Sugar Bowl covers
Transcript of Sugar Bowl covers
2012 SugarBowl
Michigan Game Notes, Updated Player Bios, Updated Record Book & Bowl History
MICHIGAN VS. VIRGINIA TECHJANUARY 3, 2012
MERCEDES-BENZ SUPERDOME - NEW ORLEANS, LA.
20112011Big Ten & National Honors
HEAD COACH BRADY HOKE2011 Big Ten Hayes-Schembechler and
Dave McClain Coach of the YearEddie Robinson, Bear Bryant and Liberty
Mutual National Coach of the Year Finalist
JUNIOR/SOPHOMORE OFFENSIVE TACKLE
TAYLOR LEWAN2011 All-Big Ten
Second Team (coaches)
JUNIOR QUARTERBACK DENARD ROBINSON2011 All-Big TenSecond Team (media)
SENIOR CENTERDAVID MOLK
2011 Rimington Trophy2011 Walter Camp, FWAA
All-America First Team2011 Big Ten Rimington-Pace O� ensive Lineman of the Year
SENIOR DEFENSIVE TACKLEMIKE MARTIN2011 All-Big TenSecond Team (media & coaches)
MICHIGAN FOOTBALL GAME NOTES PAGE 1
2011 SCHEDULE AND RESULTSDATE................ RANK ............ OPPONENT ..................... RESULT ..........TIME .................TV ........................... ATTEND.Sept. 3 ............. - / - ................ western Michigan .......... w, 34-10 ........3:36 p.m. ..........ABC ......................... 110,506Sept. 10 ........... - / - ................ Notre Dame .................... w, 35-31 ........8:12 p.m. ..........ESPN ....................... 114,804Sept. 17 ........... - / - ................ Eastern Michigan ........... w, 31-3 .......... 12:01 p.m. .......BTN ......................... 110,343Sept. 24 ........... 22 / - ............. San Diego State ............. w, 28-7 .......... 12:01 p.m. .......BTN ......................... 110,707Oct. 1 ............... 19 / - ............. Minnesota* ..................... w, 58-0 .......... 12:01 p.m. .......BTN ......................... 111,106Oct. 8 ....................12 / - ..................at Northwestern * ............... W, 42-24............ 7:01 p.m. .............BTN .................................... 47,330Oct. 15 .................11 / 23 ..............at Michigan State * ............. L, 14-28 ............. 12:01 p.m. ..........ESPN .................................. 77,515Oct. 29 ............ 17 / - ............. Purdue (HC) * ................. w, 36-14 ........ 12:01 p.m. .......ESPN2 ..................... 112,115Nov. 5 ...................13 / - ..................at Iowa * ................................. L, 16-24 ............. 12:01 p.m. ..........ESPN .................................. 70,585Nov. 12.................22 / - ..................at Illinois * .............................. W, 31-14............ 3:36 p.m.. ............ABC .................................... 60,670Nov. 19 ............ 20 / 17 .......... Nebraska * ...................... w, 45-17 ........ 12:03 p.m. .......ESPN ....................... 113,718Nov. 26 ............ 17/ - .............. Ohio State * .................... w, 40-34 ........ 12:07 p.m. .......ABC ......................... 114,132Jan. 3 ....................13/ 17 ..............vs. Virginia Tech .................................................. 8:30 p.m. .............ESPN ................................................All Times Eastern* Big Ten GamesHome Games Bold at Michigan StadiumRank (U-M / Opponent) from the Associated Press Top 25 Poll
RELEASE NO. 13- JANUARY 3, 2012 MICHIGAN FOOTBALL GAME NOTES
11 NATIONAL TITLES 41 BOwL GAME APPEARANCES 42 BIG TEN TITLES 132 YEARS OF MICHIGAN FOOTBALL
2 0 1 1 M I C H I G A N F O O T B A L LHAIL TO THE VICTORS VALIANT HAIL TO THE CONQU’RING HEROES
ATHLETIC MEDIA RELATIONS • 1100 SOUTH STATE STREET • ANN ARBOR, MICHIGAN • OFFICE (734) 763-4423 • FAX (734) 647-1188 • MGOBLUE.COM
DID YOU KNOw?•TheSugarBowlwillmarkthefirst-ever meeting between the Wolverines and Hokies.• The 2011 Wolverines became the first U-M team since 1917 to win eight home games and the first to win eight home gamesinMichiganStadiuminaseason.• in Big Ten play, U-M led the confer-ence in rushing defense (115.6 yardsper game) and opponent third-down percentage (30.1%, 31 of 103) .• in Big Ten play, U-M ranked 2nd in point differential (+127) and points scored (282 points) and allowed the 4th-fewest points (155 points) .• Quarterback Denard Robinson isnow 6th in Michigan history with 38TD passes and 5th with 35 TD runs.Robinsonranks8thinschoolhistoryinpassing yards (4,814) and8th in rush-ingyards(3,216).•Robinsonranks1stintheFBSinyardsper completion (15.46 yards). BaylorQB-Robert Griffin (14.97) ranks 2nd.•Denard Robinson ranks 2nd amongFBSQBsinrushingyardswith1,163.• Fitzgerald Toussaint and DenardRobinson each has led the Wolverines inrushinginsixgamesthisseason.• Brady Hokebecame the 8th head coach to direct a team to a BCS bowl in his first season with a team.
#17/#11 Virginia Tech Hokies (11-2, 7-1 ACC) vs. #13/#12 Michigan wolverines (10-2, 6-2 Big Ten Conference)
GAME 13: Tuesday, January 3, 2012 • 8:30 EST/7:30 CSTMercedes-Benz Superdome (73,208), New Orleans, La.
Series vs. Virginia Tech: First MeetingTelevision: ESPN
Radio: Michigan Sports NetworkLive Stats: MgoBlue.com
teLeViSiOn cOVerage
ESPN - 8:30 EST/7:30 CSTPlay-by-Play-BradNessler
ColorAnalyst-ToddBlackledgeSidelineReporter-HollyRowe
raDiO cOVerage
The Michigan Football Radio Network is comprised of 36 affiliatesinadditiontoArmedServicesRadioandSirius/XM.FrankBeckmannhandlesplay-by-playwithJimBrandstatterservingasthecoloranalyst.DougKarschprovidessidelinereports. ESPN Radio will broadcast the game with Sean McDonough (play-by-play),MattMillen (color analyst) andHeatherCox(sidelinereporter).
gOing BOwLing
• The Wolverines are making their 41st all-time bowlappearance (19-21 record).•Michiganwill bemaking its 35th January bowl appear-anceandwillplayinaJanuarybowlgameforthe13thtimein the past 15 bowl trips.•ThiswillbethesecondtimethatU-Mplays intheSugarBowl.Thepreviousgamewasa9-7losstoAuburnonJan.2, 1984.
wOLVerineS anD the hOkieS...•ThiswillbethefirstmeetingbetweenMichiganandvirginiaTech. •BothteamsareBCSat-largeselections.U-MisrankedNo.13in the BCS polls, while the Hokies enter ranked No. 11.• Michigan has compiled a 1-1 record all-time against theAtlantic Coast Conference (ACC) in bowl games. The most recentmatch-upwiththeACCcameinthe1994HallofFameBowl,a42-7victoryoverNorthCarolinaStateonNewYear’sDay.Michiganlosta17-15affairtoNorthCarolinainthe1979Gator Bowl.•U-Mhasan18-3all-timerecordagainstschoolsfromtheACC.
wOLVerineS faceD tOugh ScheDuLe in 2011• Michigan is the nation’s lone team participating in thebowlseasonthatfaced10bowl-boundopponentsduringtheregularseason.•U-M’seightwinsagainstteamsplayinginbowlgamestiesfor the most with LSU and Oklahoma State.• Michigan’s 12 regular-season opponents compiled an82-63regular-seasonrecord.Tenofthoseopponentsearnedbowl bids.•NineofU-M’s10winscameagainstteamswith6+victories.
teLeViSiOn cOVerage wOLVerineS anD the hOkieS...
GAMEDAY QUICK HITS
TABLE OF CONTENTSgameDayinformation ......................1QuickFacts .........................................2-3Tale of the Tape.. ..................................4Statistical Rankings .............................8U-M Record When ... ........................ 12Startinglineups ............................... 14DepthChart ........................................ 15Rosters ............................................16-19BradyHoke ......................................... 20CoachingandSupportStaff ......... 21individualCareerBests .............22-23MichiganStadium ............................ 24Game Recaps ...............................25-36PlayersintheNFl ............................. 37
MICHIGAN FOOTBALL GAME NOTES PAGE 2
M I C H I G A N F O O T B A L L Q U I C K F A C T SMEDIA RELATIONSPhone: (734) 763-4423Fax: (734) 647-1188Internet Site:MgoBlue.com
Mailing Address:PublicandMediaRelationsUniversityofMichigan1100 S. State St.Ann Arbor, MI 48109-2201
ASSOCIATE A.D. DavidAblauf([email protected])
FOOTBALLJustinDickens([email protected])
SECONDARY FOOTBALL/LACROSSEMattTrevor([email protected])
PUBLICATIONSBarbCossman([email protected])
MEN’S BASKETBALL/MEN’S AND wOMEN’S GOLFTomWywrot([email protected])
wRESTLING/MEN’S AND wOMEN’S TENNISleahHoward([email protected])
wOMEN’S BASKETBALL/wOMEN’S wATER POLOZenalewis([email protected])
BASEBALL/FIELD HOCKEYKentReichert([email protected])
wOMEN’S GYMNASTICS/wOMEN’S SOCCER/wOMEN’S SwIMMING AND DIVINGBradRudner([email protected])
ICE HOCKEY/wOMEN’S ROwINGRobTillotson([email protected])
VOLLEYBALL/SOFTBALLSarahvanMetre([email protected])
MEN’S AND wOMEN’S TRACK AND FIELD AND CROSS COUNTRY/SECONDARY MEN’S BASKETBALLWhitneyDixon([email protected])
MEN’S SOCCER/MEN’S SwIMMING AND DIVING/MEN’S GYMNASTICSScottKemps([email protected])
DIRECTOR OF INTERNETJonRipperger([email protected])
INTERNETMattBaumer([email protected])
OFFICE MANAGERTaraPreston([email protected])
ADMINISTRATIVE ASSISTANTJoanMedrich([email protected])
UNIVERSITY INFORMATION
School:UniversityofMichiganLocation: Ann Arbor, Mich.Enrollment: 41,942Founded: 1817University President:MarySueColemanDirector of Athletics:DaveBrandonNickname: WolverinesColors:MaizeandBlueBand: Michigan Marching BandFight Song: The VictorsConference: Big Ten
FOOTBALL INFORMATION
First Year of Varsity Status: 1879All-Time Record: 894-310-36 (132nd season)All-Time Big Ten Record: 473-186-18 (105th season)National Titles: 11Big Ten Championships: 42Bowl Games (Record): 40 (19-21)Consensus All-Americans: 78First-Team All-Big Ten Selections: 393
MICHIGAN STADIUM
Completed: 1927 (85th season)Stadium Capacity: 109,901Surface:FieldTurf(artificial)Largest Crowd (Opp., Year):114,804(NotreDame,2011)Record at Michigan Stadium: 392-120-15Consecutive 100,000-plus Crowds:238(Nov.8,1975tocurrent)
2011 SEASON IN REVIEw
Overall Record: 10-2 (.833)Big Ten Record: 6-2 (.750)Home: 8-0 / Away: 2-2 / Neutral: 0-0
MICHIGAN HEAD COACHES
BradyHoke ......................... 2011-present ............10-2 ............. (.833)RichRodriguez .................. 2008-10 .......................15-22 ........... (.405)lloydCarr ............................ 1995-2007 ..................122-40 ........ (.753)garyMoeller ....................... 1990-94 .......................44-13-3 ....... (.758)Bo Schembechler ............. 1969-89 .......................194-48-5 .... (.796)BumpElliott ........................ 1959-68 .......................51-42-2 ....... (.547)Bennie Oosterbaan .......... 1948-58 .......................63-33-4 ....... (.650)Fritz Crisler .......................... 1938-47 .......................71-16-3 ....... (.806)HarryKipke ......................... 1929-37 .......................46-26-4 ....... (.632)Tad Wieman ........................ 1927-28 .......................9-6-1 ............ (.594)George Little ...................... 1924 .............................6-2 ................ (.750)FieldingYost ....................... 1901-23, 1925-26 ....165-29-10 .. (.833)Biff Lea .................................. 1900 .............................7-2-1 ............ (.750)gustaveFerbert ................. 1897-99 .......................24-3-1 ......... (.875)William Ward ...................... 1896 .............................9-1 ................ (.900)WilliamMcCauley ............. 1894-95 .......................17-2-1 ......... (.875)FrankBarbour .................... 1892-93 .......................14-8 ............. (.636)M.Murphy/F.Crawford ... 1891 .............................4-5 ................ (.444)
FOOTBALL HISTORY
FirstYearofFootball .......................................................................1879All-Time Record .......................................................894-310-36 (.735)All-Time Conference Record ...............................473-186-18 (.712)All-Time Bowl Record .......................................................19-21 (.475)
National Championships ................................................................... 111901, 1902, 1903, 1904, 1918, 1923, 1932, 1933, 1947, 1948, 1997
Conference Championships ............................................................. 421898, 1901, 1902, 1903, 1904, 1906, 1918, 1922, 1923, 1925, 1926, 1930, 1931, 1932, 1933, 1943, 1947, 1948, 1949, 1950, 1964, 1969, 1971, 1972, 1973, 1974, 1976, 1977, 1978, 1980, 1982, 1986, 1988, 1989, 1990, 1991, 1992, 1997, 1998, 2000, 2003, 2004
Bowl Appearances ............................................................................... 411901, 1947, 1950, 1964, 1969, 1971, 1975, 1976, 1977, 1978, 1979, 1980, 1981, 1982, 1983, 1984, 1985, 1986, 1987, 1988, 1989, 1990, 1991, 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2010, 2011
Undefeated Seasons ........................................................................... 231879, 1880, 1884, 1885, 1886, 1887, 1898, 1901, 1902, 1903, 1904, 1910, 1918, 1922, 1923, 1930, 1932, 1933, 1947, 1948, 1973, 1992, 1997
10+ Win Seasons ................................................................................... 261898, 1901, 1902, 1903, 1904, 1905, 1947, 1971, 1972, 1973, 1974, 1976, 1977, 1978, 1980, 1985, 1986, 1989, 1991, 1997, 1998, 1999, 2002, 2003, 2006, 2011
MostConsecutiveWins .........29 (Sept. 28, 1901 – Oct. 31, 1903)All-Time Points Scored ..............................30,834(No.2nationally)First-Team All-Americans ...................................125(78consensus)First-TeamAll-BigTenPlayers ................393 (No. 1 in the Big Ten)HeismanTrophyWinners ................................. 3 (1941, 1991, 1997)YearswithU-MPlayerinHeismanTop10..................................... 26National Award Winners ..................................................................... 11College Football Hall of Fame Members ....................................... 35All-TimeNFlDraftPicks ..................................337 (two No. 1 picks)All-TimeFirstRoundPicks .................................................................. 50Michigan on TV ............431games;282-141-8(No.1nationally)First TV Game .......... U-M 55, MSU 0 (Sept. 27, 1947 on WWJ-TV)
MICHIGAN FOOTBALL BY DECADE
2010s ..........................................................................................17-8 (.680)2000s ................................................................................... 81-43-0 (.653)1990s ................................................................................... 93-26-3 (.775)1980s ................................................................................... 90-29-2 (.752)1970s ................................................................................... 96-16-3 (.848)1960s ................................................................................... 55-40-0 (.579)1950s ................................................................................... 52-36-3 (.588)1940s ................................................................................... 74-15-3 (.821)1930s ................................................................................... 53-26-4 (.663)1920s ................................................................................... 58-16-4 (.769)1910s ................................................................................... 52-18-6 (.723)1900s ......................................................................................82-8-3 (.898)1890s ................................................................................... 72-20-2 (.777)1880s (no games in 1882) ..............................................18-9-0 (.667)1879 .......................................................................................... 1-0-1 (.750)Overall ...................................................... 894-310-36 (.735)
MICHIGAN FOOTBALL GAME NOTES PAGE 3
M I C H I G A N F O O T B A L L M E D I A I N F O R M A T I O NINSIDE MICHIGAN FOOTBALL RADIO SHOw
HeadCoachBradyHokewillappearontheinsideMichiganFootballRadioShowat7p.m.EST,onSun.,Jan1,attheNewOrleansMarriott.Thehour-longshoworiginatesonWXYTRadio.DougKarschwillfillinforhostJimBrandstatteronthe show.
City Station Dial Pos.Alma ....................................................WFYC .....................1280 AMAlpena ................................................ WATZ .....................1450 AMAnn Arbor ..........................................WTKA .....................1050 AMBattle Creek ......................................WBCK ...................... 930 AMBenton Harbor ................................. WSJM .....................1400 AMCassopolis ......................................... WGTO ..................... 910 AMDetroit ................................................WXYT .....................1270 AMIshpeming ......................................... WIAN......................1240 AMLansing ............................................... WLMI ......................92.9 FMMarquette .........................................WDMJ ....................1320 AMSaginaw.............................................. WSGW .................... 790 AM
TraverseCity ..................................... WTCM ..................... 580 AM
MICHIGAN RADIO NETwORKIn its ninth season as a division of IMG College, the Michigan Sports Network represents one of the larg-est and most-listened to college sports network in the Midwest.AnchoredbyWWJ-AM(950)inDetroit,theMichigan Radio Network is comprised of 36 affiliate sta-tionsthatcoverthestateofMichiganduringfootballseason. In addition, U-M football can also be heard on American Armed Forces Radio and is also available onSirius/XM.FrankBeckmann(play-by-play)andJimBrandstatter(color)bringtheactiontoyoufromthebooth,withDougKarschprovidingsidelinereportsandanalysis.Followingisalistofradioaffiliates:
City Station Dial Pos.Alma ....................................................WQBX ....................104.9 FMAlpena ................................................ WATZ .....................1450 AMAnn Arbor ..........................................WTKA .....................1050 AMAnn Arbor .......................................... WWWW ................102.9 FMBattle Creek ......................................WBXX .....................104.9 FMBenton Harbor ................................. WSJM .....................1400 AMBig Rapids ......................................... WBRN ....................1460 AMBig Rapids ......................................... WBRN-FM .............107.7 FMCadillac ............................................... WATT......................1240 AMCassopolis ......................................... WGTO ..................... 910 AMCharlevoix .........................................WMKT ....................1270 AMDetroit ................................................ WWJ ........................ 950 AMEscanaba ............................................WDBC ..................... 680 AMFlint ......................................................WTRX .....................1330 AMGrand Haven .................................... WGHN ...................1370 AMGrand Rapids....................................WOOD ...................1300 AMIshpeming ......................................... WIAN......................1240 AMJackson ...............................................WKHM .................... 970 AMKalamazoo ........................................ WNWN ..................1560 AMKalamazoo ........................................ WQLR .....................1660 AMLansing ............................................... WLMI ......................92.9 FMludington..........................................WKZC ......................94.9 FMMarineCity........................................WHlX .....................1590 AMMarquette .........................................WDMJ ....................1320 AMMuskegon .........................................WOOD ...................106.9 FMNewberry ...........................................WNBY ....................1450 AMNiles ..................................................... WNIL ......................1290 AMOscoda ............................................... WWTH ...................100.7 FMPetoskey .............................................WMKT .....................92.1 FMPortHuron ........................................ WHLS .....................1450 AMReedCity ........................................... WBRN .....................95.1 FMRogersCity ........................................WHAK ..................... 980 AMRogersCity ........................................WHAK .....................99.9 FMSaginaw.............................................. WSGW .................... 790 AMSaultSte.Marie ...............................WKNW ...................1400 AMTraverseCity ..................................... WTCM ..................... 580 AMU-M football can also be heard on American Armed Forces Radio and is also available on Sirius Satellite Radio.
INSIDE MICHIGAN FOOTBALL Inside Michigan Football, the UniversityofMichiganAthleticDepartment-ownedfootballshow,returnsforafourthseasonwiththefirstepisodeonMonday,Aug.29at6p.m.onFoxSportsDetroit.HostedbyJimBrandstatter,thehalf-hourshowwillfeatureanalysisfromheadcoachBradyHokeandbepackedwith highlights and behind-the-scenesfeaturesonMichiganfoot-ball. Inside Michigan Football will be broadcast15timesthroughouttheseason,airingeveryMonday(start time varies from 5:30-6:30 p.m.)onFSNDetroit,withre-airsonThursdayat12:30p.m.andFridayat 2 p.m. Times for Inside Michigan FootballfromtheSugarBowlwillbeannouncedatalaterdate.AdditionalairingsonFSDetroitand the Big Ten Network will be announcedlater. Unfortunately,duetoBigTenNetworkregulations,insideMichigan Football will not be availableonMgoBlue.com. Followingarethedaysandtimesthe show airs:
Station Day, Time
FSNDetroit Monday,6:30p.m.
FSNDetroit Thursday,12:30p.m.
FSNDetroit Friday,2p.m.
BigTenNetwork Wednesday,Noon
Times are Eastern
weD., Dec. 28
12:30 P.m. - Arrival at louisArmstronginter-national Airport.Press Conference:
-HeadCoachBradyHoke-KevinKoger-Mike Martin-DavidMolk
thu., Dec. 29
1 P.m.-PracticeatTu-laneUniversity(OpenFirst 15 mins.)
3 P.m. - Post-practice availability:
-HeadCoachBradyHoke-DrewDileo-MarkHuyge-Patrick Omameh-Will Heininger-Craig Roh-TroyWoolfolk
fri., Dec. 309:30 a.m. - Press Confer-ence at New Orleans Marriott Convention Center Ballroom C-F:
-Off . Coord. Al Borges-JuniorHemingway-KevinKoger-DavidMolk-DenardRobinson-FitzgeraldToussaint
1 P.m.-PracticeatTu-laneUniversity(OpenFirst 15 mins.)
6 P.m.-MidCitylanesRock‘N’Bowl(Open to Media for 20 mins.)
Sat., Dec. 31
9:15 a.m. - Press Confer-ence at New Orleans Marriott Convention Center Ballroom C-F:
-Def.Coord.gregMattison-KennyDemens-JordanKovacs-Mike Martin-Craig Roh-RyanvanBergen
Sun., jan. 1
2 P.m. - Press Confer-ence at New Orleans Marriott 2nd Floor Landing:
-HeadCoachBradyHoke-KevinKoger-DavidMolk-DenardRobinson-JordanKovacs-Mike Martin-RyanvanBergen
MOn., jan. 2
11:20 a.m. - Press Conference at New Orleans Marriott Convention Center BallroomD-F:
-HeadCoachBradyHoke
*AnyinterviewrequestsshouldbedirectedtotheUniversityofMichi-ganPublicandMediaRelations offi ce.
MeDia aVaiLaBiLitieS in new OrLeanS
MICHIGAN FOOTBALL GAME NOTES PAGE 4
G A M E N O T E S v s . V I R G I N I A T E C HTALE OF THE TAPE
2011 StatiSticS
OffenSe
Michigan categOry Virginia tech
34.2 Scoring 28.5
423.1 TotalYards 415.8
235.7 RushingOffense 188.7
187.4 Passing Offense 227.1
141.2 PassEfficiency 138.8
258 FirstDowns 274
48.4% 3rd-DownConv. 46.3%
56.3% 4th-DownConv. 47.1%
15 Sacks Allowed 15
65% RedZoneOffense(TDEff.) 53%
84 % Red Zone Offense (Scoring Eff.) 75 %
9.0 PuntReturns 10.3
19.5 KickReturns 19.8
38.3 Avg.Punting 36.8
33.7 NetPunting 33.6
10-14 Field Goals 14-20
49 Penalties 75
+6 TurnoverMargin +6
31:56 Time Of Possession 33:54
2011 StatiSticS DefenSe
Michigan categOry Virginia tech
17.2 Scoring 17.2
317.6 TotalYards 313.9
129.1 RushingDefense 107.8
188.5 PassingDefense 206.2
120.1 PassEfficiency 111.9
202 FirstDowns 209
36.1% 3rd-DownConv.Allowed 32.4%
38.9% 4th-DownConv.Allowed 31.6%
28 SacksBy 38
57% RedZoneDefense(TDEff.) 54%
69% RedZoneDefense(ScoringEff.) 68%
8.4 PuntReturns 4.1
21.3 KickReturns 21.9
40.4 Avg.Punting 39.6
36.3 NetPunting 34.0
8-10 Field Goals Against 8-16
85 Penalties 51
26:42 Opponent Time Of Possession 26:06
2011 captainS• U-M elected three seniors TE KEviNKOgER, C DAviDMOlKandDTMiKEMARTiN, as captains forthe132ndteaminschoolhistory.• The three players were selected in a vote oftheirteammatesduringfallcamp.
the LaSt tiMe Out...• Michigan overcame Ohio State leads three different times and made a final fourth-downstop late in the fourth quarter to earn a 40-34win in front of 114,132 fans, the second-largest crowdinMichiganStadiumhistory.Thetriumphended a seven-game series losing streak to the Buckeyes. Junior quarterback DENARD ROBiNSON ranfor twotouchdownsandpassed for threemoreas he totaled 337 total yards (170 rushing, 167passing). His TD passes each went to seniors:widereceiverJUNiORHEMiNgWAY,widereceiv-er MARTAviOUS ODOMS and tight end KEviNKOgER. Sophomore running back FiTZgERAlDTOUSSiANT had 120 yards on 20 carries. BothRobinsonandToussaint reached the1,000-yardrushingplateaufortheseason,markingthesec-ond time (1975) two U-M players achieved thefeat in the same season. Michigan’s defense yielded 372 yards ofoffense,butitearnedasafetyinthefirstquarterand ended the game with an interception on OSU’sfourth-and-sixtryinthefinalminutes.
OffenSiVe teaM nOteS...OffenSiVe highLightS
•Michigan’soffense isaveraging34.2pointsand423.1yardspergamein2011,235.7rushingand187.4 passing. Below are offensive rankings: rank
categOry Stat Big ten ncaa 3rd-down Eff. 48.4% 3rd 13th
rushing off. 235.7 2nd 12th
total offEnsE 423.1 3rd 34th
Points/gamE 34.2 2nd 23rd
• U-Mhastotaledover100yardsrushingin11of12games, including200+ rushing yards in sevengamesand300+yardsinfourgames.Michiganhada season-best 376 rushing yards against EasternMichigan(Sept.17),320vs.SanDiegoState(Sept.24)and363yardsvs.Minnesota(Oct.1).itmarkedthe first timeU-M rushed for 300+yards in threeconsecutivegamessince1976.• Junior quarterback DENARD ROBiNSON andsophomorerunningbackFiTZgERAlDTOUSSAiNTbecameU-M’sfirstpairof1,000-yardrusherssince1975byeachsurpassingthemarkinthewinoverOhioState.Robinsonhas1,163yardsthisseason,whileToussainthas1,011.gordonBell(1,388)andRoblytle(1,030)achievedthefeat36yearsago.
rOBinSOn finiSheS StrOng•JuniorquarterbackDENARDROBiNSONfinishedtheyearstrong.inhislasttwogames,winsoverNebraska and Ohio State, Robinson combined for 25of35passingfor347yardsand5TDswithoneinterception and rushed 49 times for 253 yardswith4TDs. Overall,Robinsoncombined for600yardsand9TDs,contributingtohiscareer-best34TDsontheseason(18passing/16rushing). He became the first Michigan player in themoderneratopostmultiplerushingandpassingTDsinback-to-backgames.
Big ten tOuSSaint• Sophomore running back FiTZgERAlDTOUSSAINT has carried the load in the Michigan backfield during BigTen play. He had 818 yardsand six touchdowns on 139 attempts in confer-ence-onlyplay.He surpassed the 100-yardmarkin five Big Ten games, including the final threeoutingswhenheaveraged150.0yardspergame.In Big Ten games, he ranked 5th with an average of102.2rushingyardspergame,whilehis5.9-yardperrushaverageranked3rd.• Toussaint’s 10 rushes of 20+-yards in 2011 aresecondonlytoWisconsin’sMonteeBall(15)intheBig Ten.
Big pLay threatS• The Maize and Blue has produced 64 playsfromscrimmagethathavechewedup20+yards,including a season-high eight vs. Ohio State.U-M had seven“big plays” against Notre Dame,NorthwesternandPurdue. Junior quarterback DENARD ROBiNSON (12)and fifth-yearwide receiver JUNiORHEMiNgWAY(11) lead theWolverines in 20+-yard plays fromscrimmage.SophomorerunningbackFiTZgERAlDTOUSSAiNThas10bigplays,whilejuniorrunningbackviNCENTSMiTHhaseight.Hemingwayisaver-aging19.9yardspercatch,whichleadstheBigTenandranks5thinthenation.ElevenofHemingway’s32receptionshavebeenfor20+yards.
pOcket preSence•U-M’soffensive line includes four starters fromthe 2010 squad. Fifth-year senior center DAviDMOlK, junior right guard PATRiCK OMAMEH, sophomore left tackle TAYlORlEWANand fifth-yearseniorrighttackleMARKHUYgEhave com-bined for 118 career starts and 131 career games on the offensive line. • in 2010, Michigan’s offensive front allowedjust11sacks,which ledtheBigTen.The linehasallowed 15 sacks in 12 games in 2011, which ties for second in the Big Ten.
OffenSiVe ScOring DriVeS•Twenty-eightofMichigan’s61offensivescoringdrives have covered 70+ yards, and 19 of thedriveshavecovered80+yards.
SLOw StarterS nO MOre•Michiganhadbeenheldwithoutapointinthefirstquarterofeachofthefirstthreegames.TheWolverines have scored a touchdown on theirfirst offensive drives in seven of the past nine gamessince. U-Mhadastreakof fiveconsecu-tivegameswithaTDonthefirstoffensivedrive,butthatstreakendedatiowa.
DefenSiVe teaM nOteS...DefenSiVe iMprOVeMent
• After allowing 35.2 points per game in 2010,Michigan’sdefenseallowed17.2pointspergameduringthe2011regularseason,ranking3rdintheBig Ten and 7th in the nation. U-M has improved from108thintotaldefensein2010(447.9ypg)to18thin2011,allowing317.6yardspergame.U-Mhasforced27turnovers in2011, includingmulti-pleturnoversinnineof12games.TheWolverines’’27 turnovers rank1st in theBigTenand tied for20th in the FBS. Michigan ranks 4th in the nation in red zone defense (24-35, 69%).
MICHIGAN FOOTBALL GAME NOTES PAGE 5
G A M E N O T E S v s . V I R G I N I A T E C H Martin anD Van Bergen cOntrOL up frOnt
• Senior defensive linemen MiKE MARTiN and RYAN vAN BERgEN have controlled the line of scrimmage as of late. Van Bergen has had a tackle for loss in the last five consecutive games, includingmultiple TFls inthe past three games. In the last five games overall, vanBergenhas22tackles,nineTFls,foursacks,twopassbreakupsandonefumblerecovery.in2011,hehas totaled career-bests with 41 tackles, 12 TFLs and three FR. He has tied career-highs with 5.0 sacks and fourPBUs. Martin has 5+ tackles in each of the past seven games. In the last five games, Martin has registered 33tackles,fourTFls,2.5sacksandonesafety. Overthepastfivegames,theduohascombinedfor 55 stops, 13 TFLs, 6.5 sacks, two PBUs, one FR and onesafety.
Making aDjuStMentS• TheWolverineshaveout-scoredtheiropponents322-136 fromthesecondquarteronand207-87in the second half.
turnOVer Margin•TheWolverineshaveforced27turnovers(1st inthe Big Ten, tied for 20th in the NCAA) and own a +6 turnovermargin.TheWolverines have forcedatleasttwoturnoversinnineof12games,includ-ing a season-high five vs. Notre Dame. Overall,U-Mhas forcedeight interceptions (by sixdiffer-entplayers)andrecovered19of24fumbles.TheWolverines’ +6 margin ranks 3rd in the Big Ten.The Wolverines had a -32 turnover margin thepreviousthreeseasons.•Elevenofthe27turnovershaveresultedinU-Mtouchdowns.
3rD-DOwn SucceSS• Michigan has converted 75 of 155 third downs(48.4%), good for 3rd-best in the Big Ten and 13th in the nation. The school record is 49.6% in 1986.• U-M’s defensehasheldopponents to 57of 158third-down conversions (36.1%), 3rd in the Big Ten. U-M held Big Ten opponents to 31 of 103 (30.1%) third-downconversions,topsinBigTenplay.
penaLtieS• Michigan has committed only 49 penalties for432yardsin12games. Michigan ranks 3rd in the Big Ten and tied for 6th in the nation in fewest penalties per game.•Michiganopponentshavecommitted85penal-tiesfor734yards,anetmarginof36penaltiesfor302yards.U-Mhasdrawnmorepenaltiesthananyother Big Ten team.
freShMan preSence On ‘D’• Michigan lists three freshmen starters on itstwo-deep, redshirt freshman linebacker JAKERYANandtwotruefreshmen,cornerbackBlAKECOUNTESS and linebacker DESMONDMORgAN. Morgan and Countess have started the pastfivegames,withMorganstartingsixoverall,whileRyanhasstarted10of12games.Morganhas38tackles over his past five games, and at least five in each of those games. Morgan ranks 5th on the team in tackles with 53, Countess ranks 2nd ontheteamwithsixPBUsandRyanranksfourthonthe team with seven tackles for loss.
Three other true freshmen also have seentime on defense: defensive end FRANK ClARK, linebacker BRENNEN BEYER and cornerback RAYMONTAYlOR.
SpeciaL teaMS nOteS...giBBOnS reBOunDS
•Afterhittingjust1of5fieldgoalsasafreshmanin2010,gibbonshas rebounded in2011,hitting10 of 14 FGs (one blocked) and 52 of 53 PATs (oneblocked).gibbonshitacareer-long43-yardfield goal vs. Ohio State 11/26 to extend theWolverines’leadtosixpointswith1:59left.
INDIVIDUAL PLAYER NOTESJeremy Gallon2011 Season•Secondontheteamincatches(30)andreceiv-ingyards(450).Hasacatchineverygame.•Hadthreecatchesfor34yards,includingsix-yardTD,vs.Nebraska.•leadsteamwith19puntreturnsfor192yards(10.1 avg).•Career-high79receivingyardsvs.Purdueonthree catches; both totals were U-M game highs.•Hadteamhighsforcatches(4)andyards(66)atMichigan State.•Career-highfivecatches(73yards)atNorthwestern.•Madefourcatchesfor46yardsinfirstcareerstart vs. Minnesota.•Made2catchesfor78yardsvs.NotreDame.Sixteen-yardTDin4thquarter,career-best64-yardcatchsetupgame-winningTD. Career•in2010,ledteaminpuntreturns(10for43yards)andkickreturns(27for589yards).
ReceivingYear GP/GS No. Yards Avg. Per/Game TD Long2010 12/0 4 49 12.3 7.0 1 202011 12/1 30 450 15.0 37.5 3 64Career 24/1 34 499 14.7 20.8 4 64
Devin Gardner2011 Season•HasseenactionatquarterbackthroughoutBigTen season.•Threwsecondtouchdownofcareeratillinois,a27-yardpasstoMartaviousOdomsin4thquarter.Alsopassedforseason-high47yardson2-of-5.•RanforatouchdownatNorthwestern.•Ranforcareer-best39yardsvs.Minnesota.Career•MadecareerdebutatquarterbackagainstConnecticut(Sept.4).•Completed7-of-10passesfor85yardsandthrewforfirstcareertouchdownagainstBowlinggreen;rushedsixtimesfor25yardsandonetouchdown(alsofirstofhiscareer).
