Original TextBenefits of ReadingReading and having access to books are things that many of us today, in the developed world should take for granted. We are made to learn to read in school but most of us dont think twice about being able to read. I would say that reading is a relaxing and enjoyable activity, but many people dont like reading. It is because they think that book is unimportant or maybe because we are in the digital age of information with various media, video, and other entertainment being widely available. Whatever the reason is, it seems that now less people are reading books. In my opinion we must spend some of our time for reading. If you dont have money to buy some books there will always be a library near your place, because reading books whether fictions or non-fictions has many benefits for us. By reading books we can improve our memorizing skill, get more knowledge, and have an enjoyable and relaxing activity.

Firstly, Reading books will improve our memorizing skill. For us, being able to memorize things faster and longer is important, it will make our study easier because we will remember the material easily, and when the teachers are explaining their lesson we can remember the material faster so we will not be left behind when the teachers are explaining it fast. Many studies show if you dont use your memory, you will lose it. Crossword puzzles are an example of a word game that staves off Alzheimers. Reading, although it is not a game, helps you stretch your memory muscles in a similar way. Reading requires remembering details, facts, literature, plot lines, themes and characters. While reading, we will unconsciously memorize the plotline and the character of the story, it was proved by the fact that someone who reads books will almost remember all the contents of the book such as the plotline or characters. By how often you read books in a day or a week or maybe a month your memory will be trained and it will definitely increase your memorizing ability. As your memorizing skill increases you will definitely be able to memorize things faster and longer.

Secondly, its no secret that reading books get you more knowledge. Finding a new vocabulary, new information about the world, and many more. Reading expands your horizon of information. Youll always have something to talk about. You can discuss various plots in the novels you read, you can discuss the stuffs you are learning in the business books you are reading as well. The possibilities of sharing become endless. For most people studying and getting knowledge are something you do at school or when you do your homework at home. Those people dont know that reading books is an excellent way to get more knowledge. In fact, those who read books have higher scores in school or university, higher intelligence, and know more general knowledge. Its no matter what books you read whether non-fiction or fiction there will be new things that you learn. Knowledge is important because no matter what you want to be, you cant do it without more knowledge. Reading makes you smarter and keeps giving you knowledge and it also keeps your mind sharp as you age.

Lastly, besides improving memory and knowledge, reading books in fact can be a relaxing and enjoyable activity. When you have nothing to do and are too lazy to go out, books can be the alternative to help you enjoy and relax at home. I am sure that all of us will feel bored when there is nothing to do or there isnt anybody we can talk to, but we could get rid of our boredom by playing with friends or maybe hang out with friends. Actually other than those options there is an option that doesnt use energy and we can also relax our muscles from any tiring day and the option is to read books. It improves our memory, gives us more knowledge, and at the same time it can be a relaxing and enjoyable activity. Reading can also help us escape from a stressful day. It really doesn't matter what book you read, by losing yourself in a thoroughly engrossing book you can escape from the worries and stresses of everyday life and spend a while exploring the domain of the author's imagination.

Reading books is important. Books are the bank of knowledge. You can always improve your knowledge by reading and it still has many benefits for us. Even if you dont have money to spend, there will always be a library or maybe a friend of yours which is willing to lend you a book. In my opinion reading books whether it is a fiction or non-fiction has many benefits for us. Because by reading books we can improve our memorizing skill, get more knowledge, and have an enjoying and relaxing activity.

Standard IPA transcriptionrid nd hv kss tu bks z t mni v s tde, n dvlpt wld d tek f grntd. wi med tu ln tu rid n skul bt mst v s dnt k twas bat bi ebl tu rid. a wd se t rid z rlks nd nbl ktvti, bt mni pipl dnt lak rid. t z bkz e k t bk z nmptnt mebi bkz wi r n dtl e v nfmen w vers md, vd, nd r nttenmnt bi wadli velbl. wtv rizn z, t simz t na ls pipl rid bks. n ma pnjn wi mst spnd sm v a tam f rid. f ju dnt hv mni tu ba sm bks e wl lwez bi labrri n j ples, bkz rid bks w fknz nn-fknz hz mni bnfts fr s. ba rid bks wi kn mpruv a mmraz skl, gt m nl, nd hv n nbl nd rlks ktvti.

fstli, rid bks wl mpruv a mmraz skl. fr s, bi ebl tu mmraz z fstr nd lgr z mptnt, t wl mek a stdi iz bkz wi wl rmmb mtrl izli, nd wn tiz r ksplen e lsn wi kn rmmb mtrl fst s wi wl nt bi lft bhand wn tiz r ksplen t fst. mni stdiz f ju dnt juz j mmri, ju wl luz t. krswd pzlz r n gzmpl v wd gem t stevz f Alzheimer's. rid, l t z nt gem, hlps ju str j mmri mslz n sml we. rid rkwaz rmmbr ditelz, fkts, ltr, plt lanz, imz nd krktz. wal rid, wi wl nknsli mmraz plotline nd krktr v stri, t wz pruvd ba fkt t smwn hu ridz bks wl lmst rmmbr l kntnts v bk s z plotline krktz. ba ha f()n ju rid bks n de r wik mebi mn j mmri wl bi trend nd t wl dfntli nkris j mmraz blti. z j mmraz skl nkrisz ju wl dfntli bi ebl tu mmraz z fstr nd lg.