RushingYear GP/GS Att. Yards Avg. Per/Game TD Long2010 3/0 7 21 3.0 7.0 1 92011 9/0 25 65 2.6 9.3 1 15Career 12/0 32 86 2.7 8.6 2 15
PassingYear GP/GS Comp. Att. Pct. Yards TD Int. Long2010 3/0 7 10 70.0 85 1 0 302011 9/0 11 23 47.8 176 1 1 32Career 12/0 18 33 54.5 261 2 1 32
2011 BIG TEN FOOTBALL STANDINGS
LegenDS DiViSiOn
teaM Big ten OVeraLL
Michigan State 7-1 10-3 Michigan 6-2 10-2 Nebraska 5-3 9-3 Iowa 4-4 7-5 Northwestern 3-5 6-6 Minnesota 2-6 3-9
LeaDerS DiViSiOn
teaM Big ten OVeraLL
Wisconsin 6-2 10-2 Penn State 6-2 9-3 Purdue 4-4 6-6 Ohio State 3-5 6-6 Illinois 2-6 6-6 Indiana 0-8 1-11
Big Ten Bowl Schedule
Dec. 27, 2011, Little Caesars Bowl Purduevs.Western Michigan Dec. 30, 2011, Insight Bowl Iowa vs. No. 14 Oklahoma Dec. 31, 2011, Meineke Car Care Bowl of Texas Northwesternvs.TexasA&M Dec. 31, 2011, Kraft Fight Hunger Bowl Illinois vs. UCLA Jan. 2, 2012, Ticketcity Bowl No. 22 Penn State vs. No. 19Houston Jan. 2, 2012, Capital One Bowl No. 20 Nebraska vs. No.9SouthCarolina Jan. 2, 2012, Outback Bowl No. 17 Michigan State vs. No. 16 Georgia Jan. 2, 2012, Taxslayer.com Gator Bowl Ohio State vs. Florida Jan. 2, 2012, Rose Bowl Game Presented by Vizio No. 10 Wisconsin vs. No. 5 Oregon
G A M E N O T E S
MICHIGAN FOOTBALL GAME NOTES PAGE 6
THE NATIONAL POLLSAssociated Press Media Poll (Dec. 4)
Team Record Points Previous 1. LSU (60) 13-0 1500 1 2. Alabama 11-1 1418 2 3. Oklahoma State 11-1 1400 3 4. Stanford 11-1 1283 4 5. USC 10-2 1179 9 6. Oregon 11-2 1170 8 7. Arkansas 10-2 1148 6 8. Boise State 11-1 1107 9 9. Wisconsin 11-2 1038 1510. SouthCarolina 10-2 946 1411. KansasState 10-2 829 16 12. Michigan State 10-3 733 11 13. Michigan 10-2 707 17 14. Clemson 10-3 663 2115. Baylor 9-3 656 19 16. TCU 10-2 632 18 17. Virginia Tech 11-2 591 5 18. Georgia 10-3 566 12 19. Oklahoma 9-3 386 1320. Houston 12-1 370 7 21. Nebraska 9-3 363 2022. SouthernMiss 11-2 336 24 23. West Virginia 9-3 199 22 24. Penn State 9-3 129 23 25. Florida State 8-4 49 25
USA Today Coaches Poll (Dec. 4) Team Record Points Previous 1. LSU (59) 13-0 1475 1 2. .Alabama 11-1 1399 2 3. Oklahoma State 11-1 1367 5 4. Stanford 11-1 1286 4 5. Oregon 11-2 1232 7 6. Boise State 11-1 1128 8 7. Arkansas 10-2 1112 10 8. Wisconsin 11-2 1085 12 9. SouthCarolina 10-2 971 1310. KansasState 10-2 878 15 11. Virginia Tech 11-2 835 3 12. Michigan 10-2 789 16 13. Michigan State 10-3 735 9 14. Clemson 10-3 657 21 15. TCU 10-2 631 1716. Baylor 9-3 599 1817. Houston 12-1 542 6 18. Georgia 10-3 538 14 19. Oklahoma 9-3 437 11 20. Nebraska 9-3 402 1921. SouthernMiss 11-2 366 23 22. West Virginia 9-3 278 20 23. Penn State 9-3 189 22 24. Cincinnati 9-3 94 25 25. Florida State 8-4 68 24
tracking u-M in the tOp 25 pOLLS Date AP USA Today Preseason ....................................NR ..........................NR Week 1 ..........................................NR ..........................NR Week 2 ..........................................NR ..........................NR Week 3 ..........................................22 .......................... 21 Week 4 ..........................................19 .......................... 19 Week 5 ..........................................12 .......................... 11 Week 6 ..........................................11 .......................... 10 Week 7 ..........................................18 .......................... 17 Week 8 ..........................................17 .......................... 17 Week 9 ..........................................13 .......................... 13 Week 10 .......................................22 .......................... 21 Week 11 .......................................20 .......................... 18 Week 12 .......................................17 .......................... 16 Week 13........................................13 .......................... 12
Junior Hemingway2011 Season• All-Big Ten honorable mention (coaches). • Phil Steele’sMidseasonAll-BigTen third team. • 19.9 yards/catch average leads BigTen and isfifth in NCAA.• leads U-M in receptions (32) and receivingyards(636).•Movedinto17thplaceonU-Mcareerreceivingyardslist(1,575)vs.Nebraska.•Tiedseasonhighwith5catches(64yards)atiowa.• At Northwestern, tied season high with fivecatches. Sixth career 100-yard receiving game(124),tyingforninthall-timeatU-M.•Setseasonhighwith5grabs(56yards)vs.Minnesota.• Against Notre Dame, posted career-best 165receivingyardson3catches, including1TD for43 yards. Catch and run for 77 yards set careerbestandU-M’slongestreceptionsince2007.Career•30careerstarts,including11in2011.• Became 28thWolverine to reach 1,000 careerreceivingyardsvs.ND(9/10/11).•Ofhis86careercatches,28havebeenfor20+yards.•Hassixgamesof100+receivingyards.• 2009-10 NSCA All-American Strength andConditioningAthleteoftheYearrecipient.•Redshirted2008seasonduetoillness.
ReceivingYear GP/GS No. Yards Avg. Per/Game TD Long2007 10/1 4 37 9.3 3.7 0 232008 4/1 2 41 20.5 10.3 1 332009 11/9 16 268 16.8 24.4 2 662010 10/8 32 593 18.5 59.3 4 702011 12/11 32 636 19.9 53.0 2 77Career 47/30 86 1575 18.3 33.5 9 77
Kevin Koger2011 Season•leadsteamwithfourtouchdownreceptions,whicharealsoacareerhigh.MostTDsbyaU-MtightendsinceBennieJoppruhadfivein2002.•Tiedcareerhighwithfourcatches(40yards)vs.OhioState,includingfourthquarterTDthatproved to be the decisive score.•Setseasonhighsforreceivingyards(42)andlongest single reception (40) at Illinois.•Started25thcareergameatNorthwestern.•Caughttouchdownsinback-to-backgamesforsecond time of career vs. EMU and Minnesota.Career•Two-yearstarter;hasplayedin46 career con-tests and made 30 starts.•Set career-best 4 catchesfor38yardsandoneTDinvictoryoverNotreDame(Sept.12,2009).•Sister,laShawndaThorne,playedvolleyballatMichiganandearnedvarsityletterin1991.
ReceivingYear GP/GS No. Yards Avg. P/G TD Long2008 9/3 6 93 15.5 10.3 1 352009 12/8 16 220 13.8 18.3 2 412010 13/8 14 199 14.2 15.3 2 602011 12/11 21 235 11.2 19.6 4 40Career 46/30 55 705 12.8 15.7 9 60
David Molk2011 Season•RimingtonTrophyrecipient(nation’stopcenter).•FWAAAll-Americafirstteam.•WalterCampAll-Americafirstteam.•BigTen’sinauguralRimington-PaceOffensivelinemanoftheYear.•All-BigTenfirstteam(coaches)secondteam(media).•Started25thconsecutivegamevs.OhioState.Career•Two-yearlettermanandstarteratcenter;made41 career starts at center,25consecutively.•2010All-BigTen(1stteam-coaches;2ndteam-media).HughR.RaderMemorialAwardco-recipi-entasteam’stopoffensivelinemanin2010.•2009-10NSCAAll-AmericanStrengthandConditioningAthleteoftheYearrecipient.•2010candidateforRotarylombardiAwardandtheRimingtonTrophy (finalist).•Missedeightgamesduringthe2009seasonduetofootandkneeinjuries.•Sharedthe2009SophomoreAwardastheplayerthatdisplayedtoughnessandastrongwork ethic on the field and in the locker room.•Recipientofthe2008ironWolverineAwardasthebestall-aroundconditionedplayerforthelinemengroup.
Denard Robinson2011 Season•All-BigTensecondteam(media),honorablemention (coaches)•PhilSteele’sMid-seasonAll-BigTenthirdteam•DaveyO’BrienNationalQuarterbackAward(Semifinalist)Rushing:•Ranks13thonNCAAcareerrushinglistbyquar-terbacks with 3,216 yards. Trails Fred Solomon(Tampa)by83yardsfor12thplace.•96.9yardspergame rushing is fifth in theBigTen and 29th in the FBS; 2nd among FBS QBs.•SixteenrushingTDsaresecondinBigTen,tiedfor 11th in the FBS. Fifth-best single-season rushingTDtotalatU-M.• Surpassed 1,000-yardmark vs. OSU (1,163) torecordthe30th1,000-yardrushingcampaignbyaWolverine.Alsobecame10thU-Mplayerwithmultipleseasonsof1,000yardsrushing.•Movedupto8thinU-Mannalsforrushingyards(3,216);fifthinrushingTDs(35).• Against Nebraska andOhio State, ran for 253totalyardson49carries(5.2avg.)and4TDs.•Ranformultiple touchdowns (2) for11thtimeof career vs. Ohio State; third straight game with tworushingTDs.• Has scored a rushing touchdown in 10 of 12games, including seven straight games (9/10-10/29).•Tiedseasonhighwith26carriesfor181yardsvs.OhioState.Hisfifth100-yardgameof2011and14th of his career, which is seventh-most at U-M.• Ran 21 times against SanDiego State for 200yards--3rd-best rushing total of career. OnlyotherWolverineswiththree200-yardgamesareMikeHart(5)andRonJohnson(3).ThreerushingTDsvs.SDSUtiedcareerhigh.•Fourth-bestcareerrushingeffort(198yards)on26carriesandonetouchdownvs.EMU.•Tenrushingplaysof20+yards:53,52,41,39,
MICHIGAN FOOTBALL GAME NOTES PAGE 7
G A M E N O T E S 34, 30, 28, 25, 25, 22, 22, 22.•Ownssixofthetop12single-gamerushingper-formancesbyaquarterbackinBigTenhistory.
Big ten career ruShing yarDS By QuarterBack
1. 3,895 Antwaan Randle El, Indiana 1998-20012. 3,216 Denard Robinson, Michigan 2009-3. 2,557 JuiceWilliams,illinois 2006-09Passing:•EighthinU-Mannalsforpassingyards(4,814).Sixthintouchdowns(38)andeighthincomple-tions (329).•FirstinFBSinyardspercompletion(15.46yds/completion).• Against Nebraska and Ohio State, combined25-for-35(71.4%),347yards,5TD,1iNT.•Threwforthreetouchdownsvs.OhioState,his13thcareergamewithmultipleTDpasses.•Passedfor167yardson14-of-17(.824),hisbestcompletion percentage of the season.•337yardsatNorthwesternforsecond-besttotalofcareer.Completed17of26passesandtwotouch-downs--10thcareermulti-touchdowngame.•Completedhis first11attemptsvs.Minnesotaen route to 15-of-19 passing for 169 yards andtwo touchdowns. 11 straight completions setcareer high.•Threwforcareer-high338yardsvs.NotreDame,hissecondcareer300-yardgame.• Four touchdown passes vs. Notre Dame setcareerhigh.FinalTDpasstoRoyRoundtreewonthe game with two seconds remaining.Total Offense:•FirstWolverinetoaccountforfivetouchdowns(3passing,2rushing)inOhioStateserieshistory.FivetotalTDstiedcareerhighforthirdtime.•DuringOhioStategame,becamefourthplayerinNCAAhistorywithtwoseasonsof2,000yardspassingand1,000yardsrushing.•DuringNebraskagame,became10thplayerinNCAAhistorywith3,000yardspassingand3,000yardsrushingforacareer.• During Michigan State game, became 22ndplayerinNCAAhistorywith4,000yardspassingand2,000yardsrushingforacareer.• AgainstOhio State, became the eighth playerinNCAAhistorytoscore200points(35rushingTDs)andpassfor200points(29passingTDs)ina career. Other U-M QB to do so is Rick Leach (34 rush,48pass).• Averaging 268.3 yards per game,which ranksfirstintheBigTenand29thnationally.• Tallied sixth career game with four-plus totalTDs by passing for two scores and running fortwo more vs. Nebraska.•Ownsthetopsixtotaloffensegamesinschoolhistory. 454 total yards at Northwestern (337passing,117rushing)rankthirdall-time.Hehad446totalyardsvs.NotreDame(338passing,108rushing)on9/10/11.Thetoptwomarksare502 yardsvs.ND(9/11/10)and494yardsvs.indiana(10/2/10). Robinson has 11 career games with 300+yardsofoffenseandfourwith400+yards.• Ran and passed for two touchdowns each atNorthwestern for his fifth straight game with at least three touchdowns and the 12th game ofhis career.• Five total touchdowns (4 pass, 1 run) againstNotre Dame tied career high set vs. Hoosiers(10/2/10,3pass,2run).
• Co-Big Ten Offensive Player of theWeek andRivals.comBigTenPlayerof theWeek (vs.OhioState, 11/26)• Co-Big Ten Offensive Player of the Week (vs.Nebraska,11/19).Rivals.comBigTenPlayeroftheWeek (vs. Nebraska, 11/19).•Co-BigTenOffensivePlayeroftheWeek(vs.SanDiego State, 9/24). Rivals.com BigTen Player oftheWeek(vs.SanDiegoState,9/24).•BigTenOffensivePlayeroftheWeek(vs.NotreDame, 9/10). Rivals.com National and Big Ten PlayeroftheWeek(vs.NotreDame,9/10).
career ruShingYear GP/GS Att Yards Avg. P/G TD Long2009 12/1 69 351 5.1 29.2 5 432010 13/13 256 1702 6.6 130.9 14 872011 12/12 208 1163 5.6 5.6 16 53Career 37/26 533 3216 6.0 86.9 35 87
career paSSingYear GP/GS Comp/Att. Pct. Yards TD Int. Long2009 12/0 31 14 45.2 188 2 4 382010 13/13 291 182 62.5 2570 18 11 752011 12/12 237 133 56.1 2056 18 14 77Career 37/26 559 329 58.9 4814 38 29 77
2011 gaMe-By-gaMe PASSING RUSHING C/A Yds. TD Att. Yds. TDWMU 9/13 98 0 8 46 0ND 11/24 338 4 16 108 1EMU 7/18 95 2 26 198 1SDSU 8/17 93 0 21 200 3MINN 15/19 169 2 6 51 1NW 17/26 337 2 25 117 2MSU 9/24 123 1 18 42 1PUR 9/14 170 0 15 63 1IOWA 17/37 194 2 12 55 0ILL 6/10 92 0 12 30 2NEB 11/18 180 2 23 83 2OSU 14/17 167 3 26 170 2TOTAL 133/237 2,056 18 208 1,163 16
Robinson’s 2011 Statistics/Splits3rddownrushing:49rushes,261stdowns,8TD3rddownpassing:42-74,341stdowns,4TD,2Int.4thdownrushing:8rushes,51stdowns,0TD4thQuarter:31-55for566yards,7TD,2int.FirstHalf:76-134for1,018yards,9TD,9int.SecondHalf:57-103for1,038yards,9TD,5int.
2010 gaMe-By-gaMe PASSING RUSHING C/A Yds. TD Att. Yds. TDUConn 19/22 186 1 29 197 1 ND 24/40 240 1 28 258 2UMass 10/14 241 2 17 104 1BG 4/4 60 0 5 129 2IU 10/16 277 3 19 217 2MSU 17/29 215 1 21 86 1IOWA 13/18 96 1 18 105 0PSU 11/23 190 1 27 191 3ILL 10/20 305 3 19 62 0PUR 13/21 176 1 22 68 0WISC 16/25 239 2 22 121 2OSU 8/18 87 0 18 105 0MISS ST. 27/41 254 2 11 59 0TOTAL 182/291 2,570 18 256 1,702 14
2011 AwARDSteaM•Tostitos Fiesta Bowl National Team of the Week (vs. NotreDame9/10)•Week2UnitedStatesSportsAcademy’s2011CollegeFootballgameoftheYear(vs.NotreDame9/10)
heaD cOach BraDy hOke•BigTenHayes-SchembechlerCoachoftheYear(coaches)•BigTenDaveMcClainCoachoftheYear(media)•EddieRobinsonNationalCoachoftheYearFinalist•BearBryantCoachoftheYearAwardFinalist•liberty-MutualNationalCoachoftheYearFinalist
DefenSiVe cOOrDinatOr greg MattiSOn•2011BroylesAwardFinalist(nation’stopassistant)•Rivals.comNationalCoordinatoroftheWeek(vs.Nebraska 11/19)
SeniOr DefenSiVe tackLe wiLL heininger•CapitolOneAcademicAll-District
SeniOr LineBacker BranDOn herrOn•WalterCampNationalDefensivePlayeroftheWeek(9/3 vs. Western Michigan)•BigTenDefensivePlayeroftheWeek(9/3vs.WesternMichigan)•CollegeSportsMadnessBigTenDefensivePlayeroftheWeek (9/3 vs. Western Michigan)•CFPANationalDefensivePerformerofWeek1•CFPAlinebackerPerformeroftheWeek(9/3vs.WesternMichigan)
juniOr DefenSiVe Back jOrDan kOVacS•lottiMPACTTrophy(Quarterfinalist)
SOphOMOre OffenSiVe tackLe tayLOr Lewan•All-Big Ten (second team-coaches)
SeniOr DefenSiVe tackLe Mike Martin•All-BigTen(secondteam-coachesandmedia) SeniOr center DaViD MOLk•RimingtonTrophyRecipient•WalterCampAll-Americafirstteam•FWAAAll-Americafirstteam•BigTenRimington-PaceOffensivelinemanoftheYear•All-BigTen(firstteamcoaches,secondteammedia)
juniOr QuarterBack DenarD rOBinSOn•All-BigTen(secondteam-media)•DaveyO’BrienNationalQuarterbackAward(Semifinalist)•BigTenOffensivePlayeroftheWeek(vs.NotreDame9/10)•Rivals.comNationalandBigTenPlayeroftheWeek(vs.NotreDame9/10)•CapitalOneCupPerformanceoftheWeek(vs.NotreDame9/10)•BigTenCo-OffensivePlayeroftheWeek(vs.SanDiegoState 9/24)•BigTenCo-OffensivePlayeroftheWeek(vs.Nebraska11/19)•BigTenCo-OffensivePlayeroftheWeek(vs.OhioState11/26)
SeniOr DefenSiVe enD ryan Van Bergen•BigTenCo-DefensivePlayeroftheWeek(atillinois11/12)•CFPANationalDefensivePerformerofWeek11•CFPADefensivelinemanPerformeroftheWeek(11/12at Illinois)
freShMan kicker Matt wiLe•CFPAKickoffSpecialistPerformeroftheWeek(11/12at Illinois)
MICHIGAN FOOTBALL GAME NOTES PAGE 8
G A M E N O T E SRobinson’s 2010 Passing Statistics/Splits3rdDown:43-77for537yards,5TDs,6int.4thDown:4-14for75yards,1TDFourthQuarter:35-56for437yards,2TD,2int.FirstHalf:102-165for1,540yards,13TD,7int.SecondHalf:80-129for1,028yards,5TD,4int.
2010 Season Records & Accolades• Football Writers Association of America (FWAA) All-Americanatrunningback.•FinishedsixthintheHeismanTrophyballoting.• Chicago Tribune Silver Football recipient as the Big Ten’s MvP, becoming the first sophomorequarterbacktowintheaward.Becamefirstsopho-more to win the award since Archie Griffin in 1973.•BigTenOffensivePlayeroftheYear.•ManningAwardfinalist;DaveyO’BrienandMaxwellawardssemifinalist.•SetNCAAandBigTenrecordformostrushingyardsbyaquarterback(1,702).• Became the first quarterback inNCAAhistory torush(1,702)andpass(2,570)for1,500yardsinasea-son.•Three-timeBigTenOffensivePlayeroftheWeek(Connecticut,NotreDameandindiana).• Davey O’Brien National Quarterback of theWeek(NotreDameandindiana).• Ranked as nation’s 4th-leading rusherwith anaverageof130.9yardspergame.•Ranked2ndnationallyintotaloffense,averag-ing328.6yardspergame.• Held U-M season record for total offense; ac-countedfor4,272yardson547plays.• Reset theU-M total offensive recordwith 502yards at Notre Dame (had 502 of team’s 532yards); set U-M record with 68 total plays (28rushingand40passing).•BecameonlyquarterbackinNCAAhistorytorunandpassfor200yardsintwogamesinaseason.•Had53runsover10yards,including16over20yards,andhad86firstdownsrushing,mostintheBigTen.•BecamefirstU-MquarterbacksinceScottDreis-bach(1995-96)towinhisfirstfivestarts.•WasoneofthreeFBSquarterbackstothrowfor18touchdownsandrushfor14touchdowns in2010(CamNewtonandColinKaepernick).
Statistics and Game-By-Game Notes - 2010• Went 19-of-22 passing in first career start against Connecticut, the second-highest com-pletion percentage in a single game (86.3 pct.) inteamhistory(2nd to Elvis Grbac’s90.9 pct. vs. NotreDamein 1991 (20-22)).•Setcareerhighs incompletionsandattempts,completing 24-of-40 passes for 244 yards andone touchdown against Notre Dame; recordedan 87-yard run at Notre Dame, making it thesecond-longest run against Notre Dame ever,thesecond-longestrunfromscrimmageatNotreDame Stadium and the sixth-longest play fromscrimmageinMichiganhistory.•His258rushingyardsagainsttheirishwasthebest road performance ever for a Wolverines rusherandwasthefifth-bestsingle-gameeffortinschoolhistory.•BrokehisownU-Mrecordand theBigTen re-cord for rushing yards by a quarterback in asinglegame.Hebroketheleaguerecordof217yardssetbyMikeKafkaatMinnesotaonNov.1,2008.itrankedasthe5th-mostrushingyardsbya QB in the last 15 college football seasons.
putting 2010 in perSpectiVencaa SeaSOn ruShing yarDS By a QuarterBack (BcS) Player, School Att. Yds. TDs 1. Denard Robinson, U-M (2010) 256 1,702 142. BeauMorgan,AirForce(1996) 225 1,494 18
Michigan’S SingLe-SeaSOn ruShing yarDage LiSt
Player (Year) Att. Yds. TDs1. TshimangaBiakabutuka(1995) 303 1,818 122. AnthonyThomas(2000) 319 1,733 18 3. Jamie Morris (1987) 282 1,703 14 4. Denard Robinson (2010) 256 1,702 145. ChrisPerry(2003) 338 1,674 18
SOphOMOre OffenSiVe Big ten pLayerS Of the year
year pLayer SchOOL pOS. 1985 Lorenzo White Michigan State RB1990 TicoDuckett MichiganState RB1990 Jonvaughn Michigan RB1992 TyroneWheatley Michigan RB1998 DrewBrees Purdue QB2009 JohnClay Wisconsin RB2010 Denard Robinson Michigan QB
MOSt tOtaL OffenSe - SingLe SeaSOn Big ten hiStOry
year pLayer SchOOL yarDS
2010 Denard Robinson Michigan 4,2722000 DrewBrees Purdue 4,189
Roy Roundtree2011 Season•46-yardreceptionvs.NebraskasetupU-M’sfirsttouchdownofthegame.•Setseasonhighsforcatches(4)andlongesttouchdownreception(34)atMichiganState.Had66yardsreceiving.•Setseasonhighsforyards(83)andlongest-reception (57) at Northwestern. •lonecatchvs.NotreDamewasa16-yardtouchdownreceptionthatwonthegamewithtwo seconds remaining.•BiletnikoffAwardwatch list.
Career•Hasstarted28games,23consecutively.•All-BigTensecondteam(media)in2010.Bilet-nikoff Award candidate.•Team’sactiveleaderinreceivingyards(1,714)and receptions (122). Ranks 14th in U-M career receivingyards.•ledU-Mincatches(72),receivingyards(935)andtouchdowns(7)in2010.•Ledteamwith32receptionsfor434yardsandthreetouchdowns in 2009.•SetMichigansingle-gamerecordforreceiv-ingyardsagainstillinois;hadninereceptionsfor246yardsandtwotouchdowns,includinga75-yardtouchdownreceptiononthefirstplayfrom scrimmage.•Had4gameswithover100receivingyardsin2010.•Setcareerhighwith10receptionsfor126yardsandoneTDagainstPurdue(Nov.7,2009).•CollegeFootballNews.comFreshmanAll-America honorable mention and Sporting News Freshman All-Big Ten in 2009.•HighschoolteammateofMichaelShawandBrandon Moore.
ReceivingYear GP/GS No. Yards Avg. P/G TD Long2009 11/4 32 434 13.6 39.5 3 762010 13/13 72 935 13.0 71.9 7 752011 12/12 18 345 19.2 28.8 2 57Career 36/29 121 1668 13.8 46.3 12 76
A LOOK AT THE wOLVERINES . . . STATISTICAL RANKINGS IN 2011OFFENSECategory Statistic Big Ten NCAATeam, Points/Game 34.2 2nd 23rdTeam, Total Offense 423.1 3rd 34thTeam,Rushing 235.7 2nd 12thTeam,3rdDown% 48.4% 3rd 13thTeam, Sacks Allowed 15 T2nd T24thTeam,TurnoverMargin +6 3rd T24thTeam, Penalties/Game 4.08 avg. 2nd T6thD.Robinson,Rushing 96.9avg. 5th 29thD.Robinson,RushingTDs 16 2nd T11thD.Robinson,TotalOff. 268.2avg. 1st 29thD.Robinson,Passing 171.3avg. 5th 73rdD.Robinson,TDPass.% 7.6% 2nd 12thD.Robinson,Yds/Comp. 15.46 1st 1stD.Robinson,Yds/Att. 8.67 2nd 6thF.Toussaint,Rushing 91.9 6th 40thHemingway,Rec. avg. 19.9 avg. 1st 5th DEFENSE Category Statistic Big Ten NCAATeam,TotalDefense 317.6 5th 18thTeam,ScoringDefense 17.2 3rd 7thTeam,RushDefense 129.1 2nd 35thTeam,PassDefense 188.5 6th 16thTeam,3rdDown% 36.1 3rd 29thTeam,TurnoversForced 27 1st T20thTeam,RedZoneDefense68.6% 1st T4thTeam,FumblesRec. 19 1st 2ndR. Van Bergen, Sacks 5.0 T9th --C. Roh, Sacks 4.0 T15th --R. Van Bergen, TFL 12.0 T9th T79thC. Roh, Tackles for Loss 8.0 -- --T.gordon,Fum.Forced 2 T5th --J.Kovacs,Fum.Forced 2 T5th --T.gordon,Fum.Rec. 4 1st T4th
OFFENSEOffensive Formation:ProStyleOffensive Starters Returning/Lost: 9/2Offensive Lettermen Returning/Lost: 27/9
RETURNING STARTERS FROM 2010Player Pos. Ht. wt. Year/Elig.JuniorHemingway WR 6-1 225 5thSr.KevinKoger TE 6-4 258 Sr.Taylorlewan lT 6-8 302 Jr./So.DavidMolk^ C 6-2 286 5thSr.PatrickOmameh^ Rg 6-4 300 Sr./Jr.DenardRobinson^ QB 6-0 195 Jr.MarkHuyge* RT 6-6 302 5thSr.RoyRoundtree^ WR 6-0 177 Sr./Jr.Michael Shaw* RB 6-1 195 Sr.Vincent Smith* RB 5-6 172 Jr.^started all 13 games in 2010 *split time as starter.
DEFENSEDefensive Formation: 4-3Defensive Starters Returning/Lost: 9/2Defensive Lettermen Returning/Lost: 26/13
RETURNING STARTERS FROM 2010Player Pos. Ht. wt. Year/Elig.CourtneyAvery CB 5-11 173 So.KennyDemens lB 6-1 248 Sr./Jr.J.B. Fitzgerald LB 6-3 241 Sr.J.T.Floyd% CB 6-0 185 Sr./Jr.Camgordon^ lB 6-3 222 Jr./So.JordanKovacs^ S 6-0 197 Sr./Jr.Mike Martin NT 6-2 304 Sr.CraigRoh^ lB 6-5 269 Jr.RyanvanBergen^ DT 6-6 288 5thSr.TroyWoolfolk# CB/S 6-0 191 5thSr.%injuredandmissedpartof2010season#Missedentire2010seasonduetoinjury
MICHIGAN FOOTBALL GAME NOTES PAGE 9
G A M E N O T E S Michael Shaw2011 Season•Became49thplayerinU-Mhistorytoreach1,000careerrushingyardswithfouryardsatillinois.•Carriedfivetimesfor56yardsvs.Purdue.Ranfor37-yardtouchdown.• Ran for second touchdown of season atNorthwestern;6carriesfor25yards.•Setseasonhighsforcarries (8)andyards(60)vs.Minnesota.• Rushed for a 44-yard touchdown vs. WesternMichigan -- the longest touchdown run of hiscareer.Career•Three-yearletterman;appearedin41 career games and made 12 starts.•Setcareerhighforcarries(12),yards(126)andtouchdowns(three)againstUMass(9/18/10).•HighschoolteammateofBrandonMooreandRoyRoundtree.RushingYear GP/GS Att Yards Avg. P/G TD Long2008 10/2 42 215 5.1 21.5 0 482009 9/3 42 185 4.4 20.6 2 222010 11/5 75 402 5.4 36.5 9 502011 9/1 31 201 6.5 22.3 3 44Career 39/11 190 1003 5.3 25.7 14 50
ReceivingYear GP/GS No. Yards Avg. P/G TD Long2008 10/2 6 32 5.3 3.2 1 82009 9/3 2 5 2.5 0.5 0 112010 11/5 10 75 7.5 6.8 0 162011 9/1 1 12 12.0 1.3 0 12Career 39/11 19 124 6.5 3.2 1 16
Vincent Smith2011 Season•leadsU-Mbackswith10receptionsfor142yards.Team’sthird-bestrusher(293yards).•3rdontheteamwith303rushingyards.•AgainstMinnesota,becamethefirstWolverineinschoolhistorytoscoreatouchdownrunning,pass-ing and receiving in one game.•FirstrunningbackinFBStopassforaTDandhaverushingandreceivingTDssinceC.J.SpilleronNov.14, 2009 vs. N.C. State.•SixthBigTenplayertoachievetherun/pass/catchtouchdowntriosince1996.•Accumulated72yardsonsevenplaysfromscrim-magevs.Minnesota.ThrewaTDpasstoDrewDileofor17yards,scoredona28-yardscreenpassandranfivetimesfor27yards,includingthree-yardTD.•gained93yardsfromscrimmagevs.SanDiegoState:9carriesfor49yardsandonetouchdown,team-highthreecatchesfor44yards.•Ninecarriesfor118yardsvs.EMUforhissec-ondcareer100-yardgame.FirstU-Mrunningbackwith100-yardgamesinceMichaelShaw(9/18/10).
Career•Tenthall-timeatMichiganforcareerreceivingyardsbyarunningback(342).•leadsactiveU-Mrunningbackswith35 recep-tions for 354 yardsandsixtouchdowns.•48thWolverinetoearn1,000careerrushingyards.1,170yardsrank42ndinschoolhistory.•in2010,secondontheteaminrushingattempts(136)andrushingyards(601).Hadfiverushing
touchdowns.•Setcareerhighwith166rushingyardson17car-riesandoneTDvs.DelawareState(Oct.17,2009).•Caughtacareer-bestsevenpassesfor54yardsandoneTDatWisconsin(Nov.14,2009).•HighschoolteammateofBrandinHawthorneandMartaviousOdoms.
RushingYear GP/GS Att Yards Avg. P/G TD Long2009 8/0 48 276 5.8 30.7 1 372010 13/10 136 601 4.4 46.2 5 562011 11/1 49 296 6.0 26.9 2 38Career 32/11 233 1173 5.0 36.7 8 56
ReceivingYear GP/GS No. Yards Avg. P/G TD Long2009 8/0 10 82 8.2 10.3 2 212010 13/10 15 130 8.7 10.0 2 192011 11/1 10 142 14.2 14.2 2 32Career 32/11 35 354 10.1 11.4 6 32
Fitzgerald Toussaint2011 Season•Startednineof11games.Didnotplayvs.NotreDameduetoinjury.•91.2yardspergamerushingissixthintheBigTenand40thnationally.•U-M’ssecond-leadingrusher (1,011yards).Mostyards by a U-M running back sinceMike Hart in2007 (1,361).• During Ohio State game, became 31st playerin U-M history to reach 1,000 yards rushing in aseason.•U-M’stoprusherinBigTenplay(818yards).• Has rushed 76 times for 450 yards and threetouchdownsinlastthreegames.•Passed100-yardsrushingforthirdgameinarowandfifthtimeofcareerwith120yardson20car-ries vs. Ohio State.•Setcareerhighwith29carriesvs.Nebraska.138yards.Tiedcareerhighwithtwotouchdowns.•Setcareerhighforrushingyards(192)on27car-riesat illinois.Hadcareer-bestrunof65yardsonsecondplayofthegame.•Ran for170yardson20carriesvs.Purdue.Tiedcareerhighwithtwotouchdownsonrunsoftwoand59yards.• 170 rushingyardsvs.Purduewere themostbya U-M running back in a conference game sinceMikeHart’s195yardsvs.MinnesotaOct.30,2006.• Rushed for 108 yards and a touchdown on 11carriesvs.Minnesota.1stcareer100-yardgame.•Madesecondcareerstartvs.WesternMichigan.80 rushing yards on 11 carries and two touch-downs--hisfirstcollegiatemulti-touchdownper-formance.Career •Became50thWolverinewith1,000careerrushingyardsduringOSUgameonNov.26,2011.•Raneighttimesfor87yards,in2010highlightedby a 61-yard run vs. Bowling green (Sept. 25),on his first career carry. Scored first touchdownagainst BGSU.
RushingYear GP/GS Att Yards Avg. P/G TD Long2010 4/1 8 87 10.9 21.8 1 612011 11/10 174 1011 5.8 91.9 9 65Career 15/11 182 1098 6.0 73.2 10 65
wOLVERINE BITES
ROBINSON IN THE U-M RECORD BOOK• Junior quarterback DenardRobinsonhasquicklyascendedthe Michigan charts for pass-ing,rushingandtotalyards.
U-M Career Passing RecordsAttempts 1. Chad Henne (2004-07) 1,387 6. Steve Smith (1980-83) 648 7. JimHarbaugh(1983-86) 620 8. Brian Griese (1994-97) 606 9. Denard Robinson (2009-) 559 Completions 1. Chad Henne (2004-07) 828 4. Todd Collins (1991-94) 457 5. TomBrady(1996-99) 443 6. JimHarbaugh(1983-86) 387 7. Brian Griese (1994-97) 355 8. Denard Robinson (2009-) 329
Yards 1. Chad Henne (2004-07) 9,715 5. JimHarbaugh(1983-86) 5,449 6. TomBrady(1996-99) 5,351 7. Steve Smith (1980-83) 4,860 8. Denard Robinson (2009-) 4,814
Touchdowns 1. Chad Henne (2004-07) 87 2. John Navarre (2000-03) 72 3. Elvis Grbac (1989-92) 71 4. Rick Leach (1975-78) 48 5. Steve Smith (1980-83) 42 6. Denard Robinson (2009-) 38
U-M Career Rushing RecordsYards 1. Mike Hart (2004-07) 5,040 5. ButchWoolfolk(1978-81) 3,861 6. ChrisPerry(2000-03) 3,696 7. Roblytle(1973-76) 3,317 8. Denard Robinson (2009-) 3,216 Touchdowns 1. AnthonyThomas(1997-2000) 55 2. TyroneWheatley(1991-94) 47 3. Mike Hart (2004-07) 41 4. ChrisPerry(2000-03) 39 5. Denard Robinson (2009-) 35 100-Yard Games 1. Mike Hart (2004-07) 28 5. ButchWoolfolk(1978-81) 16 6. Roblytle(1973-76) 15 7. Denard Robinson (2009-) 14
U-M Career Off ense RecordsYards 1. Chad Henne (2004-07) 9,300 2. John Navarre (2000-03) 8,995 3. Denard Robinson (2009-) 8,030
2011 Rushing Game-By-Game2011 Opponent Att. Yards Avg. TD LongWestern Michigan 11 80 7.3 2 43 NotreDame DidNotPlay-injuredEastern Michigan 11 46 4.2 1 12 SanDiegoState 13 67 5.2 0 11Minnesota 11 108 9.8 1 35 at Northwestern 14 25 1.8 0 7 At Michigan State 2 7 3.5 0 4Purdue 20 170 8.5 2 59at Iowa 16 58 3.6 0 11at Illinois 27 192 7.1 1 65Nebraska 29 138 4.8 2 31Ohio State 20 120 6.0 0 26Season Total 174 1011 5.8 9 65
Defensive NotesCourtney Avery2011 Season•StartedatRCBandhadfourtacklesandonePBU in season opener.• Had two tackles and scored first career TD on83-yardfumblerecoveryvs.Minnesota;tiedleonHallforthelongestFRtouchdownreturninschoolhistory.•Had two tackles, recorded first career intercep-tionandhad0.5sackvs.Purdue.•Hadonestopforaloss,oneFRandonePBUvs.Nebraska.•Hadoneforcedfumbleandsecondcareerinter-ception vs. Ohio State; interception sealed 40-34 victory.Career•Madefirstcareerstartatillinoisin2010,contrib-utingfivetacklesandonepassbreakup.•Hadfirstcareersack(0.5)andfirstcareerinter-ceptionvs.Purduein2011.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU 2010 13/5 22-14-36 0.5-1 0-0 0-0 0-0 42011 12/2 16-8-24 1.5-13 0.5-6 2-1 2-83 3Career 25/7 38-22-60 2.0-14 0.5-6 2-1 2-83 7
Jibreel Black2011 Season•Appearedin12gamesasreserveDE.•Hadthreetacklesandfirstcareersackvs.Minnesota.•Hadonetackleand0.5sackvs.OhioState.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2010 13/0 3-4-7 0-0 0-0 0-0 0-0 02011 12/0 11-6-17 1.5-10 1.5-10 0-0 1-0 0Career 25/0 14-10-24 1.5-10 1.5-10 0-0 1-0 0
Blake Countess2011 Season•Truefreshmanissecondontheteamwithsixpasses defensed.•Hadseason-bestseventackles,fivesolo,infirstgamewithextendedplayingtimeatcornervs.SanDiegoState.•Hadfivetackles,foursolo,firstcareerforcedfumbleandtwoPBUsvs.Minnesota.•HadsixtacklesatMichiganState.•Madefirstcareerstartandhadthreetackles,includingoneforloss,vs.Purdue.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2011 11/5 24-12-36 1.0-1 0-0 0-0 0-0 6Career 11/5 24-12-36 1.0-1 0-0 0-0 0-0 6
Kenny Demens2011 Season•Started11gamesatMlBandleadsteamwith86 tackles, 45 solo; also has 5.0 TFLs, 3.0 sacks andoneforcedfumble.•Surpassed100careerstopsandhadteam-lead-ing12tackles,eightsolo,vs.NotreDame.•Tiedforteamleadwithseventacklesandhadfirstcareerforcedfumblevs.SanDiegoState.•Hadteam-leading11tackles,oneforaloss,atiowa.•Hadseventacklesandonesackatillinoisandfivestops, one PBU and a half-sack vs. Nebraska.•Hadeighttacklesand0.5sackvs.OhioState.Career•Thirdontheteamintackles(82)andtiedfor19th in the Big Ten with 6.3 tackles per game in 2010.•Madehisfirstcareerstartagainstiowain2010.•Hadacareerbest13tacklesatthegatorBowlvs. Mississippi State and vs. Wisconsin in 2010.•Receivedmedicalredshirtfor2008seasonaftersufferingseason-endinginjuryduringpractice.Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU 2009 12/0 2-5-7 0-0 0-0 0-0 0-0 02010 13/7 47-35-82 1.5-2 0-0 0-0 0-0 12011 12/12 45-41-86 5-20 3-18 0-0 0-0 1Career 37/19 94-81-175 6.5-22 3-18 0-0 0-0 2
J.B. Fitzgerald2011 Season•Appearedasreservelinebackerandspecialteamerin 11 games and has 10 tackles and one FR.•HadfirstcareerFRonKORvs.Nebraska.Career•Two-timeAcademicAll-BigTen(2009-10).•Hadacareer-highsixtacklesvs.MississippiStateinthegatorBowlincludingthefirstsackofhis career.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2008 12/0 3-5-8 0-0 0-0 0-0 0-0 02009 12/0 10-6-16 4-8 0-0 0-0 0-0 02010 13/3 14-8-22 3-21 1-19 0-0 0-0 02011 12/0 4-6-10 0-0 0-0 0-0 0-1 0Career 49/3 31-24-56 7-29 1-19 0-0 0-1 0
J.T. Floyd2011 Season•leadsU-Mcornerbackswith45tackles,leadsteamwith eight PBUs and is tied for team lead with two interceptions.•Startedvs.NotreDameandhadsixtacklesandsecond career interception.•Recorded100thcareertacklevs.Minnesota.•HadfourtacklesandforcedfumbleatMichiganState.•Hadfourtackles,oneinterceptionfor43returnyardsandtwoPBUsatillinois.Career•Missedfinalportionof2010withankleinjury.•Postedacareer-best13tacklesinback-to-backgames vs. Indiana and Michigan State in 2010.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2009 9/2 14-3-17 0-0 0-0 0-0 0-0 12010 8/8 43-23-66 2-5 0-0 1-0 0-0 42011 12/11 30-15-45 0-0 0-0 2-59 0-0 8Career 29/21 87-41-128 2-5 0-0 3-59 0-0 13
MICHIGAN FOOTBALL GAME NOTES PAGE 10
G A M E N O T E SwOLVERINE BITES
1,000 YARD CLUB•Senior/juniorwidereceiverRoyRoundtreeisU-M’sac-tiveleaderincareerreceivingyards.His1,714yardsare14th-bestfortheMaizeandBlue.•Fifth-yearseniorJuniorHemingwayranks17thforU-M.•SeniorMartaviousOdomsbecamethethirdactiveWol-verinewith1,000receivingyardsduringtheillinoisgame.
U-M Career Receiving Yards 1. BraylonEdwards(2001-04) 3,541 13. JackClancy(1963-66) 1,917 14. Roy Roundtree (2009-) 1,714 15. Steve Breaston (2003-06) 1,696 16. Jim Smith (1973-76) 1,687 17. Junior Hemingway (2007-) 1,575 18. Vince Bean (1981-84) 1,509 19. MarcusKnight(1996-99) 1,508 20 Jim Mandich 1967-69) 1,489 21. Adrian Arrington (2004-07) 1,438 22. JohnKolesar1985-88) 1,425 23. RalphClayton1976-79) 1,393 24. JerameTuman(1995-98) 1,279 25. lowellPerry(1950-52) 1,261 26. Greg Mathews (2006-09) 1,195 27. PaulJokisch(1984-86) 1,088 28. Martavious Odoms (2008-) 1,062
•JuniorrunningbackvincentSmithranks41stincareerrushing.•At illinois, senior runningbackMichaelShawbecamethe49thbacktoreachthe1,000-yardplateau.•Junior/sophomoreFitzToussainthas1,098careerrush-ingyards,1,011ofwhichhavecomein2011.
U-M Career Rushing Yards 1. Mike Hart (2004-07) 5,040 38. Gerald White (1983-86) 1,296 39. BobPerryman(1983-86) 1,247 40. DennisFranklin(1972-74) 1,212 41. Vincent Smith (2009-) 1,173 DaveRaimey(1960-62) 1,173 43. MelAnthony(1962-64) 1,144 44. Fitz Toussaint (2010-11) 1,098 45. DonDufek(1949-50) 1,094 46. DonMoorhead(1968-70) 1,091 47. Bennie McRae (1959-61) 1,037 48. Carlos Brown (2006-09) 1,025 49. Allen Jefferson (1987-90) 1,002 50. Michael Shaw (2008-) 1,001
RoyRoundtree MartaviousOdomsJuniorHemingway
Vincent Smith FitzToussaintMichael Shaw
MICHIGAN FOOTBALL GAME NOTES PAGE 11
G A M E N O T E S Cameron Gordon2011 Season•Missedfirstsixgamesoftheseasonwithabackinjury;hadonespecialteamsstopinfirstoutingofseasonatMichiganState.Career•Switchedfromreceivertosafetypriorto2010spring drills.•Startedfirstsevengamesatfreesafetyandfinalsixatstrong-sidelinebackerin2010.•AcademicAll-BigTenConference.•Blockedfirstcareerfieldgoalvs.UConnin2010.•Tiedfortheteamleadin2010ininterceptions(3),fumblerecoveries(2)andPBUs(4).•Postedacareer-best15tacklesatindiana,intercepting his second pass of the season.•Highschoolteammateoffreshmanquarter-backDevingardner.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2010 13/13 40-37-77 3.5-6 0-0 3-35 2-58 42011 6/0 2-1-3 0-0 0-0 0-0 0-0 0Career 19/13 42-38-80 3.5-6 0-0 3-35 2-58 4
Thomas Gordon2011 Season•StartedfirsteightgamesatFSandvs.Nebraska;has59tacklesandistiedfor4thinNCAAwithfourfumblerecoveries.•Hadthencareer-besteighttackles,includingone TFL, in season opening win vs. Western Mich.•Hadcareer-bestninetacklesvs.NotreDame.•Hadsixtacklesandfirstcareerinterceptionandfumblerecoveryvs.EasternMichigan.•TiedforteamleadwithseventacklesandhadoneFRandonePBUvs.SanDiegoState.•HadsixtacklesandforcedandrecoveredafumbleatNorthwestern.•ledteamwitheighttacklesandhad0.5TFland one FF at Michigan State.Career•Startedfourgamesin2010athybridlineback-erandplayedinninecontests.•HighschoolteammateofU-MdefensivetackleWill Campbell.•Three-yearstarteratquarterbackduringhisprep career at Cass Technical.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2010 9/4 13-10-23 4-24 2-21 0-0 0-0 02011 12/9 37-22-59 1.5-2 0-0 1-0 4-0 2Career 21/13 50-32-82 5.5-26 2-21 1-0 4-0 2
Brandin Hawthorne2011 Season•MadefirstcareerstartatlBvs.EasternMichiganandhadteam-leading10tackles, includingoneTFL.•Missedseasonopenerwithankleinjury;enteredas reserve lB against Notre Dame and had sixtackles and one PBU.•HadninetacklesandfirstcareerinterceptionatNorthwestern.•Hadfirstcareersackvs.Purdue.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2009 4/0 0-0-0 0-0 0-0 0-0 0-0 02010 9/0 1-0-1 0-0 0-0 0-0 0-0 02011 11/5 25-18-43 3-6 1-1 1-0 0-0 1Career 24/5 26-18-44 3-6 1-1 1-0 0-0 1
will Heininger2011 Season•Startedall12gamesondefensiveline.• Had two stops, oneTFl and first career unas-sisted sack at Iowa.• Had career-best four stops and two TFls atMichigan State; also had four stops vs. OhioState.•CapitolOneAcademicAll-Districtchoice.Career• 2008 and2009BigTenDistinguished Scholar;three-time Academic All-Big Ten Conference.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2008 5/0 0-0-0 0-0 0-0 0-0 0-0 02009 12/0 2-8-10 0.5-3 0.5-3 0-0 0-0 12010 3/0 3-0-3 0-0 0-0 0-0 0-0 02011 12/12 10-13-23 4-16 1-8 0-0 0-0 1Career 32/12 15-21-36 4.5-19 1.5-11 0-0 0-0 2
Brandon Herron2011 Season•Hadcareer-besteighttackles,94-yardinter-ceptionreturnforatouchdownanda29-yardfumblerecoveryforatouchdowninfirstcareerstart vs. Western Michigan.•BecamefirstU-Mplayerinmoderneratoscoretwodefensivetouchdownsinthesamegame.•Missedsixgamesduetoinjuryanddidnotplayatiowa.Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2008 12/0 4-3-7 0-0 0-0 0-0 0-0 02009 12/0 7-13-20 1-2 0-0 0-0 1-0 02010 7/0 4-3-7 0-0 0-0 0-0 0-0 12011 4/1 1-7-8 0-0 0-0 1-94 1-29 0Career 35/1 16-26-42 1-2 0-0 1-94 2-29 1
Jordan Kovacs2011 Season•Ranks2ndonteamwith64tackles,45solo,ranks tied for 2nd on team with 4.0 sacks.•MissedPurduegamewithkneeinjury;endedstreakof28consecutivestarts.•Hasthreefourth-downstops,includingtwoforlosses and one sack at Northwestern.•EarnedlottiMPACTPlayeroftheWeekhonorsafter he led team with 10 tackles, had two sacks for16yards,onePBUandoneforcedfumblevs.Western Michigan 9/3.•Postedeighthcareerdouble-digittackleperfor-manceandfirstmultiple-sackgamevs.WesternMichigan;alsosurpassed200careertackles.•Postedeighttacklesandfourthcareerinter-ceptionvs.NotreDame.•Hadsixsolostops,oneFRandoneQBpressureat Michigan State.•Hadfivetackles,oneforloss,andoneforcedfumbleatillinois.•Hadfourtackles,twoforlosses,andonesackvs. Ohio State.Career•All-BigTenhonorablemention(media)in2010.and 2011.•Had116stops(8.9avg.)in2010-secondintheBig Ten and tied for 42nd in the NCAA; tied for team lead with 8.5 TFLs.• Posted a career-high 17 tackles, 2.5 TFls andoneforcedfumbleagainstMichiganState(Oct.3,2009);the17stopswerethemostbyanydefend-erintheBigTenduringtheyear.Tiedcareerhigh
U-M LEADS NATION IN wINS ALL-TIME•TheMichiganfootballprogramlookstoextenditsleadinall-timeNCAADivision1FBSvictoriesandwin-ning percentage. •Michiganleadsthenationinwins(894),followedbyTexas(857)andNotreDame(853).•Michigan’s894victoriesarethemostofanyinstitu-tion in all divisions of college football.
tOp 5 BcS SchOOLS By winning percentage
School Record Pct. 1. Michigan ............................ 894-310-36 ..... .735 2. NotreDame ...................... 853-299-42 ..... .732 3. Oklahoma .......................... 818-307-53 ..... .717 4. Ohio State ......................... 836-315-53 ..... .716 5. Texas.................................... 857-330-33 ..... .716
tOp 5 BcS SchOOLS By winS
School Record Pct. 1. Michigan ............................ 894-310-36 ..... .735 2. Texas.................................... 857-330-33 ..... .716 3. NotreDame ...................... 853-299-42 ..... .732 4. Nebraska ............................ 846-348-40 ..... .702 5. Ohio State ......................... 836-315-53 ..... .716
105th Season of Big Ten Action•Michiganisinits105thseasonofcompetitionintheBig Ten Conference. •TheWolverineshavecompiledanimpressive473-186-18recordinconferenceplayandhaveclaimedaleague-leading42championships.•U-Malsoleadstheconferencewith390first-teamAll-Big Ten selections.
U-M In 132nd Season of Gridiron Action•U-Misinits132ndseasonofgridironaction.•TheWolverineprogramwasestablishedin1879whenagroupof13menfieldedthefirstfootballteaminschoolhistoryandplayedapairofoff-campusgames.U-M defeated Racine, 1-0, at White Stocking Park in Chicago,ill.,onMay30,1879,forthefirstvictoryinschoolhistory.TheWolverinestiedToronto,0-0,inDetroittofinishtheyear1-0-1.•U-Misinits129thyearofuninterruptedgridironaction,with1882beingtheonlyseasonthatthepro-gramdidnotplayanyvarsitygames.•TheWolverinesarethesixtholdestfootballprograminNCAAhistory.
OLDeSt cOLLege fOOtBaLL prOgraMS
School Years Princeton 142 Rutgers 142 Yale 139 Harvard 137 Pennsylvania 135 Michigan 132 Amherst 131 Navy 130
with 17 tackles vs. Ohio State in 2010.•Father,louis,wasadefensivebackforMichiganintheearly1980s(letteredin1982).
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2009 12/8 39-36-75 4..5-10 0-0 1-0 0-0 12010 13/13 61-55-116 8.5-24 1-8 2-51 1-0 12011 11/11 45-19-64 8-48 4-36 1-2 1-0 1Career 36/32 145-110-255 21-82 5-44 4-53 2-0 3
Mike Martin2011 Season•Hadthreetackles,includingoneforaloss,vs.NotreDame.•Hadthenseason-highsixtackles,includinghalf-sack at Northwestern, and five stops at Michigan St.•Hadseason-highseventacklesandcareer-besttwosacksvs.Purdue;onesackwasforsafety,U-M’sfirstsafetysince2003.•leddefensivelinewithsixtackles,including1.5 for losses, at Iowa.•ledteamwithseason-bestninetackles,includ-ing0.5sackforeightyards,atillinois.Career•RichardKatcherAwardwinnerasU-M’stopdefensive lineman in 2009 and 2010.•2009-10NSCAAll-AmericanStrengthandConditioningAthleteoftheYearrecipient.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2008 12/0 9-11-20 4.5-19 2-15 0-0 0-0 02009 12/12 20-31-51 8.5-26 2-8 0-0 0-0 02010 12/12 21-16-37 6-39 2.5-32 0-0 0-0 02011 12/12 16-38-54 5.5-24 3-18 0-0 0-0 0Career 48/36 66-96-161 24.5-108 9.5-73 0-0 0-0 0
Desmond Morgan2011 Season•Truefreshmanranks5thonteamintackleswith 53.•Startedfirstcareergamevs.NotreDame.•Startedsecondgamevs.Purdueandhadteam-leading and then career-best nine tackles.•Hadeighttacklesatillinois.•Hadcareer-bestandteam-leading10tacklesvs. Ohio State; also had 1.5 TFLs and first career sack.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2011 11/6 20-33-53 2-3 1-1 0-0 1-0 1Career 11/6 20-33-53 2-3 1-1 0-0 1-0 1
Craig Roh2011 Season•Hasstartedteam-leading37consecutivegames.•Ranks tied for2ndon teamwitheight tacklesforlossandfoursacks.• Had six tackles, including two for losses, atMichigan St; also registered 100th career tackle.•Hadtwotackles,bothfor losses,onesackandoneforcedfumblevs.SanDiegoState;was2ndconsecutivegamewithsack.•Hadfivetacklesandonesackvs.EasternMich.Career• Startedall 13games in2010 - eight athybridlinebacker and five at defensive end.• CollegeFootballNews.com Freshman All-America honorable mention and Sporting News Freshman All-Big Ten.•2009U-MAthleticAcademicAchievement.
•HighschoolteammateofoffensivetackleTaylorLewan.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2009 12/12 17-20-37 7.5-22 2-12 1-0 0-0 32010 13/13 28-15-43 5.5-31 0.5-5 0-0 0-0 12011 12/12 18-11-29 8-37 4-31 0-0 0-0 0Career 37/37 63-47-110 21-90 6.5-48 1-0 0-0 4
Jake Ryan2011 Season•Redshirtfreshmanhas7.0tacklesforlossand2.0 sacks.•MadefirstcareerstartatlBvs.WesternMichigan.•Totaledcareer-bestfivetackles,twofumblerecoveriesandhadthirdconsecutivegamewithatackleforlossvs.SanDiegoState.•Registeredfirstcareersackvs.Minnesota.•Hadthreetackles,0.5sackandfirstcareerFFvs. Nebraska.•Alsohadthreetacklesand0.5sackvs.OhioState.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2011 12/10 14-16-30 7-17 2-5 0-0 2-0 0Career 12/10 14-16-30 7-17 2-5 0-0 2-0 0
Ryan Van Bergen2011 Season•Hasacareer-best41tackles,12tacklesforlossandthreefumblerecoveries;hastiedcareerbestwith5sacksandfourPBUs.•5sacksand12tacklesforlossesleadsteam.•Hadcareer-best2.5sacksandcareer-hightyingseven tackles and three tackles for losses at illinois;wasnamedBigTenCo-DefensivePlayerof the Week and College Football Performance NationalDefensivePerformeroftheWeek.•Hadtwotackles,bothforloss,onesack,oneFRand one PBU vs. Nebraska.•Tiedcareerbestwithseventackles,twoforlosses, 0.5 sack and one PBU vs. Ohio State.•Hadtwotacklesandonesackvs.Minnesota;sack was 10th of career.•Hadtwotackles,oneforloss,oneforcedfumbleandonePBUvs.SanDiegoState;alsonotched 100th career tackle.•Hadtwotackles,oneforloss,andoneFRvs.NotreDame;markedsecondconsecutiveoutingwith a FR.Career•ledtheteamleadwithfoursacksandtiedforthe team lead with 8.5 tackles for loss in 2010.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2008 12/1 8-5-13 0-0 0-0 0-0 0-0 12009 12/12 20-20-40 6.5-44 5-40 0-0 0-1 42010 13/13 21-16-37 8.5-43 4-35 0-0 0-0 12011 12/11 24-17-41 12-54 5-34 0-0 1-3 4Career 49/37 73-58-131 27-141 14-109 0-0 1-4 10
Troy woolfolk2011 Season•Startedsixoffirstsevengamesatcorner.•Startednextfourgamesatsafety(vs.Purdue,at Iowa, at Illinois, vs. Ohio State).•Startedatsafetyandhadsixtacklesatiowa.Career•Sufferedseason-endingankleinjuryin2010preseason.
MICHIGAN FOOTBALL GAME NOTES PAGE 12
G A M E N O T E S2011 MICHIGAN RECORD wHEN...
Overall: .....................................................................................10-2
At Home: .................................................................................... 8-0
On the Road: ............................................................. 2-2
Neutral: ........................................................................ 0-0
ByMonth:
August: ........................................................................ 0-0
September: ................................................................ 4-0
October: ...................................................................... 3-1
November: ................................................................. 3-1
December: .................................................................. 0-0
January: ....................................................................... 0-0
When Scoring First: ................................................................ 5-1
When Opponent Scored First: ........................................... 5-1
When Scoring 20 or More Points: ...................................10-0
When Scoring Less Than 20 Points: ................................. 0-2
When Leading at the Half: .................................................. 7-0
When Trailing at the Half: .................................................... 3-1
When Tied at the Half: .......................................................... 0-1
Whenleadingafter3Quarters: ........................................ 8-0
WhenTrailingafter3Quarters: ......................................... 1-2
WhenTiedafter3Quarters: ............................................... 0-0
WhenOutrushingtheOpponent: .................................... 9-0
With35orMoreRushingAttempts: ................................ 8-2
With Less Than 30 Passing Attempts: ............................. 9-0
When Leading in Time of Possession: ............................. 8-1
When Trailing in Time of Possession: .............................. 2-1
OnTurf: ...................................................................................... 9-1
On Grass: .................................................................................... 1-1
WhenleadinginTakeaway/TurnoverRatio: ................ 6-1
WhenEveninTakeaway/TurnoverRatio: ...................... 1-0
WhenTrailinginTakeaway/TurnoverRatio: ................. 3-1
Withanindividual100-YardRusher: ............................... 9-0
Withanindividual200-YardPasser: ................................ 2-0
250-YardPasser: ....................................................... 2-0
Withanindividual100-YardReceiver: ............................ 2-0
WithanindividualOpponent100-YardRusher: ......... 3-2
WithanindividualOpponent200-YardPasser: .......... 4-0
250-YardPasser: ....................................................... 3-0
WithanindividualOpponent100-YardReceiver: ...... 3-1
MICHIGAN FOOTBALL GAME NOTES PAGE 13
G A M E N O T E S •Startedall12gamesandhadcareer-best46tackles in 2009.•Hadcareer-besteighttacklesvs.NotreDamein 2009.
Year GP/GS S-A-TT TFL Sacks Int. FF-FR PBU2007 8/0 3-2-5 0-0 0-0 0-0 0-0 22008 12/0 7-2-10 0-0 0-0 0-0 0-0 02009 12/12 30-16-46 0-0 0-0 0-0 0-0 12010 0/0 0-0-0 0-0 0-0 0-0 0-0 02011 12/10 16-13-29 0-0 0-0 0-0 0-0 2Career 44/22 56-33-90 0-0 0-0 0-0 0-0 5
wOLVERINE BITES
MIKE MARTIN• 2011 Second-Team All-Big Ten• 2011 Bednarik Award Watch List• 2011 RotarylombardiAwardWatch List• Had seven tackles, first multiple-sackgame(2.0sacks)andrecordedfirstcareersafetyvs.PurdueOct.29,2011.• 2010 All-Big Ten second team.•Recordedhis100thcareertackle vs. Wisconsin.•2009RichardKatcherAwardrecipientasMichigan’stop defensive lineman.•Recordedacareer-best51tackles,8.5TFlsandtwosacks as a starter in 2009.•Setcareerhighwith10tacklesandthreeTFlsatWisconsin (Nov. 14, 2009).•Sporting News All-Freshman second team in 2008.•AssistedonatleastoneTFlineightofthe12gamesduringthe2009season.
RYAN VAN BERGEN• 2011 Ted Hendricks Award Watch List• Made 100th career tackle vs. SanDiegoState9/24/11andregistered 10th career sack vs. Minnesota 10/1/11.•Contributed131tackles,27TFLs, 14 sacks, 10 pass break-ups,oneforcedfumblesandfourfumblerecoveriesduringhiscareer.•Scoredfirstandonlycareertouchdownona14-yardfumblerecoveryatWisconsinin2009.• Had seven tackles, three TFLs and 2.5 sacks at Illinois Nov. 12, 2011.• Tallied a career-best three TFLs, one sack and five solo stops at Ohio State (Nov. 27, 2010).
JORDAN KOVACS•2011lottiMPACTTrophySemifinalist.•Week1lottiMPACTPlayerofthe Week.•Has64tacklesandfoursacks.•RankedsecondintheBigTen with 116 tackles (8.9 avg.) in 2010 - tied for 42nd in the NCAA.•2009CollegeFootballNews.com Freshman All-America second team.•Finishedsecondontheteamwith75tacklesin2009,including4.5TFlsandoneinterception.•Posted17stopstwiceinhiscareer-atOhioStatein2010 and at Michigan State in 2009; his 17 stops were themostbyanydefenderintheconferenceduringthe2009 season.•Haseightcareerdouble-digittackleefforts.•Walk-onin2009whoearnedascholarship.
MICHIGAN FOOTBALL GAME NOTES PAGE 14
S T A R T I N G L I N E U P S2011 MICHIGAN STARTING LINEUPS • OFFENSE
OPPONENT wR LT LG C RG RT TE wR QB wR TBWesternMichigan Roundtree lewan Schofield Molk Omameh Huyge Koger grady D.Robinson Hemingway ToussaintNotreDame Roundtree lewan Barnum Molk Omameh Huyge Koger grady D.Robinson Hemingway ShawEasternMichigan Roundtree lewan Barnum Molk Omameh Huyge Koger McColgan** D.Robinson Hemingway ToussaintSanDiegoState Roundtree lewan Barnum Molk Omameh Huyge Koger Hopkins** D.Robinson Hemingway ToussaintMinnesota Roundtree lewan Schofield Molk Omameh Huyge Koger gallon D.Robinson Hemingway SmithatNorthwestern Roundtree lewan Schofield Molk Omameh Huyge Koger Watson% D.Robinson Hemingway ToussaintatMichiganState Roundtree lewan Schofield Molk Omameh Huyge Koger Watson% D.Robinson Hemingway ToussaintPurdue Roundtree lewan Schofield Molk Omameh Huyge Koger Hopkins** D.Robinson Hemingway Toussaintatiowa Roundtree lewan Schofield Molk Omameh Huyge Koger Watson% D.Robinson Hemingway Toussaintatillinois Roundtree lewan Schofield Molk Omameh Huyge Odoms# grady D.Robinson Hemingway ToussaintNebraska Roundtree lewan Schofield Molk Omameh Huyge Koger Watson% D.Robinson Odoms ToussaintOhioState Roundtree lewan Schofield Molk Omameh Huyge Koger Odoms D.Robinson Hemingway Toussaint#Denotesstartedas4thWR**DentoesstartedasFB.%Denotesstartedas2ndTE.
2011 MICHIGAN STARTING LINEUPS • DEFENSE
OPPONENT DE DT DT DE SAM MIKE wILL LCB SS FS RCBWesternMichigan Roh Martin vanBergen Heininger Ryan Demens Herron Woolfolk Kovacs gordon AveryNotreDame Roh Martin vanBergen Heininger Robinson** Demens Morgan Floyd Kovacs gordon AveryEasternMichigan Roh Martin Heininger vanBergen Ryan Demens Hawthorne Woolfolk Kovacs gordon FloydSanDiegoState Roh Martin Heininger vanBergen Ryan Demens Hawthorne Woolfolk Kovacs gordon FloydMinnesota Roh Martin Heininger vanBergen Ryan Demens Hawthorne Woolfolk Kovacs gordon FloydatNorthwestern Roh Martin Heininger vanBergen Avery** Demens Hawthorne Woolfolk Kovacs gordon FloydatMichiganState Roh Martin Heininger vanBergen Ryan Demens Hawthorne Woolfolk Kovacs gordon FloydPurdue Roh Martin Heininger Brink Ryan Demens Morgan Countess Woolfolk gordon Floydatiowa Roh Martin Heininger vanBergen Ryan Demens Morgan Countess Kovacs Woolfolk Floydatillinois Roh Martin Heininger vanBergen Ryan Demens Morgan Countess Kovacs Woolfolk FloydNebraska Roh Martin Heininger vanBergen Ryan Demens Morgan Countess Kovacs gordon FloydOhioState Roh Martin Heininger vanBergen Ryan Demens Morgan Countess Kovacs Woolfolk Floyd
**DenotesstartedasfifthDB.
Al Backey Back-eeJibreelBlack Juh-BREElSeth Broekhuizen Brook-hizenKennyDemens DEM-insDrewDileo Dill-e-oPaulGyarmati G-are-mahtiWill Hagerup Haa-GRUPWill Heininger Hine-in-gerStephen Hopkins Steph-enMark Huyge Hugh-gheeRocko Khoury CoreyMike Kwiatkowski kwit-KOW-skiTaylorLewan luh-wan
KristianMateus Muh-tay-usPatrick Omameh O-MAH-mayJordan Paskorz Pass-korzKrisPauloski Pa-lowskiTom Pomarico pom-uh-RiCOJihad Rasheed JEE-hodRah-SHEEDCraig Roh RowDarrylStonum Stone-umTerrence Talbott TAL-bottRaymonTaylor ray-MOANFitzgerald Toussaint Two-santMatt wile like‘while’
MICHIGAN PRONUNCIATION GUIDE
D E P T H C H A R T S
MICHIGAN FOOTBALL GAME NOTES PAGE 15
START CHARTS
CurrentOFFENSE ‘11 Streak CareerDavidMolk 12 25 41RoyRoundtree 12 23 28MarkHuyge 12 12 28Patrick Omameh 12 28 28DenardRobinson 12 25 25
CurrentDEFENSE ‘11 Streak CareerCraig Roh 12 37 37Mike Martin 12 15 36KennyDemens 12 19 19
LONGEST ACTIVE STARTS STREAKSCraig Roh........................................................37Patrick Omameh ........................................28DavidMolk ....................................................25DenardRobinson .......................................25
CAREER GAMES STARTEDDavidMolk(C) .............................................41RyanvanBergen(DE) ..............................37CraigRoh(DE) .............................................37MikeMartin(DT) ........................................36JordanKovacs(SS) ....................................32JuniorHemingway(WR) ........................30KevinKoger(TE) .........................................30RoyRoundtree(SR) ...................................28MarkHuyge(OT) ........................................28Patrick Omameh (OG) .............................28MartaviousOdoms(SR) ..........................27
CAREER GAMES PLAYEDJ.B. Fitzgerald (LB) ......................................49RyanvanBergen(DE) ..............................49MikeMartin(DT) ........................................48JuniorHemingway(WR) ........................47KevinKoger(TE) .........................................46TroyWoolfolk(CB) .....................................44DavidMolk(C) .............................................41Mike Shaw (RB) ...........................................39MartaviousOdoms(SR) ..........................38Brandon Herron (LB) ................................36
MICHIGAN DEPTH CHART vs. VIRGINIA TECHOFFENSE
WR 12 RoyRoundtree(6-0,177,Sr./Jr.)19 Kelvingrady(5-10,177,5th)
17 JeremyJackson(6-3,198,So.)
LT 77 Taylorlewan(6-8,302,Jr./So.)75 Michael Schofield (6-7, 299, Jr./So.)
LG 52 RickyBarnum(6-3,292,Sr./Jr.) 57 Elliott Mealer (6-5, 310, Sr./Jr.)
C 50 DavidMolk(6-2,286,5th) 63 RockoKhoury(6-4,287,Sr./Jr.)
RG 65 Patrick Omameh (6-4, 300, Sr./Jr.) 57 Elliott Mealer (6-5, 310, Sr./Jr.)
RT 72 MarkHuyge(6-6.302,5th)75 Michael Schofield (6-7, 299, Jr./So.)
TE 86 KevinKoger(6-4,258,Sr.) 84 Steve Watson (6-4, 255, 5th) 89 Brandon Moore (6-5, 255, Sr./Jr.)
WR 21 JuniorHemingway(6-1,222,5th) 10 Jeremygallon(5-8,185,Jr./So.) 9 MartaviousOdoms(5-8,173,Sr.)
26 Drew Dileo (5-10, 172, So.)
QB 16 DenardRobinson(6-0,195,Jr.) 7 Devingardner(6-4,205,So.)
FB 33 Stephen Hopkins (6-0, 228, So.) 49 John McColgan (6-1, 240, 5th)
RB 28 FitzgeraldToussaint(5-10,195,Jr./So.) 2 Vincent Smith (5-6, 172, Jr.) 20 Michael Shaw (6-1, 195, Sr.)
DEFENSE
DE 88 Craig Roh (6-5, 269, Jr.) 55 Jibreel Black (6-2, 260, So.) 57 Frank Clark ( 6-2, 228, Fr.)
DT 68 Mike Martin (6-2, 304, Sr.) 73 Will Campbell (6-5, 322, Jr.)
DT 39 Will Heininger (6-6, 295, 5th) 76 QuintonWashington(6-4,302,Jr./So.)
DE 53 RyanvanBergen(6-6,288,5th) 67 Nathan Brink (6-5, 263, Jr./So.)
SLB 90 JakeRyan(6-3,230,So./Fr.) 4 Cam Gordon (6-3, 222, Jr./So.) 97 BrennenBeyer(6-3,225,Fr.)
MLB 25 KennyDemens(6-1,248,Sr./Jr.) 42 J.B. Fitzgerald (6-3, 241, Sr.) 27 Mike Jones (6-2, 224, Jr./So.)
WLB 44 DesmondMorgan(6-1,220,Fr.) 7 Brandin Hawthorne (6-0, 214, Jr.) 58 Brandon Herron (6-2, 221, 5th) 27 Mike Jones (6-2, 224, Jr./So.)
LCB 18 BlakeCountess(5-10,176,Fr.) 6 RaymonTaylor(5-10,169,Fr.)
SS 32 JordanKovacs(6-0,197,Sr./Jr.) 3 Marvin Robinson (6-2, 200, So.)
FS 29 TroyWoolfolk(6-0,191,5th)�� 30 Thomas Gordon (5-11, 208, Jr./So.) 14 JoshFurman(6-2,208,So./Fr.)
RCB 8 J.T.Floyd(6-0,185,Sr./Jr.) 5 CourtneyAvery(5-11,173,So.) 17 TonyAnderson(5-11,195,5th)
SPECIAL TEAMS
PK 34 Brendangibbons(6-1,227,Jr./So.)�� 45 Matt Wile (6-2, 208, Fr.)
P 43 Will Hagerup (6-4, 210, So.) 45 Matt Wile (6-2, 208, Fr.)
LS 91 Tom Pomarico (6-4, 240, 5th) 54 Jareth Glanda (6-3, 255, Jr./So.)
H 26 Drew Dileo (5-10, 172, So.) 10 Jeremy Gallon (5-8, 185, Jr./So.)
KO 45 Matt Wile (6-2, 208, Fr.) 46 SethBroekhuizen(6-1,195,Jr./So.)
PR 10 Jeremy Gallon (5-8, 185, Jr./So.)�� 26 Drew Dileo (5-10, 172, So.) 21 Junior Hemingway (6-1, 222, 5th) 9 MartaviousOdoms(5-8,173,Sr.)
KR 9 MartaviousOdoms(5-8,173,Sr.)�� 10 Jeremy Gallon (5-8, 185, Jr./So.) 19 Kelvin Grady (5-10, 177, 5th) 2 Vincent Smith (5-6, 172, Jr.)