skndli, ts n sikrt t rid bks gt ju m nl. fand nju vkbjlri, nju nfmen bat wld, nd mni m. rid kspndz j hrazn v nfmen. jul lwez hv sm tu tk bat. ju kn dsks vers plts n nvlz ju rid, ju kn dsks stfs ju ln n bzns bks ju rid z wl. psbltiz v er bkm ndls. f mst pipl stdi nd gt nl sm ju du t skul wn ju du j hmwk t hm. z pipl dnt n t rid bks z n kslnt we tu gt m nl. n fkt, z hu rid bks hv ha skz n skul junvsti, har ntlns, nd n m nrl nl. ts n mt wt bks ju rid w nn-fknr fkn e wl bi nju z t ju ln. nl z mptnt bkz n mt wt ju wnt tu bi, ju knt du t wat m nl. rid meks ju smtr nd kips gv ju nl nd t ls kips j mand p z ju e.

lstli, bsadz mpruv mmri nd nl, rid bks n fkt kn bi rlks nd nbl ktvti. wn ju hv n tu du nd tu lezi tu g at, bks kn bi i ltntv tu hlp ju n nd rlks t hm. a m t l v s wl fil bd wn er z n tu du er znt nbdi wi kn tk tu, bt wi kd gt rd v a bdm ba ple w frndz mebi h at w frndz. kli n z pnz er z n pn t dznt juz ni nd wi kn ls rlks a mslz frm ni tar de nd i pn z tu rid bks. t mpruvz a mmri, gvz s m nl, nd t sem tam t kn bi rlks nd nbl ktvti. rid kn ls hlp s skep frm strsf()l de. t rli dznt mt wt bk ju rid, ba luz jslf n rli ngrs bk ju kn skep frm wriz nd strsz v vrde laf nd spnd wal ksplr dmen v i z mnen.

rid bks z mptnt. bks bk v nl. ju kn lwez mpruv j nl ba rid nd t stl hz mni bnfts fr s. ivn f ju dnt hv mni tu spnd, e wl lwez bi labrri mebi frnd v jz w z wl tu lnd ju bk. n ma pnjn rid bks wr t z fkn nn-fkn hz mni bnfts fr s. bkz ba rid bks wi kn mpruv a mmraz skl, gt m nl, nd hv n n nd rlks ktvti.

Case Study IPA transcription

ridndhvksstubkstztmnivstude,ndvlptwlddtekfgrntd.wimedtulnturidnskulbtmstvsdnttktwasbatbieblturid.awdsetridzrlkzndnblktvti,btmnipipldntlakrid.tzbkzetk tbkznmptntmebibkzwirndtlevnfomenwversmd,vd,ndrnttenmntbiwadlivelbl.wtvriznz,tsimztnalspiplridbks.nmapnjnwimstspndsmvatamfrid.fjudnthvmnitubasmbksewllwezbilabrrinjples,bkzridbkswfks.nznnfks.nzhzmnibnftsfrs. baridbkswiknmpruvammrazskl,gtmnl,ndhvnnblndrlksktvti.

fstli,ridbkswlmpruvammrasskl.frs,biebltummraztzfstrndlgrzmptnt,twlmekastdiizbkzwiwlrmmbmtrlizli,ndwntizrksplenelsnwiknrmmbmtrlfstswiwlntbilftbhandwntizrksplentfst.mnistdizfjudntjuzjmmri,juwlluzt.kswdpzlzrngzmplvwdgemtstevzfAlzheimer's.rid,ltzntgem,hlpsjustrjmmrimslznsmlwe.ridrkwazrmmbrditelz,fkts,ltr,pltlanz,imzndkrktz.walrid,wiwlnknslimmrazplotlinendkrktrvstri,twzpruvdbafkttsmwnhuridzbkswllmstrmmbrlkntntsvbkszplotlinekrktz.bahaf()njuridbksnderwikmebimnjmmriwlbitrendndtwldfntlinkrisjmmrasblti.zjmmrassklnkriszjuwldfntlibiebltummraztzfstrndlg.

skndli,tsnsikrttridbksgtjumnl.fandnjuvkbjlri,njunfomenbatwld,ndmnim.ridkspndzjhoraznvnfmen.jullwezhvsmtutkbat.jukndsksverspltsnnvlzjurid,jukndsksstfsjulnnbznsbksjuridzwl.psbltizverbkmndls.fmstpiplstdindgtnlsmjudutskulwnjudujhmwkthm.zpipldntntridbksznkslntwetugtmnl.nfkt,zhuridbkshvhaskznskuljunvsti,harntlns,ndnmnrlnl.tsnmtwtbksjuridwnnfks.nzfks.nzewlbinjutztjuln.nlzmptntbkznmtwtjuwnttubi,jukntdutwatmnl.ridmeksjusmtrndkipsgvjunlndtlskipsjmandpzjue.

lstli,bsadzmpuvmmrindnl,ridbksnfktknbirlkzndnblktvti.wnjuhvnttudundtulesitugat,bksknbiiltntvtuhlpjunndrlksthm.amtlvswlfilbdwnerzntuduerzntnbdiwikntktu,btwikdgtrdvabdmbaplewfrndzmebihatwfrndz.klinzpnzerznpntdzntjuznindwiknlsrlksamslzfrmnitardendipnzturidbks.tmpruvzammri,gvzsmnl,ndtsemtamtknbirlkzndnblktvti.ridknlshlpsskepfrmstrsf()lde.trlidzntmtwtbkjurid,baluzjslfnrlingrsbkjuknskepfrmwrizndstrszvvrdelafndspndwalksplrdmenvizmnen.

ridbkszmptnt.bksbkvnl.juknlwezmpruvjnlbaridndtstlhzmnibnftsfrs.ivnfjudnthvmnituspnd,ewllwezbilabrrimebifrndvjzwzwltulndjubk.nmapnjnridbkswrtzfknnn-fknhzmnibnftsfrs. bkzbaridbkswiknmpruvammrazskl,gtmnl,ndhvnnndrlksktvti.

1