NUMERICAL ROSTER
No. Player Pos. 2 Smith, Vincent ** RB 3 Bellomy,Russell QB 3 Robinson, Marvin * S 4 Gordon, Cameron * LB 4 Wilson, Steve QB 5 Avery,Courtney* CB 5 Hayes,Justice RB 6 Taylor,Raymon DB 7 gardner,Devin QB 7 Hawthorne, Brandin * LB 8 Floyd,J.T.** CB 8 Swieca,Alex QB 9 Odoms,Martavious***WR 10 gallon,Jeremy* WR 12 Roundtree,Roy** WR 13 Fry,Ben QB 14 Furman,Josh S 14 Kennedy,Jack QB 15 Cox,Michael** RB 16 Robinson,Denard** QB 17 Anderson,Tony*** CB 17 Jackson,Jeremy* WR 18 Countess,Blake DB 18 Rasheed, Jihad RB 19 grady,Kelvin** WR 19 Zeller, Charlie S 20 Carter,Tamani DB 20 Shaw, Michael *** RB 21 Hemingway,Junior***WR 22 Stonum,Darryl*** WR 23 Simmons,Floyd** S 24 Hollowell,Delonte DB 25 Demens,Kenny** lB 26 Dileo,Drew* WR 27 Jones, Mike * LB 27 Keizer,Jonathan WR 28 Cavanaugh,Matthew*S 28 Toussaint,Fitzgerald* RB 29 Woolfolk,Troy*** CB 30 Gordon, Thomas * S 31 vanSlyke,Jared* S 31 Smith,Christopher K 32 Kovacs,Jordan** S 33 Hopkins, Stephen * RB 34 Bell, Isaiah LB 34 gibbons,Brendan* PK 35 Barpal, Jordan WR 36 Johnson, Zac *** S 36 Kerridge,Joe FB 37 Talbott, Terrence * CB 38 Backey,Al* CB 38 Rawls, Thomas RB 39 Heininger,Will*** DE 40 Allspach, Nate TE 40 Poole, Antonio LB 41 Wilkins,Kenny DT
ALPHABETICAL ROSTER
No. Player Pos. Ht. wt. Year/Elig. Hometown (High School/Previous School) 40 Allspach, Nate TE 6-6 224 So./Fr. Grand Rapids, Mich. (Grandville) 17 Anderson,Tony*** CB 5-11 195 5th RedondoBeach,Calif.(RedondoUnion) 54 Ash,Richard DT 6-3 301 So./Fr. Pahokee,Fla.(Pahokee) 5 Avery,Courtney* CB 5-11 173 So. Mansfield,Ohio(lexington) 38 Backey,Al* CB 5-10 181 Jr./So. Ypsilanti,Mich.(Ypsilanti) 52 Barnum,Ricky** Ol 6-3 292 Sr./Jr. lakeland,Fla.(lakegibson) 35 Barpal, Jordan WR 5-10 166 Sr./Jr. West Bloomfield, Mich. (Seaholm) 34 Bell,isaiah lB 6-1 250 Jr./So. Youngstown,Ohio(liberty) 3 Bellomy,Russell QB 6-3 189 Fr. Arlington,Texas(Martin) 97 Beyer,Brennen lB 6-3 225 Fr. Canton,Mich.(Plymouth) 55 Black,Jibreel* DE 6-2 260 So. Cincinnati,Ohio(Wyoming) 67 Brink,Nathan DT 6-5 263 Jr./So. Holland,Mich.(HollandChristian) 46 Broekhuizen,Seth* PK 6-1 200 Jr./So. Holland,Mich.(HollandChristian) 58 Bryant,Chris Ol 6-4 341 Fr. Chicago,ill.(Simeon) 56 Burzynski,Joey Ol 6-1 284 So./Fr. Carlsbad,Calif.(Carlsbad) 73 Campbell,William** DT 6-5 322 Jr. Detroit,Mich.(CassTechnical) 20 Carter,Tamani DB 5-11 175 Fr. Pickerington,Ohio(Central) 28 Cavanaugh,Matthew*S 5-10 190 Sr./Jr. Alto,Mich.(Caledonia) 57 Clark,Frank DE 6-2 228 Fr. Cleveland,Ohio(glenville) 18 Countess,Blake DB 5-10 176 Fr. OwingsMills,Md.(OurladyofgoodCounsel) 15 Cox,Michael** RB 6-0 214 Sr./Jr. Dorchester,Mass.(AvonOldFarms) 25 Demens,Kenny** lB 6-1 248 Sr./Jr. OakPark,Mich.(DetroitCountryDay) 26 Dileo,Drew* WR 5-10 172 So. greenwellSprings,la.(ParkviewBaptist) 93 Eddins,Chris DE 6-5 265 So./Fr. Detroit,Mich.(CountryDay) 42 Esterline,Dylan TE 6-5 237 So./Fr. Blissfield,Mich.(Blissfield) 51 Evans, Marell LB 6-3 237 5th Richmond, Va. (Varina) 42 Fitzgerald,J.B.*** lB 6-3 241 Sr. PrincetonJunction,N.J.(WestWindsorPlainsboro) 8 Floyd,J.T.** CB 6-0 185 Sr./Jr. greenville,S.C.(J.l.Mann) 13 Fry,Ben QB 5-10 178 Fr. grossePointeFarms,Mich.(grossePointeSouth) 14 Furman,Josh S 6-2 208 So./Fr. Annapolis,Md.(OldMillSenior) 10 gallon,Jeremy* WR 5-8 185 Jr./So. Apopka,Fla.(Apopka) 7 gardner,Devin QB 6-4 205 So. Detroit,Mich.(inkster) 34 gibbons,Brendan* PK 6-1 241 Jr./So. WestPalmBeach,Fla.(CardinalNewman) 54 Glanda, Jareth LS 6-3 255 Jr./So. Rochester Hills, Mich. (Brother Rice) 61 glasgow,graham Ol 6-6 314 Fr. Aurora,ill.(MarmionAcademy) 4 gordon,Cameron* lB 6-3 222 Jr./So. Detroit,Mich.(inkster) 30 gordon,Thomas* S 5-11 208 Jr./So. Detroit,Mich.(CassTechnical) 19 grady,Kelvin** WR 5-10 177 5th grandRapids,Mich.(EastgrandRapids) 94 graman,Curt lS 6-5 200 Jr./So. Cincinnati,Ohio(Elder) 69 gunderson,Erik Ol 6-8 312 Jr./So. Milan,Mich.(Milan) 99 gyarmati,Paul* lB 6-1 216 Sr./Jr. Birmingham,Mich.(BrotherRice) 43 Hagerup,Will* P 6-4 225 So. Milwaukee,Wis.(WhitefishBay) 7 Hawthorne, Brandin * LB 6-0 214 Jr. Pahokee, Fla. (Pahokee) 5 Hayes,Justice RB 5-10 176 Fr. grandBlanc,Mich.(grandBlancCommunity) 39 Heininger,Will*** DE 6-6 295 5th AnnArbor,Mich.(Pioneer) 92 Heitzman,Keith DE 6-3 251 Fr. Hilliard,Ohio(HilliardDavidson) 21 Hemingway,Junior***WR 6-1 222 5th Conway,S.C.(Conway) 58 Herron,Brandon*** lB 6-2 221 5th Stafford,Texas(Dulles) 24 Hollowell,Delonte DB 5-9 164 Fr. Detroit,Mich.(CassTechnical) 33 Hopkins,Stephen* RB 6-0 228 So. DoubleOak,Texas(Marcus) 72 Huyge,Mark*** Ol 6-6 302 5th Wyoming,Mich.(CatholicCentral) 17 Jackson,Jeremy* WR 6-3 198 So. AnnArbor,Mich.(Huron) 36 Johnson, Zac *** S 6-2 205 5th Morenci, Mich. (Morenci) 27 Jones, Mike * LB 6-2 224 Jr./So. Orlando, Fla. (Edgewater) 27 Keizer,Jonathan WR 6-5 205 Fr. Portage,Mich.(PortageNorthern)
2 0 1 1 M I C H I G A N F O O T B A L L R O S T E R S
MICHIGAN FOOTBALL GAME NOTES PAGE 16
ALPHABETICAL ROSTERNo. Player Pos. Ht. wt. Year/Elig. Hometown (High School/Previous School)
14 Kennedy,Jack QB 5-11 185 Sr./Jr. Walledlake,Mich.(WalledlakeCentral) 36 Kerridge,Joe FB 6-0 231 Fr. TraverseCity,Mich.(St.Francis) 63 Khoury,Rocko** Ol 6-4 287 Sr./Jr. TraverseCity,Mich.(TraverseCityWest) 86 Koger,Kevin*** TE 6-4 258 Sr. Toledo,Ohio(Whitmer) 32 Kovacs,Jordan** S 6-0 197 Sr./Jr. Curtice,Ohio(Clay) 81 Kwiatkowski,Mike TE 6-5 257 Sr./Jr. Macomb,Mich.(Dakota) 77 lewan,Taylor* Ol 6-8 302 Jr./So. Scottsdale,Ariz.(Chaparral) 68 Martin,Mike*** DT 6-2 304 Sr. Redford,Mich.(CatholicCentral) 70 Mateus,Kristian Ol 6-7 285 So./Fr. Ada,Mich.(ForestHillsCentral) 49 McColgan,John** FB 6-1 240 5th Saginaw,Mich.(NouvelCatholic) 57 Mealer,Elliott** Ol 6-5 310 Sr./Jr. Wauseon,Ohio(Wauseon) 60 Miller,Jack Ol 6-4 263 Fr. Perrysburg,Ohio(St.John’sJesuit) 80 Miller,Ricardo TE 6-4 234 So./Fr. Orlando,Fla.(Dr.Phillips[Fla.]/Pioneer[Mich.]) 50 Molk,David*** Ol 6-2 286 5th lemont,ill.(lemontTownship) 89 Moore, Brandon TE 6-5 255 Sr./Jr. Trotwood, Ohio (Trotwood-Madison) 66 Morales,george lS 6-0 236 Sr./Jr. Northlasvegas,Nev.(Mojave) 44 Morgan,Desmond lB 6-1 220 Fr. Holland,Mich.(WestOttawa) 9 Odoms,Martavious***WR 5-8 173 Sr. Pahokee,Fla.(Pahokee) 65 Omameh,Patrick** Ol 6-4 300 Sr./Jr. Columbus,Ohio(St.FrancisDeSales) 94 Paskorz, Jordan LB 6-3 246 So./Fr. Gibsonia, Pa. (Hampton) 93 Pauloski,Kris PK 6-3 204 Jr./So. indianapolis,ind.(Pike) 91 Pomarico,Tom** lS 6-4 240 5th Jackson,Mich.(lumenChristi) 40 Poole, Antonio LB 6-2 212 Fr. Cincinnati, Ohio (Winton Woods) 18 Rasheed,Jihad RB 5-10 172 So./Fr. Detroit,Mich.(Southeastern) 38 Rawls, Thomas RB 5-10 219 Fr. Flint, Mich. (Flint Northern) 85 Reynolds,Joe* WR 6-1 191 Jr./So. Rochester,Mich.(RochesterAdams) 16 Robinson,Denard** QB 6-0 195 Jr. DeerfieldBeach,Fla.(DeerfieldBeach) 83 Robinson,Jerald WR 6-1 206 So./Fr. Canton,Ohio(South) 3 Robinson, Marvin * S 6-2 200 So. Winter Haven, Fla. (Lake Region) 82 Robinson,Terrence* WR 5-9 177 Sr./Jr. Klein,Texas(Oak) 95 Rock,Chris DE 6-5 267 Fr. Columbus,Ohio(St.FrancisDeSales) 88 Roh,Craig** DE 6-5 269 Jr. Scottsdale,Ariz.(Chaparral) 96 Ross,Jeremy PK 5-5 150 So./Fr. AnnArbor,Mich.(Pioneer) 12 Roundtree,Roy** WR 6-0 177 Sr./Jr. Trotwood,Ohio(Trotwood-Madison) 90 Ryan,Jake lB 6-3 230 So./Fr. Westlake,Ohio(St.ignatius) 75 Schofield,Michael* Ol 6-7 299 Jr./So. OrlandPark,ill.(CarlSandburg) 60 Schwab,Alex DT 6-0 241 Sr./Jr. Manassas,va.(OsbournPark) 20 Shaw, Michael *** RB 6-1 195 Sr. Trotwood, Ohio (Trotwood-Madison) 23 Simmons,Floyd** S 6-0 194 Sr./Jr. Detroit,Mich.(CrockettTechnical) 31 Smith,Christopher K 6-0 177 Fr. Washington,DC(St.Albans) 2 Smith, Vincent ** RB 5-6 172 Jr. Pahokee, Fla. (Pahokee) 22 Stonum,Darryl*** WR 6-2 195 Sr. Stafford,Texas(Dulles) 8 Swieca,Alex QB 6-1 210 Fr. NewYork,NY(TheFrischSchool) 37 Talbott,Terrence* CB 5-11 178 So. HuberHeights,Ohio(Wayne) 6 Taylor,Raymon DB 5-10 169 Fr. Detroit,Mich.(HighlandPark) 28 Toussaint,Fitzgerald* RB 5-10 195 Jr./So. Youngstown,Ohio(liberty) 53 vanBergen,Ryan*** DE 6-6 288 5th Whitehall,Mich.(Whitehall) 31 vanSlyke,Jared* S 6-2 195 5th St.louis,Mo.(JohnBurroughs) 76 Washington,Quinton*DT 6-4 302 Jr./So. St.Stephen,S.C.(Timberland) 84 Watson,Steve*** TE 6-4 255 5th CherryHillsvillage,Colo.(Mullen) 45 Wile,Matt K 6-2 208 Fr. SanDiego,Calif.(FrancisParker) 41 Wilkins,Kenny DT 6-3 280 So./Fr. Washington,Pa.(Trinity) 4 Wilson, Steve QB 5-11 180 Sr./Jr. White Lake, Mich. (Lakeland) 29 Woolfolk,Troy*** CB 6-0 191 5th Sugarland,Texas(Dulles) 19 Zeller,Charlie S 5-11 194 Jr./So. Centennial,Colo.(CherryCreek)
NUMERICAL ROSTER No. Player Pos. 42 Esterline,Dylan TE 42 Fitzgerald, J.B. *** LB 43 Hagerup,Will* P 44 Morgan,Desmond lB 45 Wile,Matt K 46 Broekhuizen,Seth* PK 49 McColgan, John ** FB 50 Molk,David*** Ol 51 Evans, Marell LB 52 Barnum,Ricky** Ol 53 vanBergen,Ryan*** DE 54 Ash,Richard DT 54 Glanda, Jareth LS 55 Black,Jibreel* DE 56 Burzynski,Joey Ol 57 Clark,Frank DE 57 Mealer, Elliott ** OL 58 Bryant,Chris Ol 58 Herron, Brandon *** LB 60 Miller, Jack OL 60 Schwab,Alex DT 61 Glasgow, Graham OL 63 Khoury,Rocko** Ol 65 Omameh, Patrick ** OL 66 Morales, George LS 67 Brink,Nathan DT 68 Martin,Mike*** DT 69 gunderson,Erik Ol 70 Mateus,Kristian Ol 72 Huyge,Mark*** Ol 73 Campbell,William** DT 75 Schofield, Michael * OL 76 Washington,Quinton*DT 77 lewan,Taylor* Ol 80 Miller, Ricardo TE 81 Kwiatkowski,Mike TE 82 Robinson, Terrence * WR 83 Robinson, Jerald WR 84 Watson, Steve *** TE 85 Reynolds,Joe* WR 86 Koger,Kevin*** TE 88 Roh,Craig** DE 89 Moore, Brandon TE 90 Ryan,Jake lB 91 Pomarico, Tom ** LS 92 Heitzman,Keith DE 93 Eddins,Chris DE 93 Pauloski,Kris PK 94 graman,Curt lS 94 Paskorz, Jordan LB 95 Rock,Chris DE 96 Ross,Jeremy PK 97 Beyer,Brennen lB 99 gyarmati,Paul* lB
2 0 1 1 M I C H I G A N F O O T B A L L R O S T E R S
MICHIGAN FOOTBALL GAME NOTES PAGE 17
2 0 1 1 R O S T E R B R E A K D O w NROSTER BY POSITION
Quarterback No. Player Pos. Ht. wt. Year/Elig. Hometown (High School/Previous School) 3 Bellomy,Russell QB 6-3 189 Fr. Arlington,Texas(Martin) 13 Fry,Ben QB 5-10 178 Fr. grossePointeFarms,Mich.(grossePointeSouth) 7 gardner,Devin QB 6-4 205 So. Detroit,Mich.(inkster) 14 Kennedy,Jack QB 5-11 185 Sr./Jr. Walledlake,Mich.(WalledlakeCentral) 16 Robinson,Denard** QB 6-0 195 Jr. DeerfieldBeach,Fla.(DeerfieldBeach) 8 Swieca,Alex QB 6-1 210 Fr. NewYork,NY(TheFrischSchool) 4 Wilson, Steve QB 5-11 180 Sr./Jr. White Lake, Mich. (Lakeland) Running Back 15 Cox,Michael** RB 6-0 214 Sr./Jr. Dorchester,Mass.(AvonOldFarms) 5 Hayes,Justice RB 5-10 176 Fr. grandBlanc,Mich.(grandBlancCommunity) 33 Hopkins,Stephen* RB 6-0 228 So. DoubleOak,Texas(Marcus) 36 Kerridge,Joe FB 6-0 231 Fr. TraverseCity,Mich.(St.Francis) 49 McColgan,John** FB 6-1 240 5th Saginaw,Mich.(NouvelCatholic) 18 Rasheed,Jihad RB 5-10 172 So./Fr. Detroit,Mich.(Southeastern) 38 Rawls, Thomas RB 5-10 219 Fr. Flint, Mich. (Flint Northern) 20 Shaw, Michael *** RB 6-1 195 Sr. Trotwood, Ohio (Trotwood-Madison) 2 Smith, Vincent ** RB 5-6 172 Jr. Pahokee, Fla. (Pahokee) 28 Toussaint,Fitzgerald* RB 5-10 195 Jr./So. Youngstown,Ohio(liberty) wide Receiver 35 Barpal, Jordan WR 5-10 166 Sr./Jr. West Bloomfield, Mich. (Seaholm) 26 Dileo,Drew* WR 5-10 172 So. greenwellSprings,la.(ParkviewBaptist) 10 gallon,Jeremy* WR 5-8 185 Jr./So. Apopka,Fla.(Apopka) 19 grady,Kelvin** WR 5-10 177 5th grandRapids,Mich.(EastgrandRapids) 21 Hemingway,Junior***WR 6-1 222 5th Conway,S.C.(Conway) 17 Jackson,Jeremy* WR 6-3 198 So. AnnArbor,Mich.(Huron) 27 Keizer,Jonathan WR 6-5 205 Fr. Portage,Mich.(PortageNorthern) 9 Odoms,Martavious***WR 5-8 173 Sr. Pahokee,Fla.(Pahokee) 85 Reynolds,Joe* WR 6-1 191 Jr./So. Rochester,Mich.(RochesterAdams) 83 Robinson,Jerald WR 6-1 206 So./Fr. Canton,Ohio(South) 82 Robinson,Terrence* WR 5-9 177 Sr./Jr. Klein,Texas(Oak) 12 Roundtree,Roy** WR 6-0 177 Sr./Jr. Trotwood,Ohio(Trotwood-Madison) 22 Stonum,Darryl*** WR 6-2 195 Sr. Stafford,Texas(Dulles) Tight End 40 Allspach, Nate TE 6-6 224 So./Fr. Grand Rapids, Mich. (Grandville) 42 Esterline,Dylan TE 6-5 237 So./Fr. Blissfield,Mich.(Blissfield) 86 Koger,Kevin*** TE 6-4 258 Sr. Toledo,Ohio(Whitmer) 81 Kwiatkowski,Mike TE 6-5 257 Sr./Jr. Macomb,Mich.(Dakota) 80 Miller,Ricardo TE 6-4 234 So./Fr. Orlando,Fla.(Dr.Phillips[Fla.]/Pioneer[Mich.]) 89 Moore, Brandon TE 6-5 255 Sr./Jr. Trotwood, Ohio (Trotwood-Madison) 84 Watson,Steve*** TE 6-4 255 5th CherryHillsvillage,Colo.(Mullen)Offensive Line 52 Barnum,Ricky** Ol 6-3 292 Sr./Jr. lakeland,Fla.(lakegibson) 58 Bryant,Chris Ol 6-4 341 Fr. Chicago,ill.(Simeon) 56 Burzynski,Joey Ol 6-1 284 So./Fr. Carlsbad,Calif.(Carlsbad) 61 glasgow,graham Ol 6-6 314 Fr. Aurora,ill.(MarmionAcademy) 69 gunderson,Erik Ol 6-8 312 Jr./So. Milan,Mich.(Milan) 72 Huyge,Mark*** Ol 6-6 302 5th Wyoming,Mich.(CatholicCentral) 63 Khoury,Rocko** Ol 6-4 287 Sr./Jr. TraverseCity,Mich.(TraverseCityWest) 77 lewan,Taylor* Ol 6-8 302 Jr./So. Scottsdale,Ariz.(Chaparral) 70 Mateus,Kristian Ol 6-7 285 So./Fr. Ada,Mich.(ForestHillsCentral) 57 Mealer,Elliott** Ol 6-5 310 Sr./Jr. Wauseon,Ohio(Wauseon) 60 Miller,Jack Ol 6-4 263 Fr. Perrysburg,Ohio(St.John’sJesuit) 50 Molk,David*** Ol 6-2 286 5th lemont,ill.(lemontTownship) 65 Omameh,Patrick** Ol 6-4 300 Sr./Jr. Columbus,Ohio(St.FrancisDeSales) 75 Schofield,Michael* Ol 6-7 299 Jr./So. OrlandPark,ill.(CarlSandburg)
ROSTER BY STATE No. Player Pos.Arizona (2) 77 lewan,Taylor* Ol 88 Roh,Craig** DECalifornia (3) 17 Anderson,Tony*** CB 56 Burzynski,Joey Ol 45 Wile,Matt KColorado (2) 84 Watson, Steve *** TE 19 Zeller, Charlie SFlorida (11) 54 Ash,Richard DT 52 Barnum,Ricky** Ol 10 gallon,Jeremy* WR 34 gibbons,Brendan* PK 7 Hawthorne, Brandin * LB 27 Jones, Mike * LB 80 Miller, Ricardo TE 9 Odoms,Martavious***WR 16 Robinson,Denard** QB 3 Robinson, Marvin * S 2 Smith, Vincent ** RBIllinois (4) 58 Bryant,Chris Ol 61 Glasgow, Graham OL 50 Molk,David*** Ol 75 Schofield, Michael * OLIndiana (1) 93 Pauloski,Kris PKLouisiana (1) 26 Dileo,Drew* WRMassachusetts (1) 15 Cox,Michael** RBMaryland (2) 18 Countess,Blake DB 14 Furman,Josh SMichigan (43) 40 Allspach, Nate TE 38 Backey,Al* CB 35 Barpal, Jordan WR 97 Beyer,Brennen lB 67 Brink,Nathan DT 46 Broekhuizen,Seth* PK 73 Campbell,William** DT 28 Cavanaugh,Matthew*S 25 Demens,Kenny** lB 93 Eddins,Chris DE 42 Esterline,Dylan TE 13 Fry,Ben QB 7 gardner,Devin QB 54 Glanda, Jareth LS 4 Gordon, Cameron * LB 30 Gordon, Thomas * S 19 grady,Kelvin** WR 69 gunderson,Erik Ol 99 gyarmati,Paul* lB 5 Hayes,Justice RB 39 Heininger,Will*** DE 24 Hollowell,Delonte DB 72 Huyge,Mark*** Ol 17 Jackson,Jeremy* WR 36 Johnson, Zac *** S 27 Keizer,Jonathan WR 14 Kennedy,Jack QB 36 Kerridge,Joe FB
MICHIGAN FOOTBALL GAME NOTES PAGE 18
2 0 1 1 R O S T E R B R E A K D O w NROSTER BY POSITION
Defensive Line 54 Ash,Richard DT 6-3 301 So./Fr. Pahokee,Fla.(Pahokee) 55 Black,Jibreel* lB 6-2 260 So. Cincinnati,Ohio(Wyoming) 67 Brink,Nathan DT 6-5 263 Jr./So. Holland,Mich.(HollandChristian) 73 Campbell,William** DT 6-5 322 Jr. Detroit,Mich.(CassTechnical) 57 Clark,Frank DE 6-2 228 Fr. Cleveland,Ohio(glenville) 93 Eddins,Chris DE 6-5 265 So./Fr. Detroit,Mich.(CountryDay) 39 Heininger,Will*** DE 6-6 295 5th AnnArbor,Mich.(Pioneer) 92 Heitzman,Keith DE 6-3 251 Fr. Hilliard,Ohio(HilliardDavidson) 68 Martin,Mike*** DT 6-2 304 Sr. Redford,Mich.(CatholicCentral) 95 Rock,Chris DE 6-5 267 Fr. Columbus,Ohio(St.FrancisDeSales) 88 Roh,Craig** DE 6-5 269 Jr. Scottsdale,Ariz.(Chaparral) 60 Schwab,Alex DT 6-0 241 Sr./Jr. Manassas,va.(OsbournPark) 53 vanBergen,Ryan*** DE 6-6 288 5th Whitehall,Mich.(Whitehall) 76 Washington,Quinton*DT 6-4 302 Jr./So. St.Stephen,S.C.(Timberland) 41 Wilkins,Kenny DT 6-3 280 So./Fr. Washington,Pa.(Trinity) Linebacker 34 Bell,isaiah lB 6-1 250 Jr./So. Youngstown,Ohio(liberty) 97 Beyer,Brennen lB 6-3 225 Fr. Canton,Mich.(Plymouth) 25 Demens,Kenny** lB 6-1 248 Sr./Jr. OakPark,Mich.(DetroitCountryDay) 51 Evans, Marell LB 6-3 237 5th Richmond, Va. (Varina) 42 Fitzgerald,J.B.*** lB 6-3 241 Sr. PrincetonJunction,N.J.(WestWindsorPlainsboro) 4 gordon,Cameron* lB 6-3 222 Jr./So. Detroit,Mich.(inkster) 99 gyarmati,Paul* lB 6-1 216 Sr./Jr. Birmingham,Mich.(BrotherRice) 7 Hawthorne, Brandin * LB 6-0 214 Jr. Pahokee, Fla. (Pahokee) 58 Herron,Brandon*** lB 6-2 221 5th Stafford,Texas(Dulles) 27 Jones, Mike * LB 6-2 224 Jr./So. Orlando, Fla. (Edgewater) 44 Morgan,Desmond lB 6-1 220 Fr. Holland,Mich.(WestOttawa) 94 Paskorz, Jordan LB 6-3 246 So./Fr. Gibsonia, Pa. (Hampton) 40 Poole, Antonio LB 6-2 212 Fr. Cincinnati, Ohio (Winton Woods) 90 Ryan,Jake lB 6-3 230 So./Fr. Westlake,Ohio(St.ignatius)Secondary 17 Anderson,Tony*** CB 5-11 195 5th RedondoBeach,Calif.(RedondoUnion) 5 Avery,Courtney* CB 5-11 173 So. Mansfield,Ohio(lexington) 38 Backey,Al* CB 5-10 181 Jr./So. Ypsilanti,Mich.(Ypsilanti) 20 Carter,Tamani DB 5-11 175 Fr. Pickerington,Ohio(Central) 28 Cavanaugh,Matthew*S 5-10 190 Sr./Jr. Alto,Mich.(Caledonia) 18 Countess,Blake DB 5-10 176 Fr. OwingsMills,Md.(OurladyofgoodCounsel) 8 Floyd,J.T.** CB 6-0 185 Sr./Jr. greenville,S.C.(J.l.Mann) 14 Furman,Josh S 6-2 208 So./Fr. Annapolis,Md.(OldMillSenior) 30 gordon,Thomas* S 5-11 208 Jr./So. Detroit,Mich.(CassTechnical) 24 Hollowell,Delonte DB 5-9 164 Fr. Detroit,Mich.(CassTechnical) 36 Johnson, Zac *** S 6-2 205 5th Morenci, Mich. (Morenci) 32 Kovacs,Jordan** S 6-0 197 Sr./Jr. Curtice,Ohio(Clay) 3 Robinson, Marvin * S 6-2 200 So. Winter Haven, Fla. (Lake Region) 23 Simmons,Floyd** S 6-0 194 Sr./Jr. Detroit,Mich.(CrockettTechnical) 37 Talbott,Terrence* CB 5-11 178 So. HuberHeights,Ohio(Wayne) 6 Taylor,Raymon DB 5-10 169 Fr. Detroit,Mich.(HighlandPark) 31 vanSlyke,Jared* S 6-2 195 5th St.louis,Mo.(JohnBurroughs) 29 Woolfolk,Troy*** CB 6-0 191 5th Sugarland,Texas(Dulles) 19 Zeller,Charlie S 5-11 194 Jr./So. Centennial,Colo.(CherryCreek)Specialist 46 Broekhuizen,Seth* PK 6-1 200 Jr./So. Holland,Mich.(HollandChristian) 34 gibbons,Brendan* PK 6-1 241 Jr./So. WestPalmBeach,Fla.(CardinalNewman) 54 Glanda, Jareth LS 6-3 255 Jr./So. Rochester Hills, Mich. (Brother Rice) 94 graman,Curt lS 6-5 200 Jr./So. Cincinnati,Ohio(Elder) 43 Hagerup,Will* P 6-4 225 So. Milwaukee,Wis.(WhitefishBay) 66 Morales,george lS 6-0 236 Sr./Jr. Northlasvegas,Nev.(Mojave) 93 Pauloski,Kris PK 6-3 204 Jr./So. indianapolis,ind.(Pike) 91 Pomarico,Tom** lS 6-4 240 5th Jackson,Mich.(lumenChristi) 96 Ross,Jeremy PK 5-5 150 So./Fr. AnnArbor,Mich.(Pioneer) 31 Smith,Christopher K 6-0 177 Fr. Washington,DC(St.Albans) 45 Wile,Matt K 6-2 208 Fr. SanDiego,Calif.(FrancisParker)
63 Khoury,Rocko** Ol 81 Kwiatkowski,Mike TE 68 Martin,Mike*** DT 70 Mateus,Kristian Ol 49 McColgan, John ** FB 44 Morgan,Desmond lB 91 Pomarico, Tom ** LS 18 Rasheed, Jihad RB 38 Rawls, Thomas RB 85 Reynolds,Joe* WR 96 Ross,Jeremy PK 23 Simmons,Floyd** S 6 Taylor,Raymon DB 53 vanBergen,Ryan*** DE 4 Wilson, Steve QBMissouri (1) 31 vanSlyke,Jared* SNew Jersey (1) 42 Fitzgerald, J.B. *** LBNew York (1) 8 Swieca,Alex QBNevada (1) 66 Morales, George LSOhio (21) 5 Avery,Courtney* CB 34 Bell, Isaiah LB 55 Black,Jibreel* DE 20 Carter,Tamani DB 57 Clark,Frank DE 94 graman,Curt lS 92 Heitzman,Keith DE 86 Koger,Kevin*** TE 32 Kovacs,Jordan** S 57 Mealer, Elliott ** OL 60 Miller, Jack OL 89 Moore, Brandon TE 65 Omameh, Patrick ** OL 40 Poole, Antonio LB 83 Robinson, Jerald WR 95 Rock,Chris DE 12 Roundtree,Roy** WR 90 Ryan,Jake lB 20 Shaw, Michael *** RB 37 Talbott, Terrence * CB 28 Toussaint,Fitzgerald* RBPennsylvania (2) 94 Paskorz, Jordan LB 41 Wilkins,Kenny DTSouthCarolina (3) 8 Floyd,J.T.** CB 21 Hemingway,Junior***WR 76 Washington,Quinton*DTTexas (6) 3 Bellomy,Russell QB 58 Herron, Brandon *** LB 33 Hopkins, Stephen * RB 82 Robinson, Terrence * WR 22 Stonum,Darryl*** WR 29 Woolfolk,Troy*** CB Virginia (2) 51 Evans, Marell LB 60 Schwab,Alex DTwashington, DC (1) 31 Smith,Christopher Kwisconsin (1) 43 Hagerup,Will* P
MICHIGAN FOOTBALL GAME NOTES PAGE 19
MICHIGAN FOOTBALL GAME NOTES PAGE 20
Brady Hoke was named the 19th head coach inUniversityofMichiganfootballhistoryonJan.11,2011.Aformer assistant coach at U-M (1995-2002), Hoke led the Wolverines to a 10-2 record (6-2 Big Ten) in his first season andanat-largeBCSberthtotheAllstateSugarBowl.Hokehad previous head coaching stints at San Diego Statefrom 2009-10, where he earned a 13-12 record, and his alma mater, Ball State, where he went 34-38 from 2003-08. Collectively,Hokeis57-52innineseasonsasaheadcoach. Hoke’s first-season success in Ann Arbor has beenacknowledgedacross the country.Hehasbeennamedafinalist for three national Coach of theYear awards: BearBryant, Eddie Robinson and liberty Mutual. The Big TenConference’s coachesvotedHokeas the inaugural recipi-entof theHayes-SchembechlerCoachof theYear award,while the Big Ten media named him the Dave McClainCoachoftheYear. Michigan’s offense averaged 34.2 points per game,which ranked second in theBigTen,whileU-M’sdefenseallowed 17.2 points per game, good for fourth in theleague. FourWolverines earned All-BigTen distinction in2011,highlightedbycenterDavidMolk,whowasnamedtheRimington-PaceOffensivelinemanof theYear in theconference.MolkalsoearnedtheRimingtonTrophyasthenation’stopcenter. With three wins more than the 2010 squad (7-6), theWolverines tied the second-bestwin improvementunderafirst-yearMichiganheadcoach.FieldingYost’s1901teamhad a four-win improvement (11-0) from the 1900 team(7-2-1),whileFrankBarbour’s1892 teamwent7-5aftera4-5 season in 1891. Only the legendaryYost precedes Hoke as aMichiganhead coach to win 10 games in his first season. Hoke also became the fifth Big Ten coach to win at least 10 games in his first season as head coach, joining Wisconsin’sBret Bielema (12-1, 2006), Ohio State’s Earle Bruce (11-1,1979), Yost (11-0, 1901) and Minnesota’s HenryWilliams(10-0-2, 1900). Since 1901, Hoke is the third U-M coach to win his first six games (Fielding Yost-1901, BennieOosterbaan-1948).Nationally,Hokeisoneofeightcoachesto direct a team to a BCS bowl in his first season.
The2010MountainWestConferenceCoachoftheYear,HokeguidedtheAztecstoa9-4record,markingthemostvictories since 1996 (8) while earning the program’s firsttriptoabowlgamein12years,a35-14victoryoverNavy.SixofhisplayersearnedAll-MWCfirstteamin2010,includ-ing running back Ronnie Hillman, the league’s Freshmanof theYear.Sevenadditionalplayersearnedsecondteam(4)honorsandhonorablemention(3).in2009,Hoke’sfirstseasonatSanDiegoState,fiveplayerswerenamedtoAll-MWC teams, while 11 were MWC All-Academic selections. AsheadcoachatBallState,hementoredplayers to35All-MACselections in six yearsen route toapairofbowlgame appearances in 2007 and ‘08. The 2008 season marked the best season in program history, recording aschool-record12winsandcompletinganundefeatedMid-AmericanConferenceregular-seasoncampaign. Collectively, Hoke has 29 years of collegiate coachingexperience beginning with assistant positions at grandvalley State (1983), Western Michigan (1984-86), Toledo(1987-88), Oregon State (1989-94) and Michigan (1995-2002). A defensive line coach at U-M, Hoke was part of threeBigTenchampionteams(1997,‘98,2000),includingthe1997nationalchampionandRoseBowlwinningsquad.Duringhistenure,U-Mposteda76-23overallrecord,claim-ingatleast10victoriesonfouroccasions. A 1982 graduate of Ball State University, Hoke earnedfour letters (1977-80) with the Cardinals. He was part ofthe only two teams in Ball State football history to postundefeated conference seasons: as a player in 1978, andas the head coach in 2008. Hoke led Ball State to the 1978 MAC championship, and as a team captain in 1980 earned All-MACsecond-teamhonors.HegraduatedfromFairmontEastHighSchoolinKettering,Ohio,in1977. Heandhiswife,theformerlauraHomberger,haveonedaughter,Kelly.
BRADY HOKE’S YEAR-BY-YEAR COACHING RECORDYEAR SCHOOL RECORD CONFERENCE RECORD POST-SEASON
2011 Michigan 10-2 6-2BigTen SugarBowl(vs.virginiaTech)
2010 SanDiegoState 9-4 5-3MWC PoinsettiaBowl(vs.Navy/W,35-14)
2009 SanDiegoState 4-8 2-6MWC
2008 BallState 12-1 8-0MAC MACWestchampion,*DidnotcoachgMACBowl(vs.Tulsa/l,45-13)
2007 BallState 7-6 5-2MAC MACWestco-champ,internationalBowl(vs.Rutgers/l,52-30)
2006 Ball State 5-7 5-3 MAC
2005 Ball State 4-7 4-4 MAC
2004 Ball State 2-9 2-6 MAC
2003 Ball State 4-8 3-5 MAC
U-M 1 Season 10-2 6-2 Big Ten
SDSU 2 Seasons 13-12 7-9 MwC
BSU 6 Seasons 34-38 27-20 MAC
TOTAL 9 Seasons 57-52 40-31 Conference
Conference Championships
MAC WEST (2007, 2008)
Coach of the Year Honors
BigTen-Hayes-Schembechler(2011, Coaches)
BigTen-DaveMcClain (2011, Media)MWC (2010)
AFCA FBS Region 3 (2008) MAC (2008)
At a Glance
Born: November 3, 1958 in Kettering,Ohio
High School: Fairmont East (1977)
College: Ball State, B.S., 1982Wife:laura
Children:Kelly
Brady Hoke: Head Coach ■ Ball State (1982)Michigan W-L: 10-2 First SeasonBig Ten W-L: 6-2
H E A D C O A C H B R A D Y H O K E
MICHIGAN FOOTBALL GAME NOTES PAGE 21
H E A D C O A C H B R A D Y H O K ERECORD VERSUS OPPONENTSConf./Team RecordBig Ten ..................................Illinois ....................................... 1-1Indiana ..................................... 1-2Iowa .......................................... 0-2Michigan ................................. 0-1Michigan State ..................... 0-1Minnesota .............................. 1-0Nebraska ................................. 1-0Northwestern ....................... 1-0Ohio State ...............................1-0Purdue ..................................... 1-2Totals .............................. 7-9
MACAkron ........................................ 2-1Bowling Green ..................... 0-3Buffalo ...................................... 2-1Central Florida ...................... 1-0Central Michigan ................ 2-4Eastern Michigan ................ 5-2KentState ............................... 3-0Miami ....................................... 2-2Northern Illinois .................. 3-3Ohio .......................................... 0-1Toledo ...................................... 4-2Western Michigan .............. 5-2Totals ..........................29-21
Independent .......................Navy .......................................... 3-0NotreDame........................... 1-0
Mountain west ....................Air Force .................................. 1-1BYU ............................................ 0-2Colorado State ..................... 2-0NewMexico .......................... 2-0SanDiegoState ................... 1-0TCU ............................................ 0-2UNLV ......................................... 1-1Utah .......................................... 0-2Wyoming ................................ 1-1Total ................................ 8-9
Big 12 ...................................Missouri ................................... 0-3Nebraska ................................. 0-1Totals .............................. 0-4
Big East ................................Boston College .................... 0-2Pittsburgh .............................. 0-1Rutgers .................................... 0-1Totals .............................. 0-4
ACC .......................................Boston College .................... 0-1
SEC ........................................Auburn .................................... 0-1
Sun Belt ................................WesternKentucky .............. 2-0
PAC 12 ..................................UCLA ......................................... 0-1
wAC ......................................Idaho ........................................ 0-1NewMexicoState .............. 2-0Utah State .............................. 1-0Total ................................ 3-1
FCS ........................................Nicholls State ........................ 1-0SouthernUtah ..................... 1-0Indiana State ......................... 1-0NorthDakotaState ............ 0-1Northeastern ........................ 1-0Totals .............................. 4-1...............................................Totals ..........................57-52
BRADY HOKE’S MILESTONE wINS win Opponent Site Date1 Ball State 31, Indiana State 7 H 8/28/200310 Ball State 26, Eastern Michigan 25 A 11/12/200520 Ball State 27, Western Michigan 23 A 10/20/200730 Ball State 38, Eastern Michigan 16 H 10/25/200840 SanDiegoState41,NewMexicoSt. A 9/11/201050 Michigan 31, Eastern Michigan 3 H 9/17/2011
U-M SUPERLATIVES UNDER BRADY HOKEOverall: ...................................................................................................10-2 At Home: ............................................................................................8-0 On the Road: .....................................................................................2-2 Neutral: ...............................................................................................0-0
ByMonth: August: ...............................................................................................0-0 September:........................................................................................4-0 October: .............................................................................................3-1 November: .........................................................................................3-1 December: .........................................................................................0-0 January: ..............................................................................................0-0
When Scoring First: ...............................................................................5-1When Opponent Scored First: ..........................................................5-1When Scoring 20 or More Points: .................................................10-0When Scoring Less Than 20 Points: ................................................0-2When Leading at the Half: .................................................................7-0When Trailing at the Half: ...................................................................3-1When Tied at the Half: .........................................................................0-1Whenleadingafter3Quarters: .......................................................8-0WhenTrailingafter3Quarters: ........................................................1-2WhenTiedafter3Quarters: ..............................................................0-0WhenOutrushingtheOpponent: ...................................................9-0With35orMoreRushingAttempts: ...............................................8-2With Less Than 30 Passing Attempts: ............................................9-0When Leading in Time of Possession: ............................................8-1When Trailing in Time of Possession: .............................................2-1
OnTurf: .....................................................................................................9-1On Grass: ...................................................................................................1-1
WhenleadinginTakeaway/TurnoverRatio: ...............................5-1WhenEveninTakeaway/TurnoverRatio: .....................................2-0WhenTrailinginTakeaway/TurnoverRatio: ................................3-1Withanindividual100-YardRusher: ..............................................8-0Withanindividual200-YardPasser: ...............................................2-0 250-YardPasser: ...............................................................................2-0Withanindividual100-YardReceiver: ...........................................1-0WithanindividualOpponent100-YardRusher: ........................3-2WithanindividualOpponent200-YardPasser: .........................4-0 250-YardPasser: ...............................................................................3-0WithanindividualOpponent100-YardReceiver: .....................3-1
GREG MATTISONDefensive Coordinator
AL BORGESOffensive Coordinator/QB
DARRELL FUNKOffensive Line
DAN FERRIGNOSpecial Teams/Tight Ends
CURT MALLORYSecondary
FRED JACKSONRunning Backs
JEFF HECKLINSKIWide Receivers
JERRY MONTGOMERYDefensiveline
MARK SMITHLinebackers
AARON wELLMANStrength and Conditioning
ROY MANNINGgraduate Assistant/Offense
AUBREY PLEASANTgraduate Assistant/Defense
MICHIGAN FOOTBALL GAME NOTES PAGE 22
I N D I V I D U A L C A R E E R B E S T S
RUSHING
Devin GardnerAttempts: 6, 3 times, last at Michigan State (Oct. 15, 2011)Yards:39,vs.Minnesota(Oct.1,2011)TDs:1,twice,lastatNorthwestern(Oct.8,2011)Long: 15, vs. Minnesota (Oct. 1, 2011)
Kelvin GradyAttempts:1,twice(lastatPurdue,Nov.13,2010)Yards:13,atPurdue(Nov.13,2010)TDs:Nonelong:13,atPurdue(Nov.13,2010)
Stephen HopkinsAttempts:8,twice,lastatPurdue(Nov.13,2010)Yards:45,vs.illinois(Nov.6,2010)TDs:1,fourtimes,lastatPurdue(Nov.13,2010)Long: 32, vs. Illinois (Nov. 6, 2010)
Denard RobinsonAttempts:29,vs.Connecticut(Sept.4,2010)Yards:258,atNotreDame(Sept.11,2010)TDs:3,twice,lastvs.SanDiegoState(Sept.24,2011)long:87,atNotreDame(Sept.11,2010)
Michael ShawAttempts:15,vs.Connecticut(Sept.4,2010)Yards:126,vs.Massachusetts(Sept.18,2010)TDs:3,twice,lastvs.illinois(Nov.6,2010)long:50,vs.Massachusetts(Sept.18,2010)
Vincent SmithAttempts:18,atPurdue(Nov.13,2010)Yards:166,vs.DelawareState(Oct.17,2009)TDs:2,vs.Bowlinggreen(Sept.25,2010)Long: 56, at Indiana (Oct. 2, 2010)
Fitzgerald ToussaintAttempts: 29, vs. Nebraska (Nov. 19, 2011)Yards:192,atillinois(Nov.12,2011)TDs:2,4times,lastvs.OhioState(Nov.26,2011)Long: 65, at Illinois (Nov. 12, 2011)
PASSING
Devin GardnerAttempts: 10, vs. Bowling Green (Sept. 25, 2010)Completions: 7, vs. Bowling Green (Sept. 25, 2010)Yards:85,vs.Bowlinggreen(Sept.25,2010)TDs:1,twice,lastatillinois(Nov.12,2011)Long: 30, vs. Bowling Green (Sept. 25, 2010)
Denard RobinsonAttempts:40,atNotreDame(Sept.11,2010)Completions:24,atNotreDame(Sept.11,2010)Yards:338,vs.NotreDame(Sept.10,2011)TDs:4,vs.NotreDame,Sept.10,2011)long:77,vs.NotreDame(Sept.10,2011)
RECEIVING
Drew DileoCatches: 2, twice, last vs. Ohio State (Nov. 26, 2011)Yards:32,vs. Ohio State (Nov. 26, 2011) TDs:1,twice,lastvs.Minnesota(Oct.1,2011)Long: 28, vs. Ohio State (Nov. 26, 2011)
Jeremy GallonCatches: 5, at Northwestern (Oct. 8, 2011)Yards:79,vs.Purdue(Oct.29,2011) TDs:1,4times,lastvs.Nebraska(Nov.19,2011)long:64,vs.NotreDame(Sept.10,2011)
Kelvin GradyCatches: 3, 3 times (last vs. Wisconsin, Nov. 20, 2010)Yards:49,vs.Massachusetts(Sept.18,2010)TDs:1,vs.DelawareState(Oct.17,2009)long:43,vs.Massachusetts(Sept.18,2010)
Junior HemingwayCatches: 9, vs. Iowa (Oct. 16, 2010)Yards:165,vs.NotreDame(Sept.10,2011)TDs:2,twice,lastvs.illinois(Nov.6,2010)long:77,vs.NotreDame(Sept.10,2011)
Jeremy JacksonCatches: 2, twice (last at Ohio State, Nov. 27, 2010)Yards:31,atOhioState(Nov.27,2010)TDs:NoneLong: 22, at Ohio State (Nov. 27, 2010)
Kevin KogerCatches: 4, twice, last vs. Ohio State (Nov. 26, 2011)Yards:60,atPennState(Oct.30,2010)TDs:1,9times,lastvs. Ohio State (Nov. 26, 2011)Long: 60, at Penn State (Oct. 30, 2010)
John McColganCatches:1,2times,lastvs.NotreDame(Sept.10,2011)Yards:15,vs.NotreDame(Sept.10,2011) TDs:1,vs.Bowlinggreen(Sept.25,2010)long:15,vs.NotreDame(Sept.10,2011)
Martavious OdomsCatches:7,3times,lastatNotreDame(Sept.11,2010)Yards:129,vs.illinois(Oct.4,2008)TDs:1,5times,lastvs. Ohio State (Nov. 26, 2011)Long: 50, vs. Miami (OH) (Sept. 6, 2008)
Roy RoundtreeCatches:10,vs.Purdue(Nov.7,2009)Yards:246,vs.illinois(Nov.6,2010)TDs:2,vs.illinois(Nov.6,2010)Long: 76, at Illinois (Oct. 31, 2009)
Michael ShawCatches:3,twice,lastatNotreDame(Sept.11,2010)Yards:28,atNotreDame(Sept.11,2010)TDs:1,vs.Utah(Aug.30,2008)long:16,vs.Connecticut(Sept.4,2010)
Vincent SmithCatches: 7, at Wisconsin (Nov. 14, 2009)Yards:54,atWisconsin(Nov.14,2009)TDs:1,6times,lastvs.Minnesota(Oct.1,2011)Long: 28, vs. Minnesota (Oct. 1, 2011)
DEFENSE
Courtney AveryTackles: 7, vs. Wisconsin (Nov. 20, 2010)Solos:5,atPurdue(Nov.13,2010)Asst: 4, vs. Wisconsin (Nov. 20, 2010)TFLs: 1.0, vs. Nebraska (Nov. 19, 2011)Sacks:0.5,vs.Purdue(Oct.29,2011)Int.: 1, twice, last vs. Ohio State (Nov. 26, 2011)FR: 1, twice, last vs. Nebraska (Nov. 19, 2011)PBUs: 2, vs. Bowling Green (Sept. 25, 2010)
Blake Countess Tackles:7,vs.SanDiegoState(Sept.24,2011)Solos:5,vs.SanDiegoState(Sept.24,2011)Asst: 3, at Michigan State (Oct. 15, 2011)TFls:1,vs.Purdue(Oct.29,2011)Sacks: NoneInt.: NoneFR: NonePBUs: 2, vs. Minnesota (Oct. 1, 2011)
Kenny DemensTackles: 13, vs. Wisconsin (Nov. 20, 2010)Solos:6,atPurdue(Nov.13,2010)Asst: 8, twice, last at Iowa (Nov. 5, 2011)TFLs: 1, 5 times, last at Illinois (Nov. 12, 2011)Sacks: 1, twice, last at Illinois (Nov. 12, 2011)Int.: NoneFR: NonePBUs: 1, vs. Illinois (Nov. 6, 2010)
TOP STATISTICAL LEADERSRushing:2011:DenardRobinson(182carries,993yards,5.5avg.,14TDs)Career: DenardRobinson(507carries;3,046yards,6.0avg.,33TDs)
Passing:2011: DenardRobinson(119-220,1,889yards,15TDs,14ints.)Career: DenardRobinson(315-542;4,647yards,35TDs,29 Ints.)
Receiving:2011: JuniorHemingway(30for591yards,19.7avg.,1TD)Career:RoyRoundtree(121for1,706yards,14.1avg.,12TD)
Punt Returns:2011: Jeremygallon(19for192yards,10.1avg.,0TD)Career: Jeremygallon(29for235yards,8.1avg.,0TD)
Kickoff Returns:2011:MartaviousOdoms(13for295yards,22.7avg.,0TD)Career: MartaviousOdoms(48for1,066yards,22.2avg.,0TD)
Field Goals:2011: Brendangibbons(9for13,long42yards)Career:Brendangibbons(10for18,long42yards)
Tackles:2011: KennyDemens(78;43solos,35assists)Career: JordanKovacs(251;142solos,109assists)
Tackles for Loss:2011:RyanvanBergen(10.0for49yards)Career:RyanvanBergen(25.0for136yards)
Sacks:2011:RyanvanBergen(4.5for33yards)Career:RyanvanBergen(13.5for108yards)
Interceptions:2011:J.T.Floyd(2for59yards)Career: JordanKovacs(4for53yards)
Pass Breakups:2011: J.T.Floyd(8)Career: J.T.Floyd(13)
MICHIGAN FOOTBALL GAME NOTES PAGE 23
I N D I V I D U A L C A R E E R B E S T S J.B. FitzgeraldTackles:5,vs.DelawareState(Oct.17,2009)Solos:4,twice,lastatPurdue(Nov.13,2010)Asst: 3, at Penn State (Oct. 30, 2010)TFls:2,vs.Purdue(Nov.7,2009)Sacks: NoneInt.: NoneFR: NonePBUs: None
J.T. FloydTackles: 13, twice, last vs. Michigan State (Oct. 9, 2010)Solos: 10, vs. Michigan State (Oct. 9, 2010)Asst: 6, at Indiana (Oct. 2, 2010)TFLs: 1, twice, last vs. Michigan State (Oct. 9, 2010)Sacks: NoneInt.: 1, 3 times, last at Illinois (Nov. 12, 2011)FR: NonePBUs: 2, 3 times, last at Illinois (Nov. 12, 2011)
Cameron GordonTackles: 15, at Indiana (Oct. 2, 2010)Solos: 12, at Indiana (Oct. 2, 2010)Asst: 5, twice, last vs. Illinois (Nov. 6, 2010)TFLs: 1, twice, last at Ohio State (Nov. 27, 2010)Sacks: NoneInt.: 1, twice, last at Indiana (Oct. 2, 2010)FR:2,atPurdue(Nov.13,2010)PBUs: 1, five times, last vs. Illinois (Nov. 6, 2010)
Thomas GordonTackles: 8, vs. Western Michigan (Sept. 3, 2011)Solos:6,vs.SanDiegoState(Sept.24,2011)Asst:3,3times,lastvs.Purdue(Oct.29,2011)TFls:2,atNotreDame(Sept.11,2010)Sacks: 1, twice (last at Penn State, Oct. 30, 2010)Int.: 1, vs. Eastern Michigan (Sept, 17, 2011)FR: 1, 4 times, last at Illinois (Nov. 12, 2011)PBUs: 1, twice, last at Illinois (Nov. 12, 2011)
Brandin HawthorneTackles: 10, vs. Eastern Michigan (Sept. 17, 2011)Solos: 7, vs. Eastern Michigan (Sept. 17, 2011)Asst: 5, at Northwestern (Oct. 8, 2011)TFLs: 1, twice, last vs. Eastern Michigan (Sept. 17, 2011)Sacks:1,vs.Purdue(Oct.29,2011)Int.: 1, at Northwestern (Oct. 8, 2011)FR: NonePBUs:1,vs.NotreDame(Sept.17,2011)
Brandon HerronTackles: 8, vs. Western Michigan (Sept. 3, 2011)Solos:3,twice(lastvs.Connecticut,Sept.4,2010)Asst: 7, vs. Western Michigan (Sept. 3, 2011)TFLs: 0.5, twice (last vs. Penn State, Oct. 24, 2009)Sacks: NoneInt.: 1, vs. Western Michigan (Sept. 3, 2011)FR: 1, twice, last vs. Western Michigan (Sept. 3, 2011)PBUs: None
Jordan KovacsTackles: 17, twice, (last at Ohio State, Nov. 27, 2010)Solos: 9, at Ohio State (Nov. 27, 2010)Asst: 10, at Michigan State (Oct. 3, 2009)TFLs: 2.5, twice, last vs. Iowa (Oct. 16, 2010)Sacks: 2, vs. Western Michigan (Sept. 3, 2011)Int.: 1, 3 times, last at Ohio State (Nov. 27, 2010)FR: 1, twice, last at Michigan State (Oct. 15, 2011)PBUs: 1, twice, last vs. Western Michigan (Sept. 3, 2011)
Mike MartinTackles: 10, at Wisconsin (Nov. 14, 2009)Solos: 9, at Wisconsin (Nov. 14, 2009)Asst: 6, twice, last at Illinois (Nov. 12, 2011)TFLs: 3, at Wisconsin (Nov. 14, 2009)Sacks:2,vs.Purdue(Oct.2,2010)Int.: NoneFR: NonePBUs: None
Desmond MorganTackles: 10, vs. Ohio State (Nov. 26, 2011)Solos: 4, twice, last at Illinois (Nov. 12, 2011)Asst: 7, vs. Ohio State (Nov. 26, 2011)TFLs: 1.5, vs. Ohio State (Nov. 26, 2011)Sacks: 1, vs. Ohio State (Nov. 26, 2011)Int.: NoneFR: 1, at Michigan State (Oct. 15, 2011)PBUs: 1, at Iowa (Nov. 5, 2011)
Craig RohTackles: 7, vs. Eastern Michigan (Sept. 19, 2009)Solos: 5, vs. Illinois (Nov. 6, 2010)Asst: 5, vs. Eastern Michigan (Sept. 19, 2009)TFLs: 2, 5 times, last at Michigan State (Oct, 15, 2011)Sacks: 1, 4 times, last at Iowa (Nov. 5, 2011)Int.: 1, vs. Eastern Michigan (Sept. 19, 2009)FR: NonePBUs: 2, at Michigan State (Oct. 3, 2009)
Jake RyanTackles:5,vs.SanDiegoState(Sept.24,2011)Solos:4,vs.SanDiegoState(Sept.24,2011)Asst:3,vs.Purdue(Oct.29,2011)TFls:1,5times,lastvs.Purdue(Oct.29,2011)Sacks: 1, vs. Minnesota (Oct. 1, 2011)Int.: NoneFR:2,vs.SanDiegoState(Sept.24,2011)PBUs: None
Ryan Van BergenTackles: 7, twice, last vs. Ohio State (Nov. 26, 2011)Solos: 5, 3 times, last vs. Ohio State (Nov. 26, 2011)Asst: 5, vs. Indiana (Sept. 26, 2009)TFLs: 3, twice, last at Illinois (Nov. 12, 2011)Sacks: 2.5, at Illinois (Nov. 12, 2011)Int.: NoneFR: 1, 3 times, last vs. Nebraska (Nov. 19, 2011)PBUs: 2, vs. Indiana (Sept. 26, 2009)
Troy woolfolkTackles:8,vs.NotreDame(Sept.12,2009)Solos: 5, twice, (last vs. Ohio State, Nov. 21, 2009)Asst: 5, at Iowa (Nov. 5, 2011)TFLs: NoneSacks: NoneInt.: NoneFR: NonePBUs: 2, vs. Eastern Michigan (Oct. 6, 2007)
PUNT RETURNS
Drew DileoReturns:1,3times,lastvs.EasternMichigan(Sept.17,2011)Yards:15,vs.Bowlinggreen(Sept.25,2010)TDs:NoneLong: 15, vs. Bowling Green (Sept. 25, 2010)
Jeremy GallonReturns:4,twice,lastvs.Nebraska (Nov. 19, 2011)Yards:62,at Illinois (Nov. 12, 2011)TDs:NoneLong: 32, at Illinois (Nov. 12, 2011)
Martavious OdomsReturns:4,vs.DelawareState(Oct.17,2009)Yards:82,atPurdue(Nov.1,2008)TDs:1,atPurdue(Nov.1,2008)long:73,atPurdue(Nov.1,2008)
KICK RETURNS
Drew DileoReturns:6, at Ohio State (Nov. 27, 2010)Yards:118, at Ohio State (Nov. 27, 2010)TDs:NoneLong: 34, vs. Wisconsin (Nov. 20, 2010)
Jeremy GallonReturns:7, vs. Illinois (Nov. 6, 2010)Yards:139, vs. Illinois (Nov. 6, 2010)TDs:NoneLong: 47, at Penn State (Oct. 30, 2010)
Kelvin GradyReturns:3, vs. Western Michigan (Sept. 3, 2011)Yards:57, vs. Western Michigan (Sept. 3, 2011)TDs:NoneLong: 14, vs. Indiana (Sept. 26, 2009)
Martavious OdomsReturns:7, vs. Illinois (Oct. 4, 2008)Yards:183, vs. Illinois (Oct. 4, 2008)TDs:NoneLong: 36, vs. Illinois (Oct. 4, 2008)
Vincent SmithReturns:5,vs.NotreDame(Sept.10,2011)Yards:98,vs.NotreDame(Sept.10,2011)TDs:NoneLong: 24,vs.NotreDame(Sept.10,2011)
KICKING
Brendan GibbonsPoints: 16, vs. Minnesota (Oct. 1, 2011)FG Att.: 3, vs. Minnesota (Oct. 1, 2011)FG Made: 3, vs. Minnesota (Oct. 1, 2011)PATs: 7, vs. Minnesota (Oct. 1, 2011)Long FG: 43, vs. Ohio State (Nov. 26, 2011)
will HagerupPunts:9,atNotreDame(Sept.11,2010)Yards:345,atNotreDame(Sept.11,2010)Average:51.0,vs.Connecticut(Sept.4,2010)50+: 2, 3 times (last vs. Michigan State, Oct. 9, 2010)I-20: 3, at Michigan State, Oct. 15, 2011)long:72,atPurdue(Nov.13,2010)
Matt wilePunts:5,vs.NotreDame(Sept.10,2011)Yards:196,vs.SanDiegoState(Sept.24,2011)Average:49.0,vs.SanDiegoState(Sept.24,2011)50+:1,vs.SanDiegoState(Sept.24,2011)i-20:2,vs.SanDiegoState(Sept.24,2011)long:51,vs.SanDiegoState(Sept.24,2011)
MICHIGAN FOOTBALL GAME NOTES PAGE 24
Michigan Stadium -- 1927-2011 (85 Years) Thefootballprogramisinits85thseasoninthe"BigHouse"in2011,witha392-120-15all-timerecordatMichiganStadium.Thelargestcollegefootballstadiuminthecountry,itwascompletedin1927atacostof$950,000,initiallyseating72,000fans.MichiganwonthefirstgameplayedatMichiganStadium,defeatingOhioWesleyan,33-0,onOct.1,1927.ThestadiumwasofficiallydedicatedonOct.22,1927,witha21-0shutoutoverOhioState. Sincethatinauguralseason,thecapacityofMichiganStadiumhasincreasednine times to its present 109,901. The Wolverines have led the nation in attendance 36timesinthepast37years,andreestablishedtheNCAAsingle-gameattendancerecordat114,804fansagainstNotreDameinthefirstnightgameeverinMichiganStadium.Thepreviousmarkwas113,090fansagainstConnecticutduringthe2010rededicationofMichiganStadium. Michiganhasdrawncrowdsof100,000-plusfor238consecutivegames.Onfoot-ballSaturdaysinAnnArbor,MichiganStadiumranksasthefourth-largest"city"inthe state of Michigan. TheWolverinesdrew897,431fansfortheireight-gamehomeschedulein2011.Theeight-gameaverageof112,179brokeMichigan’sNCAArecordof111,825fanspercontestsetduringthe2010season. MichiganStadiumwastheonlycollege-ownedfootballfacilitywithavideoscoreboardabovebothendzones.itwasalsothefirststadiumtouseelectronicscoreboards for official time when, in 1930, two were installed.
CAPACITY: 109,901--thelargestcollege-ownedstructuresofitskinddesignedsolelyforfootball--closertotheplayingfieldwithnorunningtrack--nopostsorotherobstructions.
COMPLETION: 1927---atacostinexcessof$950,000toseat72,000spectators.Capacityraisedto84,401byadditionoftemporarywoodenbleachersuntil1949 when permanent steel stands replaced the wooden bleachers, increas-ingthecapacityto97,239.Seatingcapacitythenraisedto101,001in1956,101,701 in 1973, 102,501 in 1992 and 107,501 in 1998.
FIRST GAME:October1,1927--MichiganledbyCaptainBennieOosterbaan,defeatedOhioWesleyan,33-0.laverne(Kip)Taylor,Michiganend,scoredfirstinthesta-diumona28-yardpassfromhalfbacklouisgilbert.
DEDICATION GAME: October 22, 1927 -- Michigan defeated Ohio State, 21-0.REDEDICATION GAME:September4,2010--MichigandefeatedConnecticut,30-10.ATTENDANCE:Since1927--44,501,581fanshavewatchedtheWolverinesplay527
games.Stadiumattendancerecordof106,982setNov.22,1997againstOhioState.Sinceexpansionofthe“BigHouse”in1998,andtherededicationin2010,thesingle-gameattendancerecordis114,804setagainstNotreDameonSept.10, 2011. The NCAA season record of 897,431 set in 2011.
FIELD:360x160feet--installednewFieldTurfin2010.TheoriginalFieldTurfsurfacewasinstalledin2003,returningMichigantoanartificialsurfaceforthefirsttimesincethe1990season.installedPrescriptionAthleticTurfin1991,givingMichiganitsfirstnaturalgrassfieldsince1968.Fieldwasalsolowered3-1/2feet allowing better sightlines for those seated in the lower rows.
Michigan Stadium Milestone GamesNo. Date Opponent Result Score1 Oct.1,1927 OhioWesleyan W 33-050 Nov.2,1935 Pennsylvania W 16-6100 Sept. 15, 1945 Great Lakes W 27-2200 Oct. 14, 1961 Michigan State L 0-28250 Oct.11,1969 Purdue W 31-20300 Sept.24,1977 Navy W 14-7400 Sept.11,1993 NotreDame l 23-27500 Sept. 27, 2008 Wisconsin W 27-25
Michigan Stadium Milestone wins
No. Date Opponent Score1 Oct.1,1927 OhioWesleyan 33-050 Sept. 27, 1941 Michigan State 19-7100 Oct. 11, 1952 Indiana 28-13200 Oct. 18, 1975 Northwestern 69-0250 Oct. 27, 1984 Illinois 26-18300 Aug.26,1995 virginia 18-17350 Oct.25,2003 Purdue 31-3
University of Michigan Home StadiumsStadium Years Games win Loss Tie Capacity (Yr)Ann Arbor Sites ...................1883-1892 18 17 1 0 Regents Field ........................1893-1905 92 87 2 3 400 (1893) 800 (1896)FerryField ..............................1906-1926 104 88 14 2 18,000 (1906) 25,000 (1914) 40,000 (1921) 46,000 (1926)MichiganStadium ..............1927-2011 527 392 120 15 72,000 (1927) 84,401 (1927) 85,753 (1928) 97,239 (1949) 101,001 (1956) 101,701 (1973) 102,501 (1992) 107,501 (1998) 106,201 (2008) 109,901 (2010)Total Ann Arbor Record 741 584 137 20inDetroit 1879-1901 18 12 5 1Total Home Record 759 596 142 21
100,000-Plus Crowds at Michigan StadiumThefootballprogramhasplayed238consecutivehomegamesinfrontofcrowds
inexcessof100,000.ThelasttimeMichigandidnothave100,000inattendanceinMichiganStadiumwasonOct.25,1975vs.indiana.Acrowdof93,857wasonhandforthe55-7Michiganvictory.
Sincethen,MichiganhassetnumerousNCAAattendancemarksandtheWolverineshave led the nation for 36 of the past 37 seasons in attendance.
Top 5 College Football StadiumsSchool Stadium CapacityMichigan Michigan 109,901Penn State Beaver 106,572Tennessee Neyland 102,455Ohio State Ohio 102,329Alabama Bryant-Denny 101,821
Top 10 Stadium CrowdsGame Year AttendanceNotreDame 2011 114,804*Ohio State 2011 114,132Nebraska 2011 113,718Connecticut 2010 113,090Michigan State 2010 113,065Iowa 2010 112,784Wisconsin 2010 112,276Ohio State 2003 112,118Purdue 2011 112,115NotreDame 2003 111,726* NCAA single-game record.
M I C H I G A N S T A D I U M
MICHIGAN FOOTBALL GAME NOTES PAGE 25
G A M E R E C A P S - V S . w E S T E R N M I C H I G A N
SCORING SUMMARYFirst QuarterWMU:SCRivEN,A.1ydrun(POTTER,J.kick)
Second QuarterMiCH:Toussaint,F.1ydrun(gibbons,B.kick)MiCH:Herron,Brandon94ydinterceptionreturn(Gibbons, B. kick)MiCH:Toussaint,F.2ydrun(gibbons,B.kickblocked)WMU:POTTER,J.36ydfieldgoal
Third QuarterMiCH:Herron,Brandon29ydfumblerecovery(Gibbons, B. kick)MiCH:Shaw,Michael44ydrun(gibbons,B.kick)
TEAM STATISTICSCategory wMU U-M FiRSTDOWNS 17 17RUSHES-YARDS(NET) 25-96 26-190PASSiNgYDS(NET) 183 98Passes Att-Comp-Int 31-22-1 13-9-0 TOTAL OFFENSE 56-279 39-288 FumbleReturns-Yards 0-0 1-29PuntReturns-Yards 2-16 1-5KickoffReturns-Yards 6-188 3-57interceptions-Yards 0-0 1-94Punts(Number-Avg) 2-46.5 2-41.0Fumbles-lost 3-2 1-0Penalties-Yards 8-50 1-5Possession Time 25:18 18:15 Third-DownConv. 6of11 3of6Fourth-DownConv. 1of1 1of1Red-Zone 2-3 2-2
INDIVIDUAL STATISTICSRUSHING: western Michigan-DRAKE,Tevin10-65;FiElDS,Brian1-14;PONDER,Ansel1-11;SCRivEN,Antoin3-6;CHANCE,Dareyon1-0;CARDER,Alex9-0.MICH-ToussaintFitzgerald11-80;Shaw,Michael4-54;Robinson,Denard8-46;Smith,vincent2-11;TEAM1-minus1.
PASSING: western Michigan-CARDER,Alex22-31-1-183. MICH-Robinson,Denard9-13-0-98.
RECEIVING: western Michigan-WHITE, Jordan 12-119; RAVENELL, Chleb 4-30; ARNHEIM,Robert3-11;DRAKE,Tevin1-12;CHANCE,Dar-eyon1-7;MONETTE,Eric1-4.MICH-Koger,Kevin2-16;gallon,Jeremy2-14;Roundtree,Roy2-13;Hemingway,Junior1-37;grady,Kelvin1-15;Dileo,Drew1-3.
After Western Michigan scored on its opening drive withaone-yardrushingtouchdownonfourthdown,Michigancounteredwithaone-yardtouchdownrunby Toussaint on the ensuing possession. Toussaintearnedsixcarriesonthe16-playscoringdrive,includ-ing a key three-yard run on fourth-and-one to theWMU16-yard line to extend the possession. JuniorquarterbackDenardRobinson(DeerfieldBeach,Fla./DeerfieldBeach)wasperfect inhis firstdriveof the2011 campaign, completing 5-of-5 passes for 33 yardsandadding26yardsontheground.
The Broncos had two opportunities to retake thelead,butfirstmisseda38-yardfieldgoalwiderightand, after maneuvering the way down to the U-Mfour-yard line, sophomore/freshman outside line-backerJakeRyan(Westlake,Ohio/St.ignatius)brokethrough the Broncos’ offensive line and deflectedthe intended pass straight up into the air and intothe waiting arms of Herron, who tip-toed the right sideline before hurrying down field with a convoyof Michigan defenders for a 94-yard return for atouchdown,giving theWolverines their first leadofthe game, 14-7, with 6:58 remaining in the second quarter.
U-Mthenforcedathree-and-outtosetupToussaint’ssecondtouchdown late in thesecondhalf --a two-yard dive up themiddle. Robinson connectedwithjunior/sophomore wide receiver Jeremy gallon(Apopka, Fla./Apopka) and senior/junior widereceiver Roy Roundtree (Trotwood,Ohio/Trotwood-Madison) on both his pass attempts, before fourstraightMichigan carries covered the final 22 yardsinto the end zone, including a Robinson 10-yarddance and weave through theWMU defense for afirst down.
Western Michigan added a 36-yard field goal with43 seconds left tocut theWolverines’ lead to20-10heading into halftime.
Kovacsmade the play of the second half when hestormedinonablitzandlituptheWMUquarterback,forcing a fumble. Herron picked up the loose ball,his second career fumble recovery, and thundered28yards intotheendzoneforhisseconddefensivescore of the game for a 27-10 Michigan advantage. The Wolverines followed the defensive score with thelongtouchdownrunbyShawtotakea24-pointlead,andweredrivingagainlateinthethirdquarter,afterfifth-yearseniordefensiveendRyanvanBergen(Whitehall, Mich./Whitehall) recovered a Western Michigan fumbled snap, when the officials issuedthe second weather-related suspension, ultimatelyending the game.
GAME 1: western Michigan at MichiganMichigan StadiumSeptember 3, 2011110, 506
1st ...2nd ... 3rd .... 4th ...FINALWestern Michigan 7 ........3 .........0 ........N ............10Michigan ................. 0 ...... 20 ...... 14 .......N ............34
ANN ARBOR, Mich. -- Senior weakside line-backer Brandon Herron (Stafford, Texas/Dulles) became the firstWolverine in schoolhistory to post two defensive scores in asingle contest,helping lead theUniversityofMichigan football to a 34-10 win over Western Michigan in the 2011 season opener, which wasdeclaredfinalwith1:27inthethirdquar-terduetoweatheronSaturday(Sept.3)insideMichiganStadium.Thevictory ishead coachBradyHoke’sfirstatthehelmoftheMichiganprogram.
Although the opening kickoff featured90-degree heat and sunny skies, stormsfrom the southwest rolled over MichiganStadium in the second half. The game wassuspended twice in the third quarter afterlightningwas spottedwithin sixmilesof thestadium.Thefirstsuspensionresultedinonlya 30-minute delay, but the bleak outlook ofthe second suspension forced Michigan andWestern Michigan officials to call the game with1:27leftinthethirdquarteranddeclarethe Wolverines the winner. This is the first Michigan football game to end before all 60 minutesofregulationhavebeenplayed.
Herron, who racked up a career-high eighttackles, returned both an interception and afumbletothesouthendzonefortouchdowns.His 94-yard interception return for a touch-down midway through the second quarterwas the longest interception return in pro-gramhistory,bestingKenTureaud’s92-yarderin 1961. Senior/junior safety Jordan Kovacs(Curtice,Ohio/Clay)ledthedefenseintackles(10), TFLs (two) and sacks (two), and registered theforcedfumblethatledtoHerron’ssecondtouchdown.
On the offensive side of the ball, junior/sophomorerunningbackFitzgeraldToussaint(Youngstown,Ohio/liberty)--inhisfirstcareerstart -- recorded 11 carries for a career-high 80 yards and a career-best two touchdowns.Both of Toussaint’s scores were from withintwoyardsofthegoalline(oneyard,twoyard).He also registered a 43-yard run late in thethirdquarter thatsetupsenior runningbackMichael Shaw’s (Trotwood, Ohio/Trotwood-Madison)44-yardtouchdownsprint--thelon-gest of touchdownof his career -- twoplayslaterforMichigan’sfinaltouchdown.
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 26
G A M E R E C A P S - V S . N O T R E D A M E
SCORING SUMMARYFirst QuarterND:RiDDiCK7ydpassfromREES(RUFFERkick)ND:WOOD4ydrun(RUFFERkick)Second QuarterMiCH:Hemingway43ydpassfromRobinson(gibbonskick)ND:RUFFER38ydfieldgoalThird QuarterND:JONES15ydpassfromREES(RUFFERkick)Fourth QuarterMiCH:Robinson1ydrun(gibbonskick)MiCH:gallon14ydpassfromRobinson(gibbonskick)MiCH:Smith21ydpassfromRobinson(gibbons,kick)ND:RiDDiCK29ydpassfromREES(RUFFERkick)MiCH:Roundtree16ydpassfromRobinson(gibbonskick)
TEAM STATISTICSCategory ND U-M FiRSTDOWNS 28 16RUSHES-YARDS(NET) 33-198 26-114PASSiNgYDS(NET) 315 338Passes Att-Comp-Int 39-27-2 24-11-3 TOTAL OFFENSE 72-513 50-452FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 3-10 1-21KickoffReturns-Yards 6-89 5-98interceptions-Yards 3-0 2-18Punts(Number-Avg) 4-33.5 5-38.6Fumbles-lost 4-3 1-0Penalties-Yards 9-75 9-82Possession Time 37:01 22:59 Third-DownConv. 8of14 3of9Fourth-DownConv. 0of0 0of0Red-Zone 3-5 3-3
INDIVIDUAL STATISTICSRUSHING: Notre Dame-WOOD,Cierre25-134;gRAY,Jonas6-66;REES,Tommy2-minus2.MICH-Robinson,Denard16-108;Hopkins,Ste-phen 5-10; Smith, Vincent 1-3;Shaw,Michael2-minus3;TEAM2-minus4.
PASSING: Notre Dame-REES,Tommy27-39-2-315. MICH-Robinson,DenardRobinson,Denard11-24-3-338.
RECEIVING: Notre Dame-FlOYD,Michael13-159;RiDDiCK,Theo6-62;EiFERT,Tyler4-51;JONES,TJ3-28;gRAY,Jonas1-15.MICH-Hemingway,Junior3-165;gallon,Jeremy2-78;Smith,vincent2-26;grady,Kelvin1-27;Roundtree,Roy1-16;McColgan,John1-15;Koger,Kevin1-11.
anunderthrownballtoastreakingHemingwaydowntheleftsideline.Hemingwaybrokeoffhisrouteatthethree-yard line, jumped in theair for the catchandlungedforthepylonfora43-yardtouchdowntocutNotreDame’sleadinhalf,14-7.
The Michigan defense made another big stop on NotreDame’sensuingdrivewhensenior/juniorcor-nerbackJ.T.Floyd(greenville,S.C./J.l.Mann)notchedthe Wolverines’ second interception of the night.Floyd picked off Rees’ forced pass near the goalline and returned it to the U-M 18-yard line. TheWolverinesdidnotcapitalizeontheturnover,punt-ingtheballbacktotheFightingirishthreeplayslaterand Notre Dame tacked on a 38-yard field goal totake a 17-7 lead into halftime.
The second half opened with the Fighting Irish driv-ingthefootballintoMichiganterritorytwice,buttheMaizeandBluedefenseforcedapuntandafumble.However,NotreDameextendeditsleadto17pointsonitsnextdrivewitha15-yardtouchdownpassfromRees to sophomore wide receiver T.J. Jones on third-and-ninewith2:13leftinthethirdquarter.
The Wolverines responded immediately, asRobinson’s77-yardpass-and-catchwithHemingwaybroughtMichigan to the Notre Dame six-yard line.Ontheensuingsnap,RobinsonpickedupaMichiganfumble at the one-yard line on the first play of thefourth quarter and scampered into the end zoneuntouchedtocutNotreDame’sleadto24-14.
TheWolverines’ comeback continued when junior/sophomore linebacker Brandin Hawthorne (Pahokee, Fla./Pahokee) made plays on each snap of NotreDame’s ensuing three-and-out, including a passbreakup and tackle for loss (three yards). Michiganmade it a one-possession game five plays laterwhen Robinson lobbed a 14-yard touchdown passto junior/sophomore wide receiver Jeremy gallon(Apopka, Fla./Apopka) in the back right of the end zone.
The defense came up big once again when fifth-year defensive end Ryan van Bergen (Whitehall,Mich./Whitehall) picked up a fumble by Rees ontheMichigannine-yard line, and then forcedNotreDametoathree-and-outontheFightingirish’snextpossession.
TheWolverinesthencharged58yardsdownthefieldoverfiveplays,endingtheserieswhenjuniorrunningback vincent Smith (Pahokee, Fla./Pahokee) hauledinascreenpassfromRobinsonanddodged21yardsthrough defenders to give Michigan a three-pointlead with 1:12 remaining.
Theirishmountedarallyoftheirownina42-secondseries that concluded with a 29-yard completionto Riddick for the touchdownwith 30 seconds left.Michigan completed its comeback on the ensuingdrivewithRobinson’s16-yardreceptiontoRoundtreefor the game-winning score.
GAME 2: Notre Dame at MichiganMichigan StadiumSeptember 10, 2011114, 804
1st ...2nd ... 3rd .... 4th ...FINALNotreDame .......... 14 .......3 .........7 ........ 7 ............31Michigan ................. 0 ........7 .........0 ....... 28 ...........35
ANN ARBOR, Mich. -- For the third straight season, the University of Michigan footballteamovertookNotreDameinthefinal30sec-onds,asjuniorquarterbackDenardRobinson(Deerfield Beach, Fla./Deerfield Beach) com-pleted a 16-yard pass to senior/junior widereceiver Roy Roundtree (Trotwood, Ohio/Trotwood-Madison) with two seconds remain-ing to give the Wolverines a 35-31 comeback victory in the Under the lights contest onSaturday (Sept. 10) insideMichigan Stadium.In front of a record crowd of 114,804 fans, the Wolverines clawed their way back into thegame from a 14-0 deficit in the first quarter,tallying28fourth-quarterpoints.
Robinson completed11passes for 338 yardsand four touchdowns. He also ran for onemorescoretogowithateam-high108yardsrushing.The leadchangedthreetimes in thefinalminuteandahalfof thecontest,beforeU-Mscoredthego-aheadtouchdowntoenda30-second,80-yarddrive.
Fifth-year senior wide receiver JuniorHemingway (Conway, S.C./Conway), whodonstheNo.21jersey,accumulated165yardsreceivingonthreecatches,includingacareer-long 77-yard catch that resulted in a U-Mtouchdown on the next snap. Hemingwayscored the first receiving touchdown ofthe 2011 season on the same night former Wolverine wide receiver and Heisman win-nerDesmondHoward,whowore theNo. 21jerseyfrom1988-91,washonoredduringthepre-gameceremonyasthefirst-everMichiganFootball Legend.
The U-M offense was stagnant in the first quarter, registering only 27 yards of offense,while the Fighting Irish got off to a fast start, driving down the field on their first two drives -- 57 and 83 yards, respectively -- to take a14-0 lead.
The Wolverines swung momentum in theirfavorearlyinthesecondquarterwhensenior/junior safety Jordan Kovacs (Curtice, Ohio/Clay) recordedhis fourth career interception,stepping in front of Notre Dame wideoutMichael Floyd, who finishedwith 13 catchesfor 159 yards, near the sidelines to pick offNotreDame sophomorequarterbackTommyRees’ third-down throw. Two plays later, theMaize and Blue’s aerial attack got back ontrack.Rollingouttotheright,Robinsonthrew
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 27
G A M E R E C A P S - V S . E A S T E R N M I C H I G A N
SCORING SUMMARYFirst Quarterno scoringSecond QuarterEMU:FUlKERSON21ydfieldgoalMiCH:Koger9ydpassfromRobinson(gibbonskick)MiCH:Robinson11ydrun(gibbonskick)Third QuarterMiCH:Toussaint1ydrun(gibbonskick)MiCH:Dileo19ydpassfromRobinson(gibbonskick)Fourth QuarterMiCH:gibbons21ydfieldgoal
TEAM STATISTICSCategory EMU U-M FiRSTDOWNS 12 24RUSHES-YARDS(NET) 46-207 50-376PASSiNgYDS(NET) 29 95Passes Att-Comp-Int 6-3-1 18-7-1 TOTAL OFFENSE 52-236 68-471 FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 2-16 3-17KickoffReturns-Yards 6-122 2-31interceptions-Yards 1-0 1-0Punts(Number-Avg) 5-43.6 3-35.0Fumbles-lost 1-1 1-0Penalties-Yards 5-45 2-17Possession Time 27:45 32:15 Third-DownConv. 4of12 9of14Fourth-DownConv. 1of2 0of1Red-Zone 1-2 5-5 SacksBy:Number-Yards 0-0 1-6
INDIVIDUAL STATISTICSRUSHING: Eastern Michigan-GREENE, Javonti 21-80;gillETT,Alex11-61;WHiTE,D.7-34;AllEN,Tyler1-18;BRUMFiElD,Ryan5-12;FLEMING, Joe 1-2. Michigan-Robinson,Denard26-198;Smith,vincent9-118;ToussaintFitzger-ald11-46;gardner,Devin1-7;Rawls,Thomas2-4; Shaw, Michael 1-3.
PASSING: Eastern Michigan-gillETT,Alex3-5-0-29;BENZ,Tyler0-1-1-0.Michigan-Robinson, Denard7-18-1-95.
RECEIVING: Eastern Michigan-SHElBY,Julius1-18;THOMAS,Kinsman1-6;RUSSEll,T. 1-5. Michigan-gallon,Jeremy3-43;Koger,Kevin2-21;Dileo,Drew1-19;Jackson,Jeremy1-12.
Michiganonly tallied32 totaloffensiveyards in thefirstquarterwhileallowingEasternMichigantogain122yardsontheground.TheEaglesmovedtheballinto red zone on two early drives, but EMU couldonly put three points on the scoreboard. On thefirst drive, Eastern Michigan opted to go for the end zoneonfourth-and-goalfromtheone-yardline,butsenior/junior safety Jordan Kovacs (Curtice, Ohio/Clay) stuffed the leaping Eagles ball carrier shortof thegoal line to forcea turnoverondowns. EMUstalledatthefour-yardlineontheseconddriveandkickeda21-yardfieldgoalfora3-0leadtostartthesecondquarter.
ThegamebegantoturninMichigan’sfavorearly inthe second quarter when gordon made a miracu-lous one-handed interception three yards shy ofthe Michigan goal line on an EMU trick pass play.Theoffenseproceededtomarch97yardsdownthefieldforatouchdownandMichigan’sfirstleadofthegame,7-3.Robinson rushedon thedrive’s first fourplays for 76 yards, including a season-long 52-yardscamper,andcappedthescoringdrivebytossinganine-yardtouchdownpasstoKoger.
TheMaize and Blue tacked on another touchdownwith 39 seconds left in the second quarter to takea 14-3 lead heading into halftime. Michigan moved theballdownfieldquickly,covering87yards in justsixplays.Allsixplayswereruns, featuringRobinsonand Smith. Both Robinson and Smith registered 38 rushing yards on the drive, with Robinson earningfour carries andSmithdoing itonone long runupthe left sidelines. Robinson finished the drive with an untouched11-yardtouchdownupthemiddleofthefieldonadesignedquarterbackrun.
MichiganbegantopullawayfromEasternMichiganin the secondhalfwith long, sustained touchdowndrives. Toussaint recorded his third rushing touch-down of the season onU-M’s opening drive of thethird quarter, diving across the goal line from oneyardout toput theWolverinesaheadof theEagles,21-3. Dileo added another Michigan touchdown--thefirstofhiscareer--ontheensuingpossessing,snagging a Robinson bullet on a fake quarterbackdraw for a 19-yard score with 1:05 left in the thirdquarter.
Robinson led the Wolverines on another long scoring drivelate inthefourthquarter.The13-play,84-yardpossession stalled inside EMU’s five-yard linewhena Robinson third-down pass was a little too high for the outstretched hands of senior/junior tight endBrandon Moore (Trotwood, Ohio/Trotwood-Madison) in the end zone. Michigan settled for its first field goal of theseason --a21-yarder --by junior/sophomoreplacekicker Brendan Gibbons (West Palm Beach, Fla./CardinalNewman)forthegame’sfinalscore,31-3.
GAME 3: Eastern Michigan at MichiganMichigan StadiumSeptember 17, 2011110,343
1st ...2nd ... 3rd .... 4th ...FINALEastern Michigan ... 0 ........3 .........0 ........ 0 .............. 3Michigan ................. 0 ...... 14 ...... 14 ....... 3 ............31
ANN ARBOR, Mich. -- Junior quarterbackDenard Robinson (Deerfield Beach, Fla./Deerfield Beach) and junior running backVincent Smith (Pahokee, Fla./Pahokee) each eclipsed 100 yards rushing as the Universityof Michigan football team ran over Eastern Michigan, 31-3, on Saturday (Sept. 17) atMichiganStadium.Robinsonnearedhiscareerhigh in rushing attempts with 26, amassing198yardsanda touchdown,whileSmith rantheballninetimesfor118yards.
The Wolverines piled up 376 rushing yards(2TDs), themost since registering 466 rush-ing yards against Bowling green last sea-son. Robinson and Smith became the first Wolverines tobotheclipse100rushingyardsin the same game since Robinson and senior runningbackMichaelShaw(Trotwood,Ohio/Trotwood-Madison) accomplished the feat last season against Massachusetts. Junior/sophomore tailback Fitzgerald Toussaint(Youngstown,Ohio/liberty) added 11 carriesfor46yardsandpunchedinaone-yardtouch-downinthethirdquarter.
Robinson completed 7-of-18 passes for 95 yards but still managed to throw for twotouchdowns,connectingwithseniortightendKevin Koger (Toledo, Ohio/Whitmer) in thesecondquarterforMichigan’sfirsttouchdownand sophomore wide receiver Drew Dileo(Greenwell Springs, La./Parkview Baptist) in the third quarter. Junior/sophomore wide-outJeremygallon(Apopka,Fla./Apopka)wasRobinson’s favorite target, grabbing threepassesforateam-high43yards.
Ondefense,junior/sophomoresafetyThomasgordon (Detroit,Mich./CassTechnical) talliedhisfirstcareerfumblerecoveryandfirstcareerinterception while adding six tackles. Bothof gordon’s takeaways keyed U-M’s first-halfdefense.inhisfirstcareerstart,junioroutsidelinebacker Brandin Hawthorne (Pahokee, Fla./Pahokee) earned his first double-digit tack-le performance with a team-high 10 stops, including a tackle-for-loss. Junior Craig Roh(Scottsdale, Ariz./Chaparral) made five tack-les, includinghis firstsackoftheseason,andsophomore Jibreel Black (Cincinnati, Ohio/Wyoming)registeredfourtacklesandhisfirstcareerforcedfumble.
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 28
G A M E R E C A P S - V S . S A N D I E G O S T A T E
SCORING SUMMARYFirst QuarterMiCH:Robinson5ydrun(gibbonskick)MiCH:Robinson53ydrun(gibbonskick)Second QuarterMiCH:Robinson1ydrun(gibbons,kick)Third QuarterSDSU:lOCKETT16ydpassfromliNDlEY(PEREZkick)Fourth QuarterMiCH:Smith7ydrun(gibbonskick)
TEAM STATISTICSCategory SDSU U-M FiRSTDOWNS 20 18RUSHES-YARDS(NET) 29-123 45-320PASSiNgYDS(NET) 253 93Passes Att-Comp-Int 48-23-0 17-8-2 TOTAL OFFENSE 77-376 62-413 FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 2-22 2-21KickoffReturns-Yards 4-75 0-0interceptions-Yards 2-0 0-0Punts(Number-Avg) 6-38.2 4-49.0Fumbles-lost 4-3 3-2Penalties-Yards 6-55 4-25Possession Time 29:47 30:13 Third-DownConv. 8of18 4of11Fourth-DownConv. 0of3 1of1Red-Zone 1-3 3-3
INDIVIDUAL STATISTICSRUSHING: San Diego State-HILLMAN, Ronnie 21-109;lOCKETT,Colin2-13;KAZEE,Walter3-10;MCFADDEN,leon2-5;liNDlEY,Ryan1-mi-nus14.Michigan-Robinson,Denard21-200;ToussaintFitzgerald13-67;Smith,vincent9-47;Hopkins,Stephen1-8;TEAM1-minus2.
PASSING: San Diego State-liNDlEY,Ryan23-48-0-253. Michigan-Robinson,Denard8-17-2-93.
RECEIVING: San Diego State-DENSO,Dylan7-77;lOCKETT,Colin7-71;ESCOBAR,gavin5-64;HillMAN,Ronnie2-15;RUSSEll,Marcus1-15;KAZEE,Walter1-11.Michigan-Smith, Vincent 3-44;Roundtree,Roy2-15;Dileo,Drew1-17;Hemingway,Junior1-9;gallon,Jeremy1-8.
After Roh and the Michigan defense stuffed SanDiego State to force a three-and-out to start thegame, Robinson and Smith accounted for 59 ofMichigan’s 61 yards -- all rushing -- on the ensuingpossession.Eachhadabigplaytoextendthedrive,with Robinson scrambling 19 yards on third downand Smith breaking multiple tackles for a 32-yardgain. Robinson scored on a designed quarterbackrunfromfiveyardsoutfollowingSmith’slongrunforthe first score of the contest and a 7-0 Michigan lead.
The Wolverine defense set up Michigan’s secondtouchdownwhenDemensforcedtheSDSUrunningbacktofumblethefootball,whichwasrecoveredbygordon.Robinsonrewardedthedefense’seffortwithhissecondtouchdownrunthreeplayslater.Robinsonsprinted down the right hash marks a season-long 53 yardsuntouchedonanoptionplaytoextendU-M’slead to 14-0 with 6:22 left in the opening frame.
Both offenses stalled on their next few drives withholding penalties negating significant gains that would have entered opposing territory. The MaizeandBlueregaineditsoffensiverhythmlateinthesec-ondquarterwitha12-play,81-yarddrivethatresult-edinRobinson’sthirdrushingtouchdown.Robinsonconverteda fourth-and-twofromU-M’s48-yard lineand later scampered 34 yards down to the SDSU11-yardline.Hefinishedthedriveonanakedboot-leg to the left, where he sidestepped two Aztec defendersforaone-yardrushingtouchdowntogiveMichigan a 21-0 lead heading into the halftime break.
The secondhalf beganwith sloppy play frombothoffenses, resulting in three turnovers in the first sixminutes.Themost pivotal turnoverwas committedby San Diego State when the Aztec running backbrokeoffalargegainonatosssweep,butfifth-yearseniordefensive tackleRyanvanBergen (Whitehall,Mich./Whitehall)forcedafumbleonhis100thcareertackle, and Ryan jumped on it inside theMichiganfive-yard line to prevent a SDSU scoring chance.However, the Aztecs took advantage of Michigan’sthird turnover of the third quarter with a 16-yardtouchdownpasswithfoursecondsremaininginthethirdstanzatocuttheWolverineleadto21-7.
The Aztecs had an opportunity to cut their deficittoonescore,buttheSDSUquarterbackwasunableto connect with his tight end on fourth-and-twofromtheU-M43-yardline.Michiganrespondedfourplays later with a seven-yard rushing touchdownby Smith,who seemed to have been stuffed a fewyardsbeyondthelineofscrimmagebeforeplowingthroughafewdefendersandreachingoverthegoalline for a 28-7 advantage with 6:29 left in the game.
San Diego State transitioned into a fast-paced, no-huddleoffenseandmarchedinsidetheU-Mredzonelate in the final frame, threatening to score. However, Roh sacked the quarterback and knocked the ballloosejustbeforetheSDSUsignalcallerwasabouttoattempt his pass, allowing Ryan to post his secondfumble recovery of the game and seal the win forMichigan.
GAME 4: San Diego State at MichiganMichigan StadiumSeptember 24, 2011110,707
1st ...2nd ... 3rd .... 4th ...FINALSanDiegoState.... 0 ........0 .........7 ........ 0 .............. 7Michigan ................ 14 .......7 .........0 ........ 7 ............28
ANN ARBOR, Mich. -- Junior quarter-back Denard Robinson (Deerfield Beach,Fla./Deerfield Beach) and the University ofMichigan football team (No. 22 AP/No. 21 USA Today Coaches) rushed out to a faststartagainstSanDiegoStateina28-7victorySaturday(Sept.24)atMichiganStadium.
Robinson did most of his damage with his legs, rackingup200rushingyardson21car-riesandtyinghiscareerhighwiththreerush-ingtouchdowns,withthetrioofscorescom-ing in the first half. It was the third time in his career that Robinsonhas recorded 200 rush-ing yards or more and the seventh time hehas produced multiple rushing touchdownsinagame.Robinsonadded93passingyards,completing 8-of-17 passes.
The win gives the Wolverines (4-0) a sweep of thenon-conferenceportionoftheirscheduleforthethirdstraightseasonandextendstheirSeptember winning streak to 13 games.
Junior runningbackvincent Smith (Pahokee,Fla./Pahokee)postedninecarriesfor47yardsand a seven-yard touchdown run and wasRobinson’s favorite receiving target with ateam-best three catches for 44 yards. Junior/sophomore tailback Fitzgerald Toussaint(Youngstown, Ohio/liberty) contributed toMichigan’s team total of 320 rushing yardswith13rushesfor67yards.
TheMichigandefensewasrelentlessthrough-out the afternoon, shutting out SDSU in thefirst half and preserving theWolverines’ leaddespitebeing indangerous, short-fieldsitua-tionsinthesecondhalf.JuniordefensiveendCraig Roh (Scottsdale, Ariz./Chaparral) made histwotacklescountastheybothwentforaloss, includinghis thirdcareer sackand thirdcareer forced fumble. Senior/junior lineback-er Kenny Demens (Oak Park, Mich./DetroitCountry Day) had a team-high seven tacklesandforcedafumbleinthefirstquarter.Junior/sophomore safety Thomas gordon (Detroit,Mich./CassTechnical)alsocontributedateam-high seven tackles and recovered a fumble--hissecondfumblerecoveryandthirdtake-awayinthelasttwogames.Sophomore/fresh-manlinebackerJakeRyan(Westlake,Ohio/St.ignatius)registeredfivetackles,includingoneforaloss,andhadthefirsttwofumblerecov-eries of his career.
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 29
G A M E R E C A P S - V S . M I N N E S O T A
SCORING SUMMARYFirst QuarterMiCH:Smith3ydrun(gibbonskick)MiCH:Robinson,D.9ydrun(gibbonskick)Second QuarterMiCH:Dileo17ydpassfromSmith(gibbonskick)MiCH:Smith28ydpassfromRobinson,D.(gibbonskick)MiCH:gibbons25ydfieldgoalMiCH:Koger18ydpassfromRobinson,D.(gibbonskick)Third QuarterMiCH:ToussaintFitzgerald1ydrun(gibbons,Brendan kick)MiCH:gibbons,Brendan32ydfieldgoalFourth QuarterMiCH:gibbons,Brendan38ydfieldgoalMiCH:Avery83ydfumblerecovery(gibbonskick)
TEAM STATISTICSCategory MN U-M FiRSTDOWNS 8 32RUSHES-YARDS(NET) 25-73 48-363PASSiNgYDS(NET) 104 217Passes Att-Comp-Int 22-11-0 25-18-0 TOTAL OFFENSE 47-177 73-580 FumbleReturns-Yards 0-0 1-83PuntReturns-Yards 1-0 1-0KickoffReturns-Yards 7-159 0-0interceptions-Yards 0-0 0-0Punts(Number-Avg) 10-36.3 2-37.5Fumbles-lost 2-2 1-0Penalties-Yards 9-74 3-24Possession Time 23:38 36:22 Third-DownConv. 0of11 6of11Fourth-DownConv. 0of0 0of0Red-Zone 0-1 8-9 SacksBy:Number-Yards 1-8 3-16
INDIVIDUAL STATISTICSRUSHING: Minnesota-Cobb,David8-54;Ben-nett,Duane9-33;Kirkwood3-3;Wright,Devon1-minus1;Shortell,Max4-minus16.Michigan-ToussaintFitzgerald11-108;Rawls,Thomas10-73;Shaw,Michael8-60;Robinson,Denard6-51;gard-ner,Devin6-39;Smith,vincent5-27;Hopkins,Stephen1-6;TEAM1-minus1.PASSING: Minnesota-Shortell,Max11-22-0-104.Michigan-Robinson,Denard15-19-0-169;gard-ner,Devin2-5-0-31;Smith,vincent1-1-0-17.RECEIVING: Minnesota-McKnight3-31;green2-41;Crawford-Tufts2-15;Mcgarry2-9;lair1-5;Goodger 1-3. Michigan-Hemingway5-56;gallon4-46;Koger3-35;Dileo2-23;Hopkins1-28;Smith1-28;gardner1-2;Toussaint1-minus1.
Mich./Whitehall), sophomore/freshman linebacker Jake Ryan (Westlake, Ohio/St. ignatius) and sopho-more defensive end Jibreel Black (Cincinnati, Ohio/Wyoming).
inthesecondhalf,Michiganwentthree-and-outonits first possession, but the Wolverines scored thenextthreetimestheyhadtheball,onatouchdownand two field goals, to lead 48-0 with 6:21 remaining inthethirdquarter.Junior/sophomorerunningbackFitzgerald Toussaint (Youngstown, Ohio/liberty),whofinishedwith108yardson11carriesforhisfirstcareer 100-yard game, capped a five-play, 54-yarddrivewithaone-yardleapupthemiddletomakeit45-0, and Gibbons tacked on field goals of 32 and a career-long38yardstomakeit51-0with9:17leftinthe game. Gibbons finished with career highs of 16 points, three field goals made and seven PATs.
The Golden Gophers were in position to spoil the shutoutaftertakingoveratmidfieldandmovingtothe Michigan 20-yard line with a long run, but onthe next play freshman linebacker Brennen Beyer(Canton, Mich./Plymouth) forced a fumble thatsophomore cornerback Courtney Avery (Mansfield,Ohio/lexington) scooped up and took 83 yardsdown the left sideline to close the scoring at the 4:58mark.AverymatchedleonHall (Oct. 29, 2005,at Northwestern) for the longest fumble return inschoolhistory.
Freshman defensive back Blake Countess (OwingsMills,Md./OurladyofgoodCounsel)hadfivetack-les, twopassbreakupsanda forced fumble to leadthedefense,whichposteditsfirstshutoutinBigTenplay in almost 10 years (Oct. 6, 2001, 20-0 at PennState).Senior/junior linebackerKennyDemens (OakPark,Mich./DetroitCountryDay)andjuniordefensiveend Craig Roh (Scottsdale, Ariz./Chaparral) also con-tributedfivetacklesapiece.
Robinson did most of his damage in the first half, completing his first 11 passes on the way to 169yardson15-of-19passingandtwotouchdowns.Herushed six times for 51 yards andanother score, allin the first half.
Freshman runningbackThomasRawls (Flint,Mich./FlintNorthern) ran for a career-best73yardson10carries in the second half and senior running backMichael Shaw (Trotwood, Ohio/Trotwood-Madison) rushedeighttimesfor60yardsasMichiganfinishedwith 363 yards rushing and 217 passing for seasonbestsof580totalyardsand32firstdowns.
GAME 5: Minnesota at MichiganMichigan StadiumOctober 1, 2011111,106
1st ...2nd ... 3rd .... 4th ...FINALMinnesota................ 0 ........0 .........0 ........ 0 .............. 0Michigan ................ 14 ..... 24 ...... 10 ...... 10 ...........58
ANN ARBOR, Mich. -- Junior running backVincent Smith (Pahokee, Fla./Pahokee) had touchdowns rushing, passing and receivinginhisteam’sfirstfourdrivesastheUniversityof Michigan football team (No. 19 AP/No. 19 USA Today Coaches) rolled past Minnesota,58-0, on Saturday (Oct. 1) before aMichiganStadiumcrowdof111,106.
TheWolverines (5-0,1-0BigTen)werenearlyflawlessindominatingthefirsthalf,pilingup384 yards of total offense and scoring on allsixoftheirdrivestobuildaninsurmountable31-0 halftime edge. Michigan, which rushedformorethan300yardsforthethirdstraightgame, improved to 5-0 for the second yearin a row and won its Big Ten opener for the sixth consecutive year.With the largestmar-ginofvictoryintheseries,theWolverinesrantheirwinningstreakagainstMinnesotatofourgamestoretainthelittleBrownJug.
Smith was the triple-threat star of the first half, accountingfortouchdownsthreeways.Smithscored on a three-yard run on Michigan’sfirst possession, threw a 17-yard touchdownpass tosophomorewide receiverDrewDileo(Greenwell Springs, La./Parkview Baptist) on ahalfbackoptiontostartthesecondquarter,and took a screen pass from junior quar-terback Denard Robinson (Deerfield Beach,Fla./Deerfield Beach) and went 28 yards foranother score on the following possession to make it 28-0 with 9:38 remaining in the half.
Using a diverse offense that at times fea-turedsophomorequarterbackDevingardner(Detroit, Mich./inkster) under center andRobinson in a three-back set, Michigan scored onallsixofitspossessionsintheopeninghalf,going80,75,85and69yardsfortouchdownson its first fourdrives.TheWolverines addeda 25-yard field goal from junior/sophomoreplacekicker Brendan Gibbons (West Palm Beach, Fla./Cardinal Newman) and a 56-yardtouchdowndrivetoclosethehalf.
While the offense was accumulating 21 firstdowns in the first half, the Michigan defense held the Gophers to zero first downs in the opening quarter and just four for the half.The Wolverines put pressure on Minnesotafreshman quarterback Max Shortell, a first-time starter, and got to him three times for drive-thwarting sacks from fifth-year seniordefensive end Ryan van Bergen (Whitehall,
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 30
G A M E R E C A P S - A T N O R T H w E S T E R N
SCORING SUMMARYFirst QuarterMiCH:Watson9ydpassfromRobinson(gibbonskick)NW:Colter15ydrun(Budzienkick)NW:green7ydrun(Budzienkick)Second QuarterMiCH:gallon25ydpassfromRobinson(gibbonskick)NW:Smith2ydrun(Budzienkick)NW:Budzien20ydfieldgoalThird QuarterMiCH:Robinson2ydrun(gibbonskick)MiCH:gardner1ydrun(gibbonskick)Fourth QuarterMiCH:Shaw2ydrun(gibbonskick)MiCH:Robinson5ydrun(gibbonskick)
TEAM STATISTICSCategory U-M Nw FiRSTDOWNS 23 26RUSHES-YARDS(NET) 50-179 25-107PASSiNgYDS(NET) 362 331Passes Att-Comp-Int 28-19-3 45-32-1 TOTAL OFFENSE 78-541 70-438 FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 0-0 1-20KickoffReturns-Yards 3-56 3-48interceptions-Yards 1-0 3-67Punts(Number-Avg) 1-38.0 3-46.7Fumbles-lost 0-0 1-1Penalties-Yards 5-65 5-51Possession Time 37:57 22:03 Third-DownConv. 14of17 4of11Fourth-DownConv. 1of1 0of2Red-Zone 5-6 4-5 SacksBy:Number-Yards 4-26 0-0
INDIVIDUAL STATISTICSRUSHING: Michigan-Robinson 25-117; Shaw 6-25;Toussaint14-25;Smith3-8;gardner2-4.Northwestern-Schmidt 5-31; Smith, A. 6-28; Col-ter2-28;Mark2-18;green1-7;Persa9-minus5.
PASSING: Michigan-Robinson 17-26-3-337; Gardner 2-2-0-25. Northwestern-Persa 32-44-1-331; TEAM 0-1-0-0.
RECEIVING: Michigan-Hemingway5-124;gallon5-73;Roundtree3-83;Koger2-36;Jackson1-19;Shaw 1-12; Watson 1-9; Smith 1-6. Northwest-ern-Ebert11-86;Dunsmore7-73;Schmidt5-51;Jones, C. 3-68; Colter 3-37; Smith, A. 1-8; Mark 1-4; Green1-4.
Fueledbya57-yardgrabbyjuniorwidereceiverRoyRoundtree (Trotwood, Ohio/Trotwood-Madison) onthe first drive of the second half, U-M took the ball 80 yards,cappingoffthedrivewithatwo-yardRobinsonrun. The touchdown marked the fifth consecutivegame inwhichRobinsonhasaccounted forat leastthreescores.Onepossessionlater,sophomorequar-terbackDevingardner(Detroit,Mich./inkster)scoredonaone-yardbootleg run togive theWolverinesa28-24leadwith2:58leftinthethirdquarter.
More Michigan scoring came in the final quarter.Sparked by an interception by Hawthorne, seniorMichael Shaw (Trotwood, Ohio/Trotwood-Madison) scored on a two-yard run -- the 13th of his career--toextendtheWolverineleadto11.OntheensuingNorthwestern possession, junior linebacker KennyDemens(OakPark,Mich./DetroitCountryDay)forceda fumble for the second Wildcats turnover of thegame,markingthesixthstraightcontestwithtwoormoreforcedturnoversforU-M.
A blocked field goal by NUwith 9:13 left gave theWildcats the ball back, but the Michigan defenseended the drive with a Kovacs fourth-down sackshortly after. Robinson then added a score on thegroundlateinthegame.
TheMichiganoffenserackedup529yardsenroutetoscoringthegame’sfinal28points.Robinsonfinishedthegamecompleting17-of-26passes for337yardsandtwotouchdowns.Healsoadded117yardsandtwo scores on the ground. His performance placedthird on theMichigan all-time list for total yards ina game. Hemingway hauled in five passes for 124yards,whilegallongrabbedfivepassesfor61yardsand one score.
The Michigan defense held Northwestern scoreless in thefinaltwoquarters,allowingonly130totalyards.
GAME 6: Michigan at NorthwesternRyan FieldOctober 8, 201147,330
1st ...2nd ... 3rd .... 4th ...FINALMichigan ................. 7 ........7 ....... 14 ...... 14 ...........42Northwestern ....... 14 ..... 10 ........0 ........ 0 ............24
EVANSTON, Ill. --TheUniversityofMichiganfootball team (No. 12 AP/No. 11 USA TodayCoaches)outscoredNorthwestern28-0inthesecondhalfonthewaytoa42-24victoryonSaturday(Oct.8)atRyanField.U-MprevailedinitsfirstroadtesttoremainunbeatenontheseasonandintheBigTenlegendsDivision.
Despiteputtingupthefirstpointsofthegame,the Wolverines, who ranked first in the Big Ten inturnovermargin(+7)headingintothecon-test, committed three turnovers in theopen-inghalf.JuniorquarterbackDenardRobinson(Deerfield Beach, Fla./Deerfield Beach) threwthree interceptions in the first half -- which the Wildcats turned into 10 points -- whilethe Northwestern offense surrendered zerogiveaways.
looking to extend its three-game winningstreakatRyanField,Michiganforcedathree-and-out on the game’s first series and thentook the ball down the field to score on a nine-yard pass from Robinson to fifth-yearsenior tight end Steve Watson (Cherry Hillsvillage, Colo./Mullen) -- the first reception ofhis career. Northwestern then answered with twotouchdownstotakea14-7 leadheadingintothesecondquarter.
With 8:24 left in the half and still down seven points, Michigan senior/junior safety JordanKovacs (Curtice, Ohio/Clay) made a tackle inthe backfield to stop theWildcats on fourthdown in Wolverine territory. The Maize andBlue proceeded to convert a short fourthdown of its own on its way to scoring on a25-yard touchdown pass from Robinson tosophomorewideout Jeremygallon (Apopka,Fla./Apopka). Northwestern added 10 points in the final 2:21 of the half to hold a 24-14 lead after30minutes.
Robinson completed 10-of-18 passes in the first half for 188 yards and two scores.Senior receiver Junior Hemingway (Conway,S.C./Conway) caught fourballs for 106 yards,includinga48-yardreceptionontheopeningdrive.
After allowing only three points in the threeprevious firsthalvescombined, theMichigandefense allowed 24 through the first twoquarters.KovacsandjuniorlinebackerBrandinHawthorne (Pahokee, Fla./Pahokee) led the team with five tackles apiece.
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 31
G A M E R E C A P S - A T M I C H I G A N S T A T E
SCORING SUMMARYFirst QuarterMiCH:Robinson,Denard15ydrun(gibbons,Brendan kick)MSU:Baker,Edwin1ydrun(Conroy,Dankick)Second QuarternoneThird QuarterMSU:Martin,Keshawn10ydpassfromCousins,Kirk(Conroy,Dankick)MSU:Martin,Keshawn13ydpassfromCousins,Kirk(Conroy,Dankick)Fourth QuarterMiCH:Roundtree,Roy34ydpassfromRobinson,Denard(gibbons,Brendankick)MSU:lewis,isaiah39ydinterceptionreturn(Conroy,Dankick)
TEAM STATISTICSCategory U-M MSU FiRSTDOWNS 20 16RUSHES-YARDS(NET) 36-82 39-213PASSiNgYDS(NET) 168 120Passes Att-Comp-Int 31-12-1 24-13-0 TOTAL OFFENSE 67-250 63-333 FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 2-22 1-13KickoffReturns-Yards 2-32 3-47interceptions-Yards 0-0 1-39Punts(Number-Avg) 5-40 13-124Fumbles-lost 2-0 2-2Penalties-Yards 5-40 13-124Possession Time 29:27 30:33 Third-DownConv. 3of15 7of14Fourth-DownConv. 2of4 0of0Red-Zone 1-2 3-3 SacksBy:Number-Yards 0-0 7-62
INDIVIDUAL STATISTICSRUSHING: Michigan-Robinson18-42; Smith 8-37;gallon1-8;Toussaint2-7;Dileo1-3;gard-ner6-minus15.MichiganState-Baker26-167;Bell7-20;Martin3-20;Fowler1-6;Cousins2-0.PASSING: Michigan-Robinson 9-24-1-123; gardner,3-7-0-45.MichiganState-Cousins,13-24-0-120. RECEIVING: Michigan-Roundtree4-66;Heming-way3-43;gallon3-43;Koger2-16.MichiganState-Cunningham,4-39;Martin3-31;linthicum2-22; Nichol 2-20; Bell 1-5; Caper 1-3.
Freshman defensive back Blake Countess (OwingsMills, Md./Our lady of good Counsel) led theWolverines in tackles with five in the opening 30 min-utes, while senior/junior linebacker Kenny Demens(Oak Park, Mich./Detroit Country Day) and senior/juniorsafetyJordanKovacs(Curtice,Ohio/Clay)eachtallied three. Robinson led the Wolverines rushingattackwith42yardsandadded39intheair.
The second half showed an array of big plays andscoring.MichiganStateaddedthreetouchdownstoitsfirst-halflead,whiletheWolverinescouldonlyrallyfor one more score in the second half.
On their first drive of the second half, the Spartans tooktheball54yardsandscoredona10-yardpasstoseniorreceiverKeshawnMartintogoup,14-7.lateinthethirdquarter,MSUscoredonanothertouchdownreceptionbyMartintotakea21-7lead.
Heading into the fourth quarter down, theWolverines’offenseralliedtoscoreona34-yardpassfrom Robinson to junior wideout Roy Roundtree(Trotwood,Ohio/Trotwood-Madison)tocutthedefi-cittosevenpoints.ThescorewasRoundtree’s12thofhis career and second of the season.
Michigan State started its next possessionwith theball on its own21 yard-line, only to fumble for thesecondtimeofthegame.JuniorJ.T.Floyd(greenville,S.C./J.l. Mann) caused the fumble. Michigan tookoverinMSUterritorybutwaseventuallystoppedonfourth-and-onetoturntheballoverondowns.
With 4:31 left in the game, Robinson threw his first interception of the game, which the Spartans returned for a touchdown to extend their lead to28-14.
Robinson,wholeftthegamewithaninjurylateinthefourthquarter,threwfor123yardsandascoretogowithhis 42 yards anda touchdownon theground,while sophomore quarterback Devin gardner(Detroit,Mich./inkster) added 45 yards through theair. Roundtree reeled ina team-best fourpasses for66yardsandascore.
Sophomore safety Thomas gordon (Detroit, Mich./Cass Technical) led the defense with seven tackles, whileKovacsandjuniorCraigRoh(Scottsdale,Ariz./Chaparral)eachaddedsix.
GAME 7: Michigan at Michigan StateSpartan StadiumOctober 15, 201177,515
1st ...2nd ... 3rd .... 4th ...FINALMichigan .................. 7 ........0 .........0 ........ 7 ............14Michigan State ..... 7 ........0 ....... 14 ....... 7 ............28
EAST LANSING, Mich. -- A late Spartan inter-ceptionforascorethwartedtheUniversityofMichigan football team’s (No. 11 AP/No. 10USATodayCoaches)fourth-quartercomebackin a 28-14 loss at Michigan State (No. 23 AP/No.19USATodayCoaches)onSaturday(Oct.15) at Spartan Stadium, which saw gusts ofwind 40-50 miles per hour throughout thegame.
TheseriestrendcontinuedasMSUoutrushedtheWolverines, 213-82, in U-M’s first loss ofthe season. The winner of 39 of the past 42 matchupsbetweenthesetwoteamshaswontherushingbattleaswell.MSUpressuredtheU-M quarterbacks throughout the afternoonastheMaizeandBluesurrenderedsevensacksandpuntedtheballseventimes.
Michigan came out of the tunnel prior tothe game sporting unexpectedwhite legacyjerseys, a road version of the uniformswornagainst Notre Dame on Sept. 10. The whitepants honored the uniforms worn by the1974-75 Wolverine teams.
Thetwoteamsmatchedupevenlyinthefirsthalf,asthescoreshowed7-7andtherushingyards 95 for Michigan and 100 for MichiganState.
U-Mstruckfirst,driving80yardsontheopen-ing possession of the game. The drive was fueledbya26-yardrunbyjuniorrunningbackVincent Smith (Pahokee, Fla./Pahokee) and a fakefieldgoalrunforafirstdowninSpartanterritory.JuniorquarterbackDenardRobinson(DeerfieldBeach,Fla./DeerfieldBeach),onthe10th play of the drive, scrambled left on abrokenplayandknockedoverthepylonfora15-yard rushing touchdown to putMichiganup,7-0.
On the ensuing drive, the Spartans took theball63yardsonnineplays, culminatingwithaone-yardtouchdownrunby juniorrunningback Edwin Baker.
The rest of the first quarter and through-out the second, the two squads locked ina stalemate. Despite combining for 18 firstdowns,thereweresevenpuntsinthefirsthalf.SophomorepunterWillHagerup (Milwaukee,Wis./WhitefishBay)pinnedMSUinsideitsown20yard-linethreetimes.
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 32
own five-yard line, Martin bull-rushed the Purdueoffensive line and sacked the Purdue quarterbackin the end zone for a safety. Junior/sophomoreplacekicker Brendan Gibbons (West Palm Beach, Fla./CardinalNewman)addeda37-yard fieldgoal -- thesecondlongestofhiscareer--threeminuteslatertogive U-M a 12-7 lead.
Purduethreatenedtoscoreontheensuingdrive,fac-inga third-and-10 fromtheU-M16-yard line,whenabubblescreentippedoff thereceiver’shands intothe arms of a diving Avery.TheWolverines capital-ized anddrove the lengthof the field in fiveplays,covering83yards.Two16-yardrunsbyToussaintanda42-yardbombdowntherightsidelinetogallonsetupMichigan at the Purdue two-yard line.Toussaintpuncheditinonthenextplay,runningovertherighttackleforhisfifthrushingtouchdownoftheseasonfor a 19-7 Michigan advantage.
AfterasecondMartinsackforcedPurduetopunt,theWolverines extended their lead to 22-7 to end thefirsthalf.Robinsonopenedthedrivewitha28-yardrun into Purdue territory. Michigan worked its waydown to the three-yard line but could not convertanyof its threeshotsat theendzone,settling foragibbons’22-yardfieldgoal.
ToussaintandShaweachaddedquickstrikes inthesecond half to give Michigan a comfortable lead. With 2:48leftinthethirdquarter,ToussainttookapitchtotheleftsideandmadethreeimpressivecutbackstoeludePurduedefendersbeforesprinting59yardsforhissecondtouchdownoftheday.OnMichigan’snextpossession, Shawburst through the line andbrokefreedowntherightsidelinefora37-yardscore--histhird of the season -- to give Michigan a 36-7 lead with12:32leftinthefourthquarter.
Purdue had an opportunity to add another touch-downmidwaythroughthefourthquarterbutfailedto convert a fourth-and-goal from the U-M three-yardlinewhenMorganandsenior/juniorlinebackerKennyDemens(OakPark,Mich./DetroitCountryDay)stuffed the Boilermaker quarterback just shy of thegoal line.With15 seconds left in thegame,Purduescored a touchdown on a 19-yard pass for a finalscore of 36-14.
G A M E R E C A P S - V S . P U R D U E
SCORING SUMMARYFirst QuarterPUR:Bush48ydpassfromTerBush(Wiggskick)MiCH:Robinson,Denard2ydrun(gibbonskick)Second QuarterMiCH:Martin,Mike-safetyMiCH:gibbons37ydfieldgoalMiCH:Toussaint2ydrun(gibbonskick)MiCH:gibbons22ydfieldgoalThird QuarterMiCH:Toussaint59ydrun(gibbonskick)Fourth QuarterMiCH:Shaw37ydrun(gibbonskick)PUR:Ross19ydpassfromMarve(Wiggskick)
TEAM STATISTICSCategory PUR U-M FiRSTDOWNS 16 25RUSHES-YARDS(NET) 29-89 53-339PASSiNgYDS(NET) 222 196Passes Att-Comp-Int 27-17-1 17-10-2 TOTAL OFFENSE 56-311 70-535 FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 2-25 1-0KickoffReturns-Yards 4-98 3-81interceptions-Yards 2-0 1-0Punts(Number-Avg) 6-38.7 2-40.5Fumbles-lost 0-0 0-0Penalties-Yards 8-86 5-51Possession Time 23:35 36:25 Third-DownConv. 3of13 7of13Fourth-DownConv. 1of2 1of2Red-Zone 1-3 4-5 SacksBy:Number-Yards 1-8 4-20
INDIVIDUAL STATISTICSRUSHING: Purdue-TerBush3-38;Bolden11-22; Crank 4-18; Edison 2-11; Gravesande 1-4; Shavers1-3;Siller2-minus1;Marve5-minus6.Michigan-Toussaint20-170;Robinson,D.15-63;Shaw 5-56; Smith, V. 6-28; Gallon 1-11; Gardner 3-9;Rawls1-2;Hopkins1-1;TEAM1-minus1.
PASSING: Purdue-Marve8-14-1-66;TerBush9-13-0-156.Michigan-Robinson,D.9-14-1-170;Gardner 1-2-1-26; Smith, V. 0-1-0-0.
RECEIVING: Purdue-Siller5-58;Holmes3-44;Ross3-38;Edison2-11;Bush1-48;Wright1-15;Bolden 1-4; Gravesande 1-4. Michigan-Gallon 3-79;Roundtree2-61;Hemingway2-16;Smith,v.1-26; Moore 1-9; Jackson 1-5.
GAME 8: Purdue at MichiganMichigan StadiumOctober 29, 2011112,115
1st ...2nd ... 3rd .... 4th ...FINALPurdue ..................... 7 ........0 .........0 ........ 7 ............14Michigan ................. 7 ...... 15 ........7 ........ 7 ............52
ANN ARBOR, Mich.--Junior/sophomorerun-ning back Fitzgerald Toussaint (Youngstown,Ohio/liberty) and theUniversityofMichiganfootball team (No. 17 AP/No. 17 Coaches) entertained the Homecoming crowd with a 36-14 rout over the Purdue Boilermakerson Saturday afternoon (Oct. 29) at MichiganStadium.Toussaintsetcareerhighsforcarries(20)andrushingyards(170)andmatchedhiscareer high with two touchdown runs. it isthe second time inToussaint’s career he haseclipsedthe100-yardthreshold.
The Wolverines outgained the Boilermakers535-311 and possessed the ball for 36:25. Junior quarterback Denard Robinson(Deerfield Beach, Fla./Deerfield Beach) andseniorrunningbackMichaelShaw(Trotwood,Ohio/Trotwood-Madison)eachaddedrushingtouchdownswhilerunningfor63and56yards,respectively.Robinsonalsocompleted9-of-14throwsfor170yards,whilejunior/sophomorewidereceiverJeremygallonhauledinateam-highthreecatchesforacareer-high79yards.
The Michigan defense posted seven TFLs and four sacks andwas ledby seniornose tackleMike Martin (Redford, Mich./Catholic Central), who contributed a season-high two sacks tofinishwithseventackles.Martin’sfirstsackwasin the end zone, resulting in Michigan’s firstsafetysince2003againstHouston.FreshmanlinebackerDesmondMorgan(Holland,Mich./West Ottawa) led the Wolverines with nine stops in his second career start, and sopho-more cornerback Courtney Avery (Mansfield,Ohio/lexington) registered his first careerinterception and first career sack (half-sack).
After Purdue jumped out to a quick leada 48-yard touchdown on a bubble screenjust 1:24 into the game, Michigan evenedit up at seven apiece with a 12-play drive.Thebigplaywasa23-yardthrowbackscreenfromRobinson togallon thatputU-M in thered zone. Four differentWolverines earned acarry,totaling46rushingyards,andRobinsoncappedthetouchdowndrivewithatwo-yardquarterback draw -- his 10th rushing touch-down of the season.
Both defenses tightened up after allowingtheearlytouchdownsasMichiganforcedtwothree-and-outs and Purdue intercepted twopasses. Then, with 14:13 left in the second quarter and theBoilermakers sittingon their
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 33
G A M E R E C A P S - A T I O w A
SCORING SUMMARYFirst QuarteriOWA:Coker4ydrun(Meyerkick)MiCH:Toussaint5ydpassfromRobinson,D.(Dileorushfailed)Second QuarteriOWA:Herman1ydpassfromvandenberg(Meyerkick)iOWA:Meyer42ydfieldgoalThird QuarterMiCH:gibbons32ydfieldgoalFourth QuarteriOWA:Coker13ydrun(Meyerkick)MiCH:Koger7ydpassfromRobinson,D.(gibbonskick)
TEAM STATISTICSCategory U-M IOwA FiRSTDOWNS 22 15RUSHES-YARDS(NET) 37-127 35-131PASSiNgYDS(NET) 196 171Passes Att-Comp-Int 38-18-1 21-14-0 TOTAL OFFENSE 75-323 56-302 FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 2-17 2-28KickoffReturns-Yards 5-90 3-56interceptions-Yards 0-0 1-5Punts(Number-Avg) 5-39.4 5-40.0Fumbles-lost 2-1 0-0Penalties-Yards 3-20 5-29Possession Time 30:06 29:54 Third-DownConv. 7of16 4of12Fourth-DownConv. 1of2 1of2Red-Zone 3-5 3-3 SacksBy:Number-Yards 2-10 2-28
INDIVIDUAL STATISTICSRUSHING:Michigan-Toussaint16-58;Robinson,D.12-55;Smith4-14;gardner5-0.iowa-Coker29-132;McNutt1-7;vandenberg4-minus4;TEAM1-minus4.PASSING: Michigan-Robinson,D.17-37-1-194;Gardner 1-1-0-2. Iowa-Vandenberg 14-21-0-171. RECEIVING: Michigan-Hemingway5-64;Koger3-18;Roundtree2-37;grady2-22;Smith2-12;gallon1-13;Odoms1-13;Dileo1-12;Toussaint1-5.iowa-McNutt9-101;Davis2-52;Fiedorowicz1-9;Martin-Manley1-8;Herman1-1.
inthesecondhalf,U-Mstartedoffstrongasfifth-yearsenior Will Heininger (Ann Arbor, Mich./Pioneer) and junior Craig Roh (Scottsdale, Ariz./Chaparral) eachgarnered sacks on iowa’s opening drive to force apunt. TheWolverines responded by taking the balldownthefieldandconvertingona32-yardfieldgoalby junior/sophomore Brendan gibbons (West PalmBeach, Fla./Cardinal Newman) to bring Michigan within eight points.
With 10:47 left in the game, Coker added a sec-ond touchdown on an 11-yard run to expand theHawkeye lead to 24-9.TheWolverines quickly tooktheball 57 yards in2:59, culminatingwitha seven-yardtouchdownreceptionbyseniortightendKevinKoger(Toledo,Ohio/Whitmer),cuttingtheiowaleadback to eight.
Starting from its own 18 yard-line with 2:15 to go,theMichiganoffensedrovedownthe fieldbutwasstoppedatthethree-yardlineafterfourshotsattheend zone.
Robinson threw for 194 yards on 17-of-37 passingwithtwoscoresandadded55yardsontheground.Fifth-year senior Junior Hemingway (Conway, S.C./Conway)ledthereceivingcorewith64yardsonfivereceptions.On thedefensive side, junior linebackerKennyDemens(OakPark,Mich./DetroitCountryDay)tallied a team-high 11 tackles.
GAME 9: Michigan at IowaKinnick StadiumNovember 5, 201170,585
1st ...2nd ... 3rd .... 4th ...FINALMichigan .................. 6 ........0 .........3 ........ 7 ............16Iowa .......................... 7 ...... 10 ........0 ........ 7 ............24
IOwA CITY, Iowa -- After driving 79 yardsin the final two minutes, the University ofMichigan football team (No. 13 AP/No. 13 USA Today)cameupthreeyardsshortinitscome-backatiowaandfell,24-16,onSaturday(Nov.5)atKinnickStadium.U-Mhadfourtriesatthegoallinefromthreeyardsout,butfourpasseswent incomplete.
TheMichigandefenseheldstoutinthesecondhalf,onlyallowingsevenpoints,butthe17-6halftime deficit was too much to overcomefortheoffense,despiteout-gainingiowa323yardsto302yardsforthegame.
The teamswere almost identical throughoutthe first half with nine first downs apiece and iowaowningonlyaneight-secondadvantagein time of possession, but the story of thefirst half for the Wolverines was turnovers.Michigan turned the ball over twice -- onefumble and one interception -- while theHawkeyessurrenderedzero.
After a Michigan three-and-out to start thegame, the first opening drive in which the Wolverines did not score a touchdown sinceSept. 17 against Eastern Michigan, Iowa drove downthefieldandscoredonaMarcusCokerfour-yardrushtogivetheHawkeyesa7-0lead.
With 2:14 left in the first quarter, Michigancappeda12-play,61-yarddrivewithatouch-down for its first points of the game. Juniorquarterback Denard Robinson (DeerfieldBeach, Fla./Deerfield Beach) scrambled inthe pocket before finding sophomore run-ning back Fitzgerald Toussaint (Youngstown,Ohio/liberty) in the corner of the end zone.However,afterabotchedhold,theextrapointwasunsuccessful, leavingtheMaizeandBluetrailing, 7-6.
Thecontestremainedaone-pointmarginuntiliowaquarterbackJamesvandenbergaddedatouchdown pass to extend the lead to 14-6.Threeminuteslater,followingaMichiganfum-ble,theHawkeyesaddeda42-yardfieldgoal.
On the subsequentU-Mdrive, Robinsonwasintercepted in the end zone on a tipped pass with 1:04 left in the secondquarter, sendingthe Wolverines into the locker room down, 17-6.
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 34
a20-yardpass tobring theWolverines into the redzone.Thedriveculminatedwitha27-yardfieldgoalbyjunior/sophomorekickerBrendangibbons(WestPalm Beach, Fla./Cardinal Newman) to give Michigan a 17-0 lead.
illinoisbrokeintoMichiganterritoryforthefirsttimeall game late in the third quarter and scored on a13-yard run by quarterback Nathan Scheelhaase toendtheU-Mhopesforasecondconferenceshutoutof the season.
With 11 minutes to go in the game and illinoismarching inside Michigan territory for the secondstraightdrive,senior/juniordefenseivebackJ.T.Floyd(greenville,S.C./J.l.Mann)interceptedScheelhaase’sthird-downpassforhisthirdcareerpickandreturnedit42yardstotheillini22-yardline.Threeplayslater,gardnerfoundOdomsona27-yardpostpatternforaMichigan touchdown,extending the leadback to17 points.
Despite a 16-yard sack by fifth-year senior RyanVan Bergen (Whitehall, Mich./Whitehall) and senior Mike Martin (Redford, Mich./Catholic Central) on third down to take illinois out of field-goal range,ScheelhaasefoundA.J.Jenkinsfora32-yardcomple-tiononthenextplaytokeepthe illinoisdrivealive,leadingtoaone-yardrushingTDtocuttheMichiganlead to 24-14 with 3:12 to go in the game.
On the following onside kick, senior/junior receiverRoyRoundtree(Trotwood,Ohio/Trotwood-Madison)recoveredtheball,andtwoplayslaterToussainttookthehandoff anddashed27 yards for a touchdown,giving U-M a 17-point lead that stood as the final second ticked off the clock.
leadingtheoffensefortheWolverineswasToussaint,who rushed for 192 yards -- a career high -- on 27carrieswith one score. Odoms also brought in twocatches for 46 yards andhis first touchdownof theseason. On the defensive side, Martin led the waywith nine tackles. Van Bergen also added seven tack-les to go along with his two and a half sacks.
G A M E R E C A P S - A T I L L I N O I S
SCORING SUMMARYFirst QuarterMiCH:Robinson,D.9ydrun(gibbonskick)Second QuarterMiCH:Robinson,D.2ydrun(gibbonskick)Third QuarterMiCH:gibbons27ydfieldgoalill:Scheelhaase13ydrun(Dimkekick)Fourth QuarterMiCH:Odoms27ydpassfromgardner(gibbonskick)ill:Ford1ydrun(Dimkekick)MiCH:Toussaint27ydrun(gibbonskick)
TEAM STATISTICSCategory U-M ILL FiRSTDOWNS 14 15RUSHES-YARDS(NET) 48-223 33-37PASSiNgYDS(NET) 139 177Passes Att-Comp-Int 15-8-1 34-17-1 TOTAL OFFENSE 63-362 67-214 FumbleReturns-Yards 0-0 1-2PuntReturns-Yards 4-62 2-8KickoffReturns-Yards 0-0 1-14interceptions-Yards 1-43 1-0Punts(Number-Avg) 4-34.2 9-41.6Fumbles-lost 3-2 3-2Penalties-Yards 4-29 4-25Possession Time 32:45 27:15 Third-DownConv. 6of14 5of17Fourth-DownConv. 0of1 2of2Red-Zone 3-6 2-2 SacksBy:Number-Yards 4-49 1-8
INDIVIDUAL STATISTICSRUSHING:Michigan-Toussaint27-192;Robinson,D.12-30;gardner2-9;Shaw3-4;Smith,v.1-0;TEAM3-minus12.illinois-Ford11-26; Scheelhaase 16-14; Pollard 5-11; TEAM 1-minus14.
PASSING:Michigan-Robinson,D.6-10-1-92;Gardner 2-5-0-47. Illinois-Scheelhaase 16-31-1-170;O’Toole1-3-0-7.
RECEIVING:Michigan-Hemingway3-43;Odoms2-46;Koger2-42;gallon1-8.illinois-Jenkins8-103;Davis4-28;lankford1-18;Harris1-14;viliunas1-7;Pollard1-6;Young1-1.
GAME 10: Michigan at IllinoisMemorial StadiumNovember 12, 201160,670
1st ...2nd ... 3rd .... 4th ...FINALMichigan ................. 7 ........7 .........3 ....... 14 ...........31Illinois ....................... 0 ........0 .........7 ........ 7 ............14
CHAMPAIGN, Ill. -- Junior/sophomore run-ning back Fitzgerald Toussaint (Youngstown,Ohio/liberty) rushed for 192 yards and theWolverine defense posted four sacks andforced three turnovers, as the University ofMichigan football team (No. 22 AP/No. 21 USA Today Coaches) defeated illinois, 31-14, onSaturday(Nov.12)atMemorialStadium.U-Mled14-0athalfandneverledbyfewerthan10points the rest of the game.
Michigan dominated the first half of play,shuttingouttheFightingillini.Michiganout-gained the Illinois offense, 249-30, in total yards while putting up 10 first downs toillinois’ one. Against a defense that led theBigTen in rushingyards/game this seasonat103 heading into the contest, the Wolverines gained157onthegroundinthefirsthalf.
itonlytook1:45andfourplaysforU-Mtoputpoints on the scoreboard to start the game. After a 65-yard run by Toussaint, the lon-gestofhis career, juniorquarterbackDenardRobinson (Deerfield Beach, Fla./DeerfieldBeach)tooktheballinfromnineyardsouttogivetheWolverinesa7-0lead.itwasthesixthopening drive touchdown in the past sevengames for Michigan.
Earlyinthesecondquarter,RobinsonrantheballinagainfromtwoyardsouttoextendtheMichigan lead to 14. The score marked the ninthmulti-rushingtouchdowngameforthedual-threatquarterbackinhiscareer.
Only minutes later, the Wolverines offensemarched inside the five yard-line but wasstoppedonfourattemptsattheendzoneandturnedtheballoverondowns.Ontheensuingplay, theMichigandefense stripped the illiniballcarrierforitsfirstturnoverofthecontest.
With oneminute left in the half, a Robinsonpass went off the fingertips of senior wide receiver Martavious Odoms (Pahokee, Fla./Pahokee) in the end zone, leading to a missed U-Mfieldgoalanda14-0MaizeandBluehalf-time lead.
itwasnotuntilanillinimuffedpuntwith7:23left in the third quarter thatMichigan had ascoringopportunity.SophomorequarterbackDevin gardner (Detroit, Mich./inkster) cameintothegameandhitfifth-yearseniorreceiverJuniorHemingway(Conway,S.C./Conway)on
SCORING SUMMARY
G A M E R E C A P S - V S . N E B R A S K A
SCORING SUMMARYFirst QuarterMiCH:gallon,J.6ydpassfromRobinson,D.(gibbonskick)MiCH:gibbons,B.42ydfieldgoalNEB:Kinnie,B.54ydpassfromMartinez,T.(Maher,B.kick)Second QuarterNEB:Maher,Brett51ydfieldgoalMiCH:Robinson,D.14ydrun(gibbons,B.kick)Third QuarterMiCH:Robinson,D.1ydrun(gibbons,B.kick)MiCH:Toussaint,F.1ydrun(gibbons,B.kick)NEB:Abdullah,A.3ydrun(Maher,B.kick)Fourth QuarterMiCH:Odoms,M.38ydpassfromRobinson,D.(Gibbons, B. kick)MiCH:Toussaint,F.31ydrun(gibbons,B.kick)
TEAM STATISTICSCategory NEB U-M FiRSTDOWNS 11 24RUSHES-YARDS(NET) 31-138 61-238PASSiNgYDS(NET) 122 180Passes Att-Comp-Int 23-9-0 19-11-1 TOTAL OFFENSE 54-260 80-418 FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 1-11 5-33KickoffReturns-Yards 7-159 3-70interceptions-Yards 1-10 0-0Punts(Number-Avg) 6-46.0 4-36.8Fumbles-lost 4-3 0-0Penalties-Yards 8-73 5-45Possession Time 18:47 41:13 Third-DownConv. 3of13 8of18Fourth-DownConv. 0of2 1of1Red-Zone 1-2 5-5 SacksBy:Number-Yards 1-13 3-4
INDIVIDUAL STATISTICSRUSHING:Nebraska-Martinez,T.16-49;Burk-head,R.10-36;Marlowe,T.1-23;Abdullah,A.2-19;David,l.1-6;green,A.1-5.Michigan-Tous-saint,F.29-138;Robinson,D.23-83;Hopkins,S.2-15;Dileo,D.1-4;Odoms,M.1-1;Shaw,M.2-0;TEAM3-minus3.PASSING: Nebraska-Martinez, T. 9-23-0-122. Michigan-Robinson,D.11-18-1-180;gardner,D.0-1-0-0.RECEIVING: Nebraska-Marlowe,T.3-24;Enunwa,Q.3-21;Kinnie,B.1-54;Reed,K.1-15;Bell,K.1-8. Michigan-Gallon, J. 3-34; Odoms, M. 2-47; Hemingway,J.2-34;Toussaint,F.2-4;Roundtree,R.1-46;Dileo,D.1-15.
the rightsideline inside theNebraska five-yard line.Robinson capped the scoring drive two plays laterwitha six-yardpass toa crossinggallon in theendzone for a 7-0 lead.
Junior/sophomore placekicker Brendan gibbons(West Palm Beach, Fla./Cardinal Newman) drilled a career-long 42-yard field goal into thewind to addthreepoints toMichigan’s leadwith2:03 left in thefirstquarter.TheCornhuskersrecoveredquickly,put-ting 10 points on the scoreboard in a 4:05 span to tiethegamewitha54-yard,play-actiontouchdownpassanda51-yardfieldgoal.
Michigan retook the lead on the ensuing drive,marching 74 yards in 12 plays in 6:07. Robinsonconvertedtwothird-and-sixsituationswithaneight-yard completion to fifth-year seniorwideout JuniorHemingway(Conway,S.C./Conway)andaneight-yardrushtoextendthedrive.Facinghisthirdthirddownof the drive, Robinson ran to the left on a designed keeperandburst throughtheholeuntouchedfora14-yard touchdown, giving theWolverines a 17-10lead at halftime.
The Wolverines pulled away in the third quarter,capitalizing on Nebraska special-teams mistakes. On the kickoff to open the second half, senior/juniorwide receiver Terrence Robinson (Klein, Texas/Oak)drilledtheNebraska returner, forcinghis firstcareerfumblethatsophomorecornerbackCourtneyAvery(Mansfield, Ohio/lexington) -- who also notched aTFlandpassbreakup--jumpedonattheCornhusker33-yard line. After a 23-yard throwback screen togallonsetupMichigannearthegoalline,Robinsonscored his second rushing touchdown of the dayfrom one-yard out on a play-action rollout to therightpylon.
Nebraska was forced to punt on the next posses-sion,but thepunterdropped thesnap.By the timehe picked the football back up, sophomore/fresh-man safety Josh Furman (Annapolis, Md./Old MillSenior) blocked the punt -- Michigan’s first since2009. The Wolverines appeared to have stalled at the Nebraskafive-yardline,settingupashortfield-goalattempt, but sophomorewideout and holderDrewDileo (greenwell Springs, la./ParkviewBaptist) tookthe snap and scurried four yards for a first down.Toussaintbounced to theoutsideon thenextplay,scoringonaone-yardtouchdownrununtouchedtogive Michigan a 31-10 advantage with 5:03 remain-inginthethirdquarter.
After the Cornhuskers scored on a well-designed,three-yardoptionplay late in the thirdquarter, theWolverinesaddedtwomoretouchdowns.Robinsonthrewaperfect38-yardtouchdownstriketoOdomsinthebackoftheendzone,andToussaintaddedhissecondrushingscoreofthegameonatackle-break-ing, 31-yard run following Nebraska’s third fumblewith7:33leftinthefourthquarterforMichigan’sfinaltouchdown.
GAME 11: Nebraska at MichiganMichigan StadiumNovember 19, 2011113,718
1st ...2nd ... 3rd .... 4th ...FINALNebraska .................. 7 ........3 .........7 ........ 0 ............17Michigan ................ 10 .......7 ....... 14 ...... 14 ...........45
ANN ARBOR, Mich. -- The University ofMichigan football team (No. 20 AP/No. 18 USA Today Coaches) routed Nebraska (No.17AP/No. 16USATodayCoaches), 45-17, onSaturday(Nov.19)atMichiganStadiumfortheWolverines’ first win against a ranked oppo-nentthisseason.Michiganheavilyoutgained(418-260) and out-possessed (41:13-18:39)the Cornhuskers to improve to a perfect 7-0recordattheBigHousein2011.
Michigan rode the legs of junior/sopho-more running back Fitzgerald Toussaint(Youngstown, Ohio/liberty)and junior quar-terback Denard Robinson (Deerfield Beach,Fla./Deerfield Beach). Toussaint finishedwitha career-high 29 carries for 138 yards andtwo touchdowns, while Robinson earned 23carries for 83 yards and two rushing scores.Toussaint eclipsed 100 rushing yards for thefourth time this seasonand the second timeinasmanyweeks.
Through the air, Robinson completed 11-of-18 passes for 180 yards and two touch-downs.Robinson’spassing touchdownswereto junior/sophomore wide receiver JeremyGallon (Apopka, Fla./Apopka) and senior wideout Martavious Odoms (Pahokee, Fla./Pahokee). Gallon recorded a team-high three catches for 34 yards and Odoms tallied tworeceptionsforaseason-best47yards.
Nebraskaonlyreachedtheredzonetwiceandheld possession for only 18:39 as Michiganposted six tackles-for-loss, three sacks, threefumblerecoveriesandablockedpunt.Senior/junior safety Jordan Kovacs (Curtice, Ohio/Clay) led the team with seven tackles anda TFl, while senior/junior middle lineback-er Kenny Demens (Oak Park, Mich./DetroitCountryDay)registeredfivetackles,anassist-edsackandapassbreakup.Fifth-yearseniordefensive lineman Ryan van Bergen addedtwo TFLs -- bringing his total to seven in the pastfourgames--andasack.
After both defenses forced three-and-outsto open the first quarter, Robinson led theWolverines on an eight-play, 79-yard touch-down drive. Robinson sparked the drive on the first play, sprinting for 16 yards beforebeing tripped up. Then, facing a third-and-eight, Robinson lobbed a 46-yard pass tosenior/junior wide receiver Roy Roundtree(Trotwood, Ohio/Trotwood-Madison) down
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 35
allthewaybacktotheirthree-yardlineaftertwopenaltiesandvanBergen’stackle-for-loss.Rohrushedtherightedgeonthirddown, drawing anoffensiveholdingpenalty in the end zone,resultinginasafetyanda9-7U-Mlead.
The Michigan then tacked on seven more points. Starting nearmidfieldafter junior/sophomorewideoutJeremygallon’s(Apopka,Fla./Apopka)20-yardreturnontheshortOSUkickoff,theWolverinesconvertedafourth-and-oneonathree-yarddiveby sophomore fullback StephenHopkins (DoubleOak,Texas/Marcus).Fourplays later,Robinsonthreadeda26-yardpasstoHemingwayinthemiddleoftheendzoneforatouchdownanda 16-7 Michigan advantage.
The Buckeyes andWolverines exchanged leads in the secondquarterthreetimes.OhioStatetookaone-pointleadwith7:51left in the half after drilling a 45-yard field goal and 19-yardrushingscorebyMiller.
RobinsonledtheWolverines80yardsonnineplaysontheensu-ing drive, highlighted by a 46-yard counter rush byToussaintand a five-yard reception by Odoms to give Michigan a firstdownattheOSUsix-yardline.Robinsoncappedthedrivetwoplays later with his second rushing touchdown of the gamefromsixyardsout.However,onthenextdrive,Millerconnectedona43-yardpostroutetogivetheBuckeyesa24-23leadhead-ing into halftime.
TheMaize andBlue received theball to start the secondhalfandmarched80yards in11plays.Thedrive featured twobigpassplaysbyRobinson.Thefirsta26-yardtouchpasstoKogerbehind the OSU linebackers’ outstretched hands to set upMichiganinsidetheredzone.Thesecondcamethreeplayslateron third-and-11 when the offensive line gave Robinson time to connectwithOdoms for a 20-yard touchdown to give U-M a30-24lead.Afteradroppedsnaponthepunt,resultinginalossof17yards,OhioStatemoveddowntotheU-Mfive-yardline.TheMichigandefensemadethreestops,cappedbyasackbyDemensandsophomoredefensiveendJibreelBlack(Cincinnati,Ohio/Wyoming),forcingOSUtokicka21-yardfieldgoaltocutMichigan’sleadtothreepoints.
Thehomeoffenserewardedthedefense’sstop,extendingtheleadtotwoscoreswithamethodical75-yardtouchdowndrive.TheWolverinesutilizeda19-yardreceptionbyHemingwayandapersonalfoulpenaltyontheBuckeyestoworktheirwaydownto the four-yard line. Facing third-and-short, Robinson fakedthe Ohio State defense with a play-action pass and found awide-openKogerinthebackoftheendzonetogiveMichigana 37-27 lead.
Ohio Statemarched 80 yards in oneminute and 23 seconds,scoringonafour-yardtouchdownruntoshrinkMichigan’sleadback to three points.
TheWolverines appeared to have added another touchdownlate in the fourth quarter, but offensive holding and per-sonalfoulpenaltiesforcedMichiganfromthegoallinebacktothe OSU 26-yard line. Junior/sophomore placekicker BrendanGibbons (West Palm Beach, Fla./Cardinal Newman) converted a career-best43-yardfieldgoaltogiveMichigana40-34leadwith1:59leftinthefourthquarter.
TheBuckeyeshadonelastchancetowinthegame,needingtodrive 80 yards for a touchdownwithonlyone timeout.Millerscrambledforafirstdownonfourth-and-sixtokeepthedrivealive, but sophomore cornerback Courtney Avery (Mansfield,Ohio/lexington)--whoalsonotchedaforcedfumble--tippedand then intercepted Miller’s pass with 39 seconds left nearmidfield to seal the Michigan win.
G A M E R E C A P S - V S . O H I O S T A T E
SCORING SUMMARYFirst QuarterOSU:Brown54ydpassfromMiller(Basilkick)MiCH:Robinson,D.41ydrun(gibbonskick)MiCH:TEAMsafetyMiCH:Hemingway26ydpassfromRobinson,D.(Gibbons kick)Second QuarterOSU:Basil45ydfieldgoalOSU:Miller19ydrun(Basilkick)MiCH:Robinson,D.6ydrun(gibbonskick)OSU:Posey43ydpassfromMiller(Basilkick)Third QuarterMiCH:Odoms20ydpassfromRobinson,D.(gibbonskick)Fourth QuarterMiCH:Basil21ydfieldgoalMiCH:Koger4ydpassfromRobinson,D.(gibbonskick)OSU:Herron4ydrun(Basilkick)MiCH:gibbons43ydfieldgoal
TEAM STATISTICSCategory OSU U-M FiRSTDOWNS 18 23RUSHES-YARDS(NET) 31-137 50-277PASSiNgYDS(NET) 235 167Passes Att-Comp-Int 26-14-1 17-14-0 TOTAL OFFENSE 57-372 67-444 FumbleReturns-Yards 0-0 0-0PuntReturns-Yards 1-0 0-0KickoffReturns-Yards 3-76 4-77interceptions-Yards 0-0 1-1Punts(Number-Avg) 3-40.0 2-47.5Fumbles-lost 1-0 3-1Penalties-Yards 5-47 3-29Possession Time 24:50 35:10 Third-DownConv. 5of12 5of11Fourth-DownConv. 1of2 1of2Red-Zone 3-3 4-4 SacksBy:Number-Yards 1-3 4-15
INDIVIDUAL STATISTICSRUSHING: Ohio State-Miller, B. 16-100; Herron 15-37.Michigan-Robinson,D.26-170;Toussaint20-120;Smith1-3;Hopkins1-3;TEAM1-minus2;Hagerup1-minus17.PASSING: Ohio State-Miller, B. 14-25-1-235; TEAM0-1-0-0.Michigan-Robinson,D.14-17-0-167.RECEIVING:OhioState-Hall4-32;Posey3-58;Brown2-76;Stoneburner1-36;Fragel1-20;Smith1-6;Herron1-6;Boren,Zach1-1.Michigan-Koger4-40;Hemingway2-45;Dileo2-32;Odoms2-25;gallon2-11;Roundtree1-8;Toussaint1-6.
GAME 12: Ohio State at MichiganMichigan StadiumNovember 26, 2011114,132
1st ...2nd ... 3rd .... 4th ...FINALOhio State .............. 7 ...... 17 ........0 ....... 10 ...........34Michigan ................ 16 .......7 .........7 ....... 10 ...........40
ANN ARBOR, Mich. -- JuniorquarterbackDenardRobinson (Deerfield Beach, Fla./Deerfield Beach)passedforthreetouchdownsandranfortwomore,lift-ingtheUniversityofMichiganfootballteam(No.17AP/No.16USAToday)toa40-34victoryoverOhioStateonSaturday(Nov.26)atMichiganStadium.Thewinsnapsa seven-game losing streak to Ohio State -- the longest suchdroughtintherivalry--andgivesMichiganitsfirst10-win season since 2006 and its first-ever 8-0 home record.
Robinsontotaled337yardsandfivetouchdowns,carry-ingtheball26timesfor170yards--pushinghimpast1,000 rushing yards for the season -- and two touch-downs.Healsocompleted14-of-17passesfor167yardsandthreetouchdowns.
Another standout on offense was junior/sophomorerunningbackFitzgeraldToussaint (Youngstown,Ohio/liberty),whohad20carriesfor120yards--thesecondtime this season thatMichigan has had two 100-yardrushers in a game. Toussaint joined Robinson by sur-passing1,000rushingyardsfortheseasoninthisgame,marking the first time since 1975 that the Wolverines havehadtwo1,000-yardrushersinaseason.
Three seniors caught touchdown passes in their finalhome game at Michigan Stadium: tight end KevinKoger (Toledo, Ohio/Whitmer), wide receiver JuniorHemingway (Conway, S.C./Conway) and wideoutMartaviousOdoms (Pahokee,Fla./Pahokee).Koger fin-ished with a team-high four receptions for 40 yards,Hemingway grabbed two passes for a team-high 45yards,andOdomspostedtwocatchesfor25yards.
Defensively, Michigan allowed 372 total yards butcontinued to apply pressure, recording seven tack-les-for-loss and four sacks. Freshman linebackerDesmond Morgan (Holland, Mich./West Ottawa) ledthe Wolverines with a career-high 10 tackles, 1.5 TFLs andsack,whilesenior/juniormiddle linebackerKennyDemens (Oak Park,Mich./Detroit CountryDay) addedeight tackles and an assisted sack. Fifth-year seniordefensive end Ryan van Bergen (Whitehall, Mich./Whitehall) tied a career high with seven tackles to go along with two tackles-for-loss, an assisted sack and a pass breakup, giving him nine TFls in the last fivegames.
Ohio State jumped out to a quick lead, scoring on a54-yard touchdown pass. The Wolverines respondedtwopossessionslaterafterasackbysenior/juniorsafetyJordanKovacs(Curtice/Ohio/Clay)forcedtheBuckeyestopuntdeepintheirownterritory.Twoplays intothedrive,Robinsonpulledona readoptionandbeat theOhio State defense to the corner, sprinting 41 yardsdowntheleftsidelineforatouchdowntotiethegameat7-7with9:15leftinthefirstquarter.Football Ticket Interest ListJoinusatMichiganStadiumin2012!SupportMichiganAthletics and gain priority for individual and seasonticketsbybecomingamemberofthevictorsClub.
Junior defensive end Craig Roh (Scottsdale, Ohio/Chaparral) gave Michigan its first lead against Ohio State since 2007 on the ensuing possession. Afterstarting on its own 20-yard line, the Buckeyesmoved
SCORING SUMMARY
MICHIGAN FOOTBALL GAME NOTES PAGE 36
w O L V E R I N E S I N T H E N A T I O N A L F O O T B A L L L E A G U E FORMER wOLVERINE PLAYERS IN THE NFLPLAYER, POSITION TEAMAdrian Arrington, WR ................................. New Orleans SaintsJason Avant, WR ........................................... Philadelphia EaglesDavidBaas,Og .............................................NewYorkgiantsJeffBackus,OT ..............................................DetroitlionsTomBrady,QB .............................................. New England PatriotsAlanBranch,DT ............................................ Seattle SeahawksSteve Breaston, WR/RS ..............................KansasCityChiefsStevieBrown,DB ......................................... Indianapolis ColtsPrescottBurgess,lB ................................... Baltimore RavensBraylonEdwards,WR.................................. San Francisco 49ersJayFeely,PK .................................................. Arizona CardinalslarryFoote,lB ..............................................PittsburghSteelersJonathan Goodwin, C ................................ San Francisco 49ersBrandongraham,DE ................................. Philadelphia EaglesJamesHall,DE............................................... St.louisRamsLeon Hall, CB ................................................. Cincinnati BengalsDavidHarris,lB ............................................NewYorkJetsChad Henne, QB...........................................MiamiDolphinsSteveHutchinson,Og................................ Minnesota VikingsTimJamison,DE ...........................................HoustonTexansJake Long, OT ................................................MiamiDolphinsMario Manningham, WR ...........................NewYorkgiantsZoltan Mesko, P ............................................ New England PatriotsJonasMouton,lB ........................................ SanDiegoChargersRyanMundy,S* ...........................................PittsburghSteelersStephen Schilling, OL ................................. SanDiegoChargerslaMarrWoodley,OlB .................................PittsburghSteelersCharles Woodson, CB .................................greenBayPackers
#signedtopracticesquad*graduatedfromMichiganbutfinishedplayingcareeratanotherinstitution.
FORMER wOLVERINE PLAYERS COACHING IN THE NFLHarold Goodwin, Assistant Offensive Line ...................PittsburghSteelersJimHarbaugh,HeadCoach ...............................................San Francisco 49ersJim Herrmann, Linebackers ...............................................NewYorkgiantsJeraldingram,RunningBacks ...........................................NewYorkgiantsAndyMoeller,AssistantOffensiveline .........................Baltimore RavensMikeTrgovac,Defensiveline ............................................greenBayPackers
FORMER U-M ASSISTANTS COACHING IN THE NFLCam Cameron, Offensive Coordinator ...........................Baltimore RavensMikeDeBord,TightEnds .....................................................Chicago BearsTerryMalone,TightEnds ....................................................New Orleans SaintsBillSheridan,DefensiveCoordinator .............................MiamiDolphins
MICHIGAN FOOTBALL GAME NOTES PAGE 37
MICHIGAN FOOTBALL STATISTICAL FILES PAGE 1
2011 Statistical Files(Dec. 4, 2011)
2011 Michigan FootballMichigan Game Results (as of Nov 26, 2011)
All games
Date Opponent Score Overall Conference Time Attend
Sep 03, 2011 WESTERN MICHIGAN W 34-10 1-0 0-0 3:35 110506Sep 10, 2011 NOTRE DAME W 35-31 2-0 0-0 3:30 114804Sep 17, 2011 EASTERN MICHIGAN W 31-3 3-0 0-0 2:56 110343Sep 24, 2011 SAN DIEGO STATE W 28-7 4-0 0-0 3:08 110707
* Oct 1, 2011 MINNESOTA W 58-0 5-0 1-0 3:15 111106* Oct 08, 2011 at Northwestern W 42-24 6-0 2-0 3:16 47330* Oct 15, 2011 at #23 Michigan State L 14-28 6-1 2-1 3:27 77515* Oct 29, 2011 PURDUE W 36-14 7-1 3-1 3:04 112115* Nov 5, 2011 at Iowa L 16-24 7-2 3-2 3:11 70585* Nov 12, 2011 at Illinois W 31-14 8-2 4-2 3:23 60670* Nov 19, 2011 NEBRASKA W 45-17 9-2 5-2 3:30 113718* Nov 26, 2011 OHIO STATE W 40-34 10-2 6-2 3:35 114132
2011 Michigan Wolverines Game-by-Game Offense
---1st Downs--- Down Conv. NET OFF ----RUSHING---- -----------------PASSING-------------------- --------TDs------- FGs FUM PEN PUNTSOPP T R P P 3rd 4th Tot PL Tot Att Avg Net Sa-Yds Att-Comp TD In R P Rt M-A No-Ls No-Yds No-Avg TOP
WMU 17 9 5 3 3/6 1/1 288 39 190 26 7.3 98 0-0 13-9 0 0 3 0 2 0-0 1-0 1-5 2-41.0 18:15
ND 16 5 10 1 3/9 0/0 452 50 114 26 4.4 338 1-5 24-11 4 3 1 4 0 0-0 1-0 9-82 5-38.6 22:59
EMU 24 19 5 0 9/14 0/1 471 68 376 50 7.4 95 0-0 18-7 2 1 2 2 0 1-1 1-0 2-17 3-35.0 32:15
SDSU 18 14 3 1 4/11 1/1 413 62 320 45 7.1 93 0-0 17-8 0 2 4 0 0 0-1 3-2 4-25 4-49.0 30:13
MINN 32 19 10 3 6/11 0/0 580 73 363 48 7.6 217 1-8 25-18 3 0 3 3 1 3-3 1-0 3-24 2-37.5 36:22
at NW 23 8 14 1 14/17 1/1 541 78 179 50 3.6 362 0-0 28-19 2 3 4 2 0 0-1 0-0 5-65 1-38.0 37:57
at MSU 20 8 8 6 3/15 2/4 250 67 82 36 2.3 168 7-62 31-12 1 1 1 1 0 0-0 2-0 5-40 7-31.9 29:27
PUR 25 17 7 1 7/13 1/2 535 70 339 53 6.4 196 1-8 17-10 0 2 4 0 0 2-2 0-0 5-51 2-40.5 36:25
at IOWA 22 10 10 2 7/16 1/2 323 75 127 37 3.4 196 2-28 38-18 2 1 0 2 0 1-1 2-1 3-20 5-39.4 30:06
at ILL 14 8 6 0 6/14 0/1 362 63 223 48 4.6 139 1-8 15-8 1 1 3 1 0 1-2 3-2 4-29 4-34.2 32:45
NEB 24 14 6 4 8/18 1/1 418 80 238 61 3.9 180 1-13 19-11 2 1 4 2 0 1-2 0-0 5-45 4-36.8 41:13
OSU 23 14 8 1 5/11 1/2 444 67 277 50 5.5 167 1-3 17-14 2 0 2 3 0 1-1 3-1 3-29 2-47.5 35:10
Va.Tech.
TOTAL 258 145 90 23 75/155 9/16 5077 792 2828 530 5.3 2249 15-135 262-145 20 15 31 20 3 10-14 17-6 49-432 41-38.3 31:56
2011 Michigan Wolverines Game-by-Game Defense
---1st Downs--- Down Conv. NET OFF ----RUSHING---- -----------------PASSING-------------------- --------TDs------- FGs FUM PEN PUNTSOPP T R P P 3rd 4th Tot PL Tot Att Avg Net Sa-Yds Att-Comp TD In R P Rt M-A No-Ls No-Yds No-Avg TOP
WMU 17 8 9 0 6/11 1/1 279 56 96 25 3.8 183 2-16 31-22 0 1 1 0 0 1-2 3-2 8-50 2-46.5 25:18
ND 28 9 15 4 8/14 0/0 513 72 198 33 6.0 315 0-0 39-27 3 2 1 3 0 1-1 4-3 9-75 4-33.5 37:01
EMU 12 10 1 1 4/12 1/2 236 52 207 46 4.5 29 1-6 6-3 0 1 0 0 0 1-2 1-1 5-45 5-43.6 27:45
SDSU 20 5 15 0 8/18 0/3 376 77 123 29 4.2 253 1-14 48-23 1 0 0 1 0 0-0 4-3 6-55 6-38.2 29:47
MINN 8 2 5 1 0/11 0/0 177 47 73 25 2.9 104 3-16 22-11 0 0 0 0 0 0-0 2-2 9-74 10-36.3 23:38
at NW 26 6 17 3 4/11 0/2 438 70 107 25 4.3 331 4-26 45-32 0 1 3 0 0 1-1 1-1 5-51 3-46.7 22:03
at MSU 16 9 7 0 7/14 0/0 333 63 213 39 5.5 120 0-0 24-13 2 0 1 2 1 0-0 2-2 13-124 5-41.0 30:33
PUR 16 5 9 2 3/13 1/2 311 56 89 29 3.1 222 4-20 27-17 2 1 0 2 0 0-0 0-0 8-86 6-38.7 23:35
at IOWA 15 6 8 1 4/12 1/2 302 56 131 35 3.7 171 2-10 21-14 1 0 2 1 0 1-1 0-0 5-29 5-40.0 29:54
at ILL 15 6 8 1 5/17 2/2 214 67 37 33 1.1 177 4-49 34-17 0 1 2 0 0 0-0 3-2 4-25 9-41.6 27:15
NEB 11 7 4 0 3/13 0/2 260 54 138 31 4.5 122 3-4 23-9 1 0 1 1 0 1-1 4-3 8-73 6-46.0 18:39
OSU 18 9 8 1 5/12 1/2 372 57 137 31 4.4 235 4-15 26-14 2 1 2 2 0 2-2 1-0 5-47 3-40.0 24;50
Va.Tech
TOTAL 202 82 106 14 57/158 7/18 3811 727 1549 381 4.1 2262 28-176 346-202 12 8 13 12 1 8-10 24-19 85-734 64-40.4 26:42
2011 Michigan FootballMichigan Overall Team Statistics (as of Nov 26, 2011)
All games
Team Statistics MICH OPPSCORING 410 206 Points Per Game 34.2 17.2FIRST DOWNS 258 202 R u s h i n g 145 82 P a s s i n g 90 106 P e n a l t y 23 14RUSHING YARDAGE 2828 1549 Yards gained rushing 3134 1837 Yards lost rushing 306 288 Rushing Attempts 530 381 Average Per Rush 5.3 4.1 Average Per Game 235.7 129.1 TDs Rushing 31 13PASSING YARDAGE 2249 2262 C o m p - A t t - I n t 145-262-15 202-346-8 Average Per Pass 8.6 6.5 Average Per Catch 15.5 11.2 Average Per Game 187.4 188.5 TDs Passing 20 12TOTAL OFFENSE 5077 3811 Total Plays 792 727 Average Per Play 6.4 5.2 Average Per Game 423.1 317.6KICK RETURNS: #-Yards 30-592 53-1131PUNT RETURNS: #-Yards 22-198 20-169INT RETURNS: #-Yards 8-156 15-121KICK RETURN AVERAGE 19.7 21.3PUNT RETURN AVERAGE 9.0 8.4INT RETURN AVERAGE 19.5 8.1FUMBLES-LOST 17-6 24-19PENALTIES-Yards 49-432 85-734 Average Per Game 36.0 61.2PUNTS-Yards 41-1569 64-2584 Average Per Punt 38.3 40.4 Net punt average 33.7 36.3TIME OF POSSESSION/Game 3 1 : 5 6 2 6 : 4 23RD-DOWN Conversions 75/155 57/158 3rd-Down Pct 48% 36%4TH-DOWN Conversions 9/16 7/18 4th-Down Pct 56% 39%SACKS BY-Yards 28-176 15-135MISC YARDS 0 1TOUCHDOWNS SCORED 54 26FIELD GOALS-ATTEMPTS 10-14 8-10ON-SIDE KICKS 0-0 0-1RED-ZONE SCORES (46-55) 84% (24-35) 69%RED-ZONE TOUCHDOWNS (36-55) 65% (20-35) 57%PAT-ATTEMPTS (52-53) 98% (26-26) 100%ATTENDANCE 897431 256100 Games/Avg Per Game 8/112179 4/64025 Neutral Site Games 0/0
Score by Quarters 1st 2nd 3rd 4th OT TotalMichigan 88 115 86 121 0 410Opponents 70 49 42 45 0 206
2011 Michigan FootballMichigan Overall Individual Statistics (as of Nov 26, 2011)
All games
Rushing gp-gs att gain loss net avg td lg avg/gRobinson, Denard 12-12 208 1307 144 1163 5.6 16 53 96.9Toussaint, Fitz 11-10 174 1059 48 1011 5.8 9 65 91.9Smith, Vincent 11-1 49 303 7 296 6.0 2 38 26.9Shaw, Michael 9 - 1 31 214 15 199 6.4 3 44 22.1Rawls, Thomas 9 - 0 13 80 1 79 6.1 0 25 8.8Gardner, Devin 9 - 0 25 101 48 53 2.1 1 15 5.9Hopkins, Stephen 11-2 11 43 0 43 3.9 0 12 3.9Gallon, Jeremy 12-1 2 19 0 19 9.5 0 11 1.6Dileo, Drew 12-0 2 7 0 7 3.5 0 4 0.6Odoms, Martavious 11-3 1 1 0 1 1.0 0 1 0.1Hagerup, Will 8 - 0 1 0 17 -17 -17.0 0 0 -2.1TEAM 9 - 0 13 0 26 -26 -2.0 0 0 -2.9Total 12 530 3134 306 2828 5.3 31 65 235.7Opponents 12 381 1837 288 1549 4.1 13 41 129.1
Passing gp-gs effic comp-att-int pct yds td lg avg/gRobinson, Denard 12-12 142.24 133-237-14 56.1 2056 18 77 171.3Gardner, Devin 9 - 0 117.76 11-23-1 47.8 176 1 32 19.6Smith, Vincent 11-1 286.40 1-2-0 50.0 17 1 17 1.5Total 12 141.19 145-262-15 55.3 2249 20 77 187.4Opponents 12 120.12 202-346-8 58.4 2262 12 54 188.5
Receiving gp-gs no. yds avg td lg avg/gHemingway, Junior 12-11 32 636 19.9 2 77 53.0Gallon, Jeremy 12-1 30 450 15.0 3 64 37.5Koger, Kevin 12-11 21 235 11.2 4 40 19.6Roundtree, Roy 12-12 18 345 19.2 2 57 28.8Smith, Vincent 11-1 10 142 14.2 2 32 12.9Dileo, Drew 12-0 9 121 13.4 2 28 10.1Odoms, Martavious 11-3 7 131 18.7 3 38 11.9Toussaint, Fitz 11-10 5 14 2.8 1 7 1.3Grady, Kelvin 12-3 4 64 16.0 0 27 5.3Jackson, Jeremy 12-0 3 36 12.0 0 19 3.0Hopkins, Stephen 11-2 1 28 28.0 0 28 2.5McColgan, John 11-1 1 15 15.0 0 15 1.4Shaw, Michael 9 - 1 1 12 12.0 0 12 1.3Watson, Steve 12-4 1 9 9.0 1 9 0.8Moore, Brandon 10-0 1 9 9.0 0 9 0.9Gardner, Devin 9 - 0 1 2 2.0 0 2 0.2Total 12 145 2249 15.5 20 77 187.4Opponents 12 202 2262 11.2 12 54 188.5
Punt Returns no. yds avg td lgGallon, Jeremy 19 192 10.1 0 32Dileo, Drew 1 0 0.0 0 0Furman, Josh 1 6 6.0 0 0Floyd, J.T. 1 0 0.0 0 0Total 22 198 9.0 0 32Opponents 20 169 8.4 0 22
Interceptions no. yds avg td lgAvery, Courtney 2 1 0.5 0 1Floyd, J.T. 2 59 29.5 0 43Kovacs, Jordan 1 2 2.0 0 2Herron, Brandon 1 94 94.0 1 94Hawthorne, Brandin 1 0 0.0 0 0Gordon, Thomas 1 0 0.0 0 0Total 8 156 19.5 1 94Opponents 15 121 8.1 1 39
Kick Returns no. yds avg td lgOdoms, Martavious 16 352 22.0 0 33Smith, Vincent 7 129 18.4 0 24Gallon, Jeremy 3 46 15.3 0 20Grady, Kelvin 3 57 19.0 0 25Koger, Kevin 1 8 8.0 0 8Total 30 592 19.7 0 33Opponents 53 1131 21.3 0 38
Fumble Returns no. yds avg td lgAvery, Courtney 1 83 83.0 1 83Herron, Brandon 1 29 29.0 1 29Total 2 112 56.0 2 83Opponents 1 2 2.0 0 2
2011 Michigan FootballMichigan Overall Individual Statistics (as of Nov 26, 2011)
All games
PATScoring td fg kick rush rcv pass dxp saf ptsRobinson, Denard 16 - - - - - - - 96Gibbons, Brendan - 10-14 52-53 - - - - - 82Toussaint, Fitz 10 - - - - - - - 60Smith, Vincent 4 - - - - - - - 24Koger, Kevin 4 - - - - - - - 24Gallon, Jeremy 3 - - - - - - - 18Shaw, Michael 3 - - - - - - - 18Odoms, Martavious 3 - - - - - - - 18Roundtree, Roy 2 - - - - - - - 12Dileo, Drew 2 - - 0-1 - - - - 12Herron, Brandon 2 - - - - - - - 12Hemingway, Junior 2 - - - - - - - 12Gardner, Devin 1 - - - - - - - 6Watson, Steve 1 - - - - - - - 6Avery, Courtney 1 - - - - - - - 6TEAM - - - - - - - 1 2Martin, Mike - - - - - - - 1 2Total 54 10-14 52-53 0-1 - - - 2 410Opponents 26 8-10 26-26 - - - - - 206
Total Offense g plays rush pass total avg/gRobinson, Denard 12 445 1163 2056 3219 268.2Toussaint, Fitz 11 174 1011 0 1011 91.9Smith, Vincent 11 51 296 17 313 28.5Gardner, Devin 9 48 53 176 229 25.4Shaw, Michael 9 31 199 0 199 22.1Rawls, Thomas 9 13 79 0 79 8.8Hopkins, Stephen 11 11 43 0 43 3.9Gallon, Jeremy 12 2 19 0 19 1.6Dileo, Drew 12 2 7 0 7 0.6Odoms, Martavious 11 1 1 0 1 0.1Hagerup, Will 8 1 -17 0 -17 -2.1TEAM 9 13 -26 0 -26 -2.9Total 12 792 2828 2249 5077 423.1Opponents 12 727 1549 2262 3811 317.6
Field Goals fg pct. 01-19 20-29 30-39 40-49 50-99 lg blkGibbons, Brendan 10-14 71.4 0-0 4-4 4-6 2-4 0-0 43 1
FG Sequence Michigan OpponentsWestern Michigan - 38,(36)Notre Dame - (38)Eastern Michigan (21) (21),50San Diego State 40 -Minnesota (25),(32),(38) -Northwestern 37 (20)Michigan State - -Purdue (37),(22) -Iowa (32) (42)Illinois 38,(27) -Nebraska (42),42 (51)Ohio State (43) (45),(21)
Numbers in (parentheses) indicate field goal was made.
Punting no. yds avg lg tb fc i20 50+ blkHagerup, Will 27 993 36.8 50 1 7 5 1 0Wile, Matt 14 576 41.1 51 0 4 4 2 0Total 41 1569 38.3 51 1 11 9 3 0Opponents 64 2584 40.4 69 3 14 18 9 1
Kickoffs no. yds avg tb ob retn net ydlnWile, Matt 75 4798 64.0 19 3Total 75 4798 64.0 19 3 21.3 43.8 26Opponents 46 2954 64.2 15 0 19.7 44.8 25
2011 Michigan FootballMichigan Overall Individual Statistics (as of Nov 26, 2011)
All games
All Purpose g rush rcv pr kr ir total avg/gRobinson, Denar 12 1163 0 0 0 0 1163 96.9Toussaint, Fitz 11 1011 14 0 0 0 1025 93.2Gallon, Jeremy 12 19 450 192 46 0 707 58.9Hemingway, Jun 12 0 636 0 0 0 636 53.0Smith, Vincent 11 296 142 0 129 0 567 51.5Odoms, Martavi 11 1 131 0 352 0 484 44.0Roundtree, Roy 12 0 345 0 0 0 345 28.8Koger, Kevin 12 0 235 0 8 0 243 20.2Shaw, Michael 9 199 12 0 0 0 211 23.4Dileo, Drew 12 7 121 0 0 0 128 10.7Grady, Kelvin 12 0 64 0 57 0 121 10.1Herron, Brandon 4 0 0 0 0 94 94 23.5Rawls, Thomas 9 79 0 0 0 0 79 8.8Hopkins, Stephe 11 43 28 0 0 0 71 6.5Floyd, J.T. 12 0 0 0 0 59 59 4.9Gardner, Devin 9 53 2 0 0 0 55 6.1Jackson, Jeremy 12 0 36 0 0 0 36 3.0McColgan, John 11 0 15 0 0 0 15 1.4Watson, Steve 12 0 9 0 0 0 9 0.8Moore, Brandon 10 0 9 0 0 0 9 0.9Furman, Josh 11 0 0 6 0 0 6 0.5Kovacs, Jordan 11 0 0 0 0 2 2 0.2Avery, Courtney 12 0 0 0 0 1 1 0.1Hagerup, Will 8 -17 0 0 0 0 -17 -2.1TEAM 9 -26 0 0 0 0 -26 -2.9Total 12 2828 2249 198 592 156 6023 501.9Opponents 12 1549 2262 169 1131 121 5232 436.0
2011 Michigan FootballMichigan Overall Defensive Statistics (as of Nov 26, 2011)
All games
Tackles Sacks Pass defense Fumbles blkd
## Defensive Leaders gp-gs ua a tot tfl/yds no-yds int-yds brup qbh rcv-yds ff kick saf
25 Demens, Kenny 12-12 45 41 86 5.0-20 3.0-18 . 1 1 . 1 . .32 Kovacs, Jordan 11-11 45 19 64 8.0-48 4.0-36 1-2 1 1 1-0 2 . .30 Gordon, Thomas 12-9 37 22 59 1.5-2 . 1-0 2 . 4-0 2 . .68 Martin, Mike 12-12 16 38 54 5.5-24 3.0-18 . . 3 . . . 144 Morgan, Desmond 11-6 21 32 53 2.5-4 1.0-1 . 1 . 1-0 . . .8 Floyd, J.T. 12-11 30 15 45 . . 2-59 8 . . 1 . .7A Hawthorne, Brandin 11-5 25 18 43 3.0-6 1.0-1 1-0 1 . . . . .53 Van Bergen, Ryan 12-11 24 17 41 12.0-54 5.0-34 . 4 3 3-0 1 . .18 Countess, Blake 11-5 24 12 36 1.0-1 . . 6 . . 1 . .90 Ryan, Jake 12-10 14 16 30 7.0-17 2.0-5 . . . 2-0 1 . .88 Roh, Craig 12-12 18 11 29 8.0-37 4.0-31 . . 2 . 1 . .29 Woolfolk, Troy 12-10 16 13 29 . . . 2 . . . . .5 Avery, Courtney 12-3 16 8 24 1.5-13 0.5-6 2-1 3 . 2-83 1 . .39 Heininger, Will 12-12 10 13 23 4.0-16 1.0-8 . 1 . . . . .55 Black, Jibreel 12-0 11 6 17 1.5-10 1.5-10 . . . . 1 . .13 Johnson, Carvin 8-0 9 5 14 . . . 1 . 1-0 . . .73 Campbell, Will 12-0 5 6 11 2.5-9 2.0-8 . 1 . 1-0 . . .97 Beyer, Brennen 10-0 5 6 11 . . . . . . . . .14 Furman, Josh 11-0 5 5 10 . . . . . . . 1 .2H Cavanaugh, Matthew 12-0 3 7 10 . . . . . . . . .42 Fitzgerald, J.B. 12-0 4 6 10 . . . . . 1-0 . . .3 Robinson, Marvin 5-1 6 3 9 . . . . . . . . .58 Herron, Brandon 4-1 1 7 8 . . 1-94 . . 1-29 . . .23 Simmons, Floyd 12-0 6 . 6 . . . . . . 2 . .82 Robinson, Terrence 11-0 3 2 5 . . . . . 1-0 1 . .5G Clark, Frank 11-0 2 3 5 . . . . . . . . .24 Hollowell, Delonte 4-0 4 1 5 . . . . . . . . .45 Wile, Matt 12-0 4 . 4 . . . . . . . . .27 Jones, Mike 9-0 3 1 4 . . . . . . . . .2 Smith, Vincent 11-1 3 . 3 . . . . . . . . .49 McColgan, John 11-1 3 . 3 . . . . . 1-0 . . .4 Gordon, Cameron 6-0 2 1 3 . . . . . . . . .6 Taylor, Raymon 9-0 1 1 2 . . . . . . . . .84 Watson, Steve 12-4 . 2 2 . . . . . . . . .10 Gallon, Jeremy 12-1 2 . 2 . . . . . . . . .31 Van Slyke, Jared 11-0 1 1 2 . . . 1 . . . . .21 Hemingway, Junior 12-11 1 1 2 . . . . . . . . .20 Shaw, Michael 9-1 1 . 1 . . . . . . . . .76 Washington, Quinton 8-0 1 . 1 . . . . . . . . .86 Koger, Kevin 12-11 1 . 1 . . . . . . . . .91 Pomarico, Tom 12-0 . 1 1 . . . . . . . . .72 Huyge, Mark 12-12 1 . 1 . . . . . . . . .67 Brink, Nathan 11-1 1 . 1 1.0-4 . . . . . . . .43 Hagerup, Will 8-0 1 . 1 . . . . . . . . .75 Schofield, Michael 12-9 1 . 1 . . . . . . . . .TM TEAM 9-0 . . . . . . . . . . . 1
Total 12 432 340 772 64-265 28-176 8-156 33 10 19-112 15 1 2Opponents 12 447 376 823 69-258 15-135 15-121 24 6 6-2 10 2 .
2011 Michigan FootballMichigan Team Game-by-Game (as of Nov 26, 2011)
All games
TEAM STATISTICS
Rushing Receiving Passing Kick Returns Punt Returns totDate Opponent no. yds td lg no. yds td lg cmp-att-int yds td lg no. yds td lg no. yds td lg offSep 03 WESTERN MICHIGAN 26 190 3 44 9 98 0 37 9-13-0 98 0 37 3 57 0 25 1 5 0 5 288Sep 10 NOTRE DAME 26 114 1 39 11 338 4 77 11-24-3 338 4 77 5 98 0 24 1 21 0 21 452Sep 17 EASTERN MICHIGAN 50 376 2 52 7 95 2 24 7-18-1 95 2 24 2 31 0 17 3 17 0 9 471Sep 24 SAN DIEGO STATE 45 320 4 53 8 93 0 32 8-17-2 93 0 32 0 0 0 0 2 21 0 21 413Oct 1 MINNESOTA 48 363 3 35 18 217 3 28 18-25-0 217 3 28 0 0 0 0 1 0 0 0 580Oct 08 at Northwestern 50 179 4 25 19 362 2 57 19-28-3 362 2 57 3 56 0 25 0 0 0 0 541Oct 15 at Michigan State 36 82 1 26 12 168 1 34 12-31-1 168 1 34 2 32 0 17 2 22 0 18 250Oct 29 PURDUE 53 339 4 59 10 196 0 49 10-17-2 196 0 49 3 81 0 33 1 0 0 0 535Nov 5 at Iowa 37 127 0 22 18 196 2 19 18-38-1 196 2 19 5 90 0 28 2 17 0 9 323Nov 12 at Illinois 48 223 3 65 8 139 1 40 8-15-1 139 1 40 0 0 0 0 4 62 0 32 362Nov 19 NEBRASKA 61 238 4 31 11 180 2 46 11-19-1 180 2 46 3 70 0 32 5 33 0 17 418Nov 26 OHIO STATE 50 277 2 46 14 167 3 28 14-17-0 167 3 28 4 77 0 25 0 0 0 0 444Michigan 530 2828 31 65 145 2249 20 77 145-262-15 2249 20 77 30 592 0 33 22 198 0 32 5077Opponents 381 1549 13 41 202 2262 12 54 202-346-8 2262 12 54 53 1131 0 38 20 169 0 22 3811
Games played: 12 Avg per rush: 5.3 Avg per catch: 15.5 Pass efficiency: 141.19 Kick ret avg: 19.7 Punt ret avg: 9.0 All purpose avg/game: 501.9 Total offense avg/gm: 423.1
Tackles Sacks Fumble Pass Defense Blkd PAT AttemptsDate Opponent ua a total tfl-yds no-yds ff fr-yds int-yds qbh brup kick kick rush rcv saf ptsSep 03 WESTERN MICHIGAN 31 36 67 4.0-20 2.0-16 1 2-29 1-94 0 4 0 4-5 0 0 0 34Sep 10 NOTRE DAME 49 24 73 4.0-9 0.0-0 1 3-0 2-18 0 2 0 5-5 0 0 0 35Sep 17 EASTERN MICHIGAN 38 30 68 4.0-13 1.0-6 1 1-0 1-0 0 0 0 4-4 0 0 0 31Sep 24 SAN DIEGO STATE 43 24 67 4.0-22 1.0-14 3 3-0 0-0 0 4 0 4-4 0 0 0 28Oct 1 MINNESOTA 32 18 50 5.0-21 3.0-16 1 2-83 0-0 0 3 0 7-7 0 0 0 58Oct 08 at Northwestern 45 30 75 5.0-27 4.0-26 1 1-0 1-0 3 3 0 6-6 0 0 0 42Oct 15 at Michigan State 39 26 65 6.0-11 0.0-0 2 2-0 0-0 3 0 0 2-2 0 0 0 14Oct 29 PURDUE 28 38 66 7.0-29 4.0-20 0 0-0 1-0 0 3 0 4-4 0 0 1 36Nov 5 at Iowa 32 38 70 6.0-18 2.0-10 0 0-0 0-0 0 2 0 1-1 0 0 0 16Nov 12 at Illinois 31 28 59 6.0-54 4.0-49 1 2-0 1-43 4 5 0 4-4 0 0 0 31Nov 19 NEBRASKA 35 18 53 6.0-18 3.0-4 3 3-0 0-0 0 6 1 6-6 0 0 0 45Nov 26 OHIO STATE 29 30 59 7.0-23 4.0-15 1 0-0 1-1 0 1 0 5-5 0 0 1 40Michigan 432 340 772 64.0-265 28.0-176 15 19-112 8-156 10 33 1 52-53 0 0 2 410Opponents 447 376 823 69.0-258 15.0-135 10 6-2 15-121 6 24 2 26-26 0 0 0 206
Punting Field Goals KickoffsDate Opponent no. yds avg long blkd tb fc 50+ i20 md-att long blkd no. yds avg tb obSep 03 WESTERN MICHIGAN 2 82 41.0 47 0 0 0 0 1 0-0 0 0 6 395 65.8 0 0Sep 10 NOTRE DAME 5 193 38.6 47 0 0 2 0 1 0-0 0 0 6 361 60.2 0 0Sep 17 EASTERN MICHIGAN 3 105 35.0 41 0 0 1 0 0 1-1 21 0 6 350 58.3 0 0Sep 24 SAN DIEGO STATE 4 196 49.0 51 0 0 1 2 2 0-1 0 0 5 341 68.2 1 0Oct 1 MINNESOTA 2 75 37.5 47 0 0 0 0 0 3-3 38 0 11 683 62.1 3 1Oct 08 at Northwestern 1 38 38.0 38 0 0 0 0 0 0-1 0 1 7 454 64.9 3 1Oct 15 at Michigan State 7 223 31.9 42 0 1 1 0 4 0-0 0 0 3 158 52.7 0 0Oct 29 PURDUE 2 81 40.5 49 0 0 0 0 0 2-2 37 0 6 386 64.3 2 0Nov 5 at Iowa 5 197 39.4 49 0 0 3 0 0 1-1 32 0 4 246 61.5 0 1Nov 12 at Illinois 4 137 34.2 44 0 0 0 0 1 1-2 27 0 6 409 68.2 5 0Nov 19 NEBRASKA 4 147 36.8 50 0 0 2 1 0 1-2 42 0 8 537 67.1 1 0Nov 26 OHIO STATE 2 95 47.5 48 0 0 1 0 0 1-1 43 0 7 478 68.3 4 0Michigan 41 1569 38.3 51 0 1 11 3 9 10-14 43 1 75 4798 64.0 19 3Opponents 64 2584 40.4 69 1 3 14 9 18 8-10 51 0 46 2954 64.2 15 0
2011 Michigan FootballMichigan Opponent Game-by-Game (as of Nov 26, 2011)
All games
OPPONENT STATISTICS
Rushing Receiving Passing Kick Returns Punt Returns totDate Opponent no. yds td lg no. yds td lg cmp-att-int yds td lg no. yds td lg no. yds td lg offSep 03 WESTERN MICHIGAN 25 96 1 24 22 183 0 20 22-31-1 183 0 20 6 188 0 38 2 16 0 11 279Sep 10 NOTRE DAME 33 198 1 38 27 315 3 29 27-39-2 315 3 29 6 89 0 34 3 10 0 13 513Sep 17 EASTERN MICHIGAN 46 207 0 19 3 29 0 18 3-6-1 29 0 18 6 122 0 32 2 16 0 15 236Sep 24 SAN DIEGO STATE 29 123 0 30 23 253 1 30 23-48-0 253 1 30 4 75 0 29 2 22 0 22 376Oct 1 MINNESOTA 25 73 0 29 11 104 0 33 11-22-0 104 0 33 7 159 0 34 1 0 0 0 177Oct 08 at Northwestern 25 107 3 23 32 331 0 39 32-45-1 331 0 39 3 48 0 20 1 20 0 20 438Oct 15 at Michigan State 39 213 1 25 13 120 2 16 13-24-0 120 2 16 3 47 0 21 1 13 0 13 333Oct 29 PURDUE 29 89 0 41 17 222 2 48 17-27-1 222 2 48 4 98 0 30 2 25 0 14 311Nov 5 at Iowa 35 131 2 27 14 171 1 44 14-21-0 171 1 44 3 56 0 23 2 28 0 14 302Nov 12 at Illinois 33 37 2 13 17 177 0 32 17-34-1 177 0 32 1 14 0 14 2 8 0 6 214Nov 19 NEBRASKA 31 138 1 23 9 122 1 54 9-23-0 122 1 54 7 159 0 33 1 11 0 11 260Nov 26 OHIO STATE 31 137 2 24 14 235 2 54 14-26-1 235 2 54 3 76 0 31 1 0 0 0 372Opponents 381 1549 13 41 202 2262 12 54 202-346-8 2262 12 54 53 1131 0 38 20 169 0 22 3811Michigan 530 2828 31 65 145 2249 20 77 145-262-15 2249 20 77 30 592 0 33 22 198 0 32 5077
Games played: 12 Avg per rush: 4.1 Avg per catch: 11.2 Pass efficiency: 120.12 Kick ret avg: 21.3 Punt ret avg: 8.4 All purpose avg/game: 436.0 Total offense avg/gm: 317.6
Tackles Sacks Fumble Pass Defense Blkd PAT AttemptsDate Opponent ua a total tfl-yds no-yds ff fr-yds int-yds qbh brup kick kick rush rcv saf ptsSep 03 WESTERN MICHIGAN 26 16 42 2.0-2 0.0-0 0 0-0 0-0 0 1 1 1-1 0 0 0 10Sep 10 NOTRE DAME 29 12 41 5.0-17 1.0-5 1 0-0 3-0 0 1 0 4-4 0 0 0 31Sep 17 EASTERN MICHIGAN 40 28 68 4.0-6 0.0-0 1 0-0 1-0 0 2 0 0-0 0 0 0 3Sep 24 SAN DIEGO STATE 37 24 61 4.0-9 0.0-0 2 2-0 2-0 0 1 0 1-1 0 0 0 7Oct 1 MINNESOTA 46 24 70 5.0-15 1.0-8 1 0-0 0-0 0 3 0 0-0 0 0 0 0Oct 08 at Northwestern 43 38 81 8.0-17 0.0-0 0 0-0 3-67 0 0 1 3-3 0 0 0 24Oct 15 at Michigan State 32 30 62 10.0-68 7.0-62 1 0-0 1-39 3 4 0 4-4 0 0 0 28Oct 29 PURDUE 34 52 86 5.0-18 1.0-8 0 0-0 2-0 0 3 0 2-2 0 0 0 14Nov 5 at Iowa 39 40 79 4.0-30 2.0-28 1 1-0 1-5 1 4 0 3-3 0 0 0 24Nov 12 at Illinois 23 60 83 9.0-37 1.0-8 2 2-2 1-0 2 1 0 2-2 0 0 0 14Nov 19 NEBRASKA 58 18 76 9.0-33 1.0-13 0 0-0 1-10 0 3 0 2-2 0 0 0 17Nov 26 OHIO STATE 40 34 74 4.0-6 1.0-3 1 1-0 0-0 0 1 0 4-4 0 0 0 34Opponents 447 376 823 69.0-258 15.0-135 10 6-2 15-121 6 24 2 26-26 0 0 0 206Michigan 432 340 772 64.0-265 28.0-176 15 19-112 8-156 10 33 1 52-53 0 0 2 410
Punting Field Goals KickoffsDate Opponent no. yds avg long blkd tb fc 50+ i20 md-att long blkd no. yds avg tb obSep 03 WESTERN MICHIGAN 2 93 46.5 49 0 0 1 0 1 1-2 36 0 3 205 68.3 0 0Sep 10 NOTRE DAME 4 134 33.5 52 0 0 1 1 2 1-1 38 0 6 414 69.0 1 0Sep 17 EASTERN MICHIGAN 5 218 43.6 53 0 0 2 1 3 1-2 21 0 2 133 66.5 0 0Sep 24 SAN DIEGO STATE 6 229 38.2 52 0 0 4 1 2 0-0 0 0 2 140 70.0 2 0Oct 1 MINNESOTA 10 363 36.3 64 0 2 3 1 1 0-0 0 0 1 70 70.0 1 0Oct 08 at Northwestern 3 140 46.7 47 0 0 0 0 0 1-1 20 0 4 248 62.0 1 0Oct 15 at Michigan State 5 205 41.0 45 0 0 0 0 1 0-0 0 0 5 333 66.6 3 0Oct 29 PURDUE 6 232 38.7 49 0 1 1 0 1 0-0 0 0 4 210 52.5 0 0Nov 5 at Iowa 5 200 40.0 44 0 0 1 0 2 1-1 42 0 5 263 52.6 0 0Nov 12 at Illinois 9 374 41.6 61 0 0 0 2 1 0-0 0 0 2 140 70.0 2 0Nov 19 NEBRASKA 6 276 46.0 69 1 0 0 2 2 1-1 51 0 4 268 67.0 1 0Nov 26 OHIO STATE 3 120 40.0 58 0 0 1 1 2 2-2 45 0 8 530 66.2 4 0Opponents 64 2584 40.4 69 1 3 14 9 18 8-10 51 0 46 2954 64.2 15 0Michigan 41 1569 38.3 51 0 1 11 3 9 10-14 43 1 75 4798 64.0 19 3
2011 Michigan FootballMichigan Red-Zone Results (as of Nov 26, 2011)
All games
Michigan Inside Opponent Red-Zone
Times Times Total Rush Pass FGs Failed to score inside RZ
Date Opponent Score In RZ Scored Pts TDs TDs TDs Made FGA Down Int Fumb Half Game
Sep 03, 2011 WESTERN MICHIGAN W 34-10 2 2 13 2 2 0 0 0 0 0 0 0 0Sep 10, 2011 NOTRE DAME W 35-31 3 3 21 3 1 2 0 0 0 0 0 0 0Sep 17, 2011 EASTERN MICHIGAN W 31-3 5 5 31 4 2 2 1 0 0 0 0 0 0Sep 24, 2011 SAN DIEGO STATE W 28-7 3 3 21 3 3 0 0 0 0 0 0 0 0Oct 1, 2011 MINNESOTA W 58-0 9 8 44 5 3 2 3 0 0 0 0 1 0Oct 08, 2011 at Northwestern W 42-24 6 5 35 5 4 1 0 0 0 1 0 0 0Oct 15, 2011 at Michigan State L 14-28 2 1 7 1 1 0 0 0 1 0 0 0 0Oct 29, 2011 PURDUE W 36-14 5 4 20 2 2 0 2 0 1 0 0 0 0Nov 5, 2011 at Iowa L 16-24 5 3 16 2 0 2 1 0 1 1 0 0 0Nov 12, 2011 at Illinois W 31-14 6 3 17 2 2 0 1 1 1 0 1 0 0Nov 19, 2011 NEBRASKA W 45-17 5 5 31 4 3 1 1 0 0 0 0 0 0Nov 26, 2011 OHIO STATE W 40-34 4 4 24 3 1 2 1 0 0 0 0 0 0
Totals 55 46 280 36 24 12 10 1 4 2 1 1 046 of 55 (83.6%)
Opponents Inside Michigan Red-Zone
Times Times Total Rush Pass FGs Failed to score inside RZ
Date Opponent Score In RZ Scored Pts TDs TDs TDs Made FGA Down Int Fumb Half Game
Sep 03, 2011 WESTERN MICHIGAN W 34-10 3 2 10 1 1 0 1 0 0 1 0 0 0Sep 10, 2011 NOTRE DAME W 35-31 5 3 21 3 1 2 0 0 0 1 1 0 0Sep 17, 2011 EASTERN MICHIGAN W 31-3 2 1 3 0 0 0 1 0 1 0 0 0 0Sep 24, 2011 SAN DIEGO STATE W 28-7 3 1 7 1 0 1 0 0 1 0 1 0 0Oct 1, 2011 MINNESOTA W 58-0 1 0 0 0 0 0 0 0 0 0 1 0 0Oct 08, 2011 at Northwestern W 42-24 5 4 24 3 3 0 1 0 0 0 0 1 0Oct 15, 2011 at Michigan State L 14-28 3 3 21 3 1 2 0 0 0 0 0 0 0Oct 29, 2011 PURDUE W 36-14 3 1 7 1 0 1 0 0 1 1 0 0 0Nov 5, 2011 at Iowa L 16-24 3 3 21 3 2 1 0 0 0 0 0 0 0Nov 12, 2011 at Illinois W 31-14 2 2 14 2 2 0 0 0 0 0 0 0 0Nov 19, 2011 NEBRASKA W 45-17 2 1 7 1 1 0 0 0 1 0 0 0 0Nov 26, 2011 OHIO STATE W 40-34 3 3 17 2 2 0 1 0 0 0 0 0 0
Totals 35 24 152 20 13 7 4 0 4 3 3 1 024 of 35 (68.6%)
2011 Michigan FootballMichigan By-Quarter Statistics (as of Nov 26, 2011)
All games
3rd-Down Conversions
Date Opponent Score Overall 1st Qtr 2nd Qtr 3rd Qtr 4th Qtr Overtime
Sep 03, 2011 WESTERN MICHIGAN W 34-10 3-6 50.0 2-3 66.7 1-2 50.0 0-1 0.0Sep 10, 2011 NOTRE DAME W 35-31 3-9 33.3 0-2 0.0 0-3 0.0 1-2 50.0 2-2 100.0Sep 17, 2011 EASTERN MICHIGAN W 31-3 9-14 64.3 0-2 0.0 1-3 33.3 5-5 100.0 3-4 75.0Sep 24, 2011 SAN DIEGO STATE W 28-7 4-11 36.4 2-2 100.0 0-2 0.0 2-4 50.0 0-3 0.0Oct 1, 2011 MINNESOTA W 58-0 6-11 54.5 3-3 100.0 2-3 66.7 1-3 33.3 0-2 0.0Oct 08, 2011 at Northwestern W 42-24 14-17 82.4 4-4 100.0 1-3 33.3 5-5 100.0 4-5 80.0Oct 15, 2011 at Michigan State L 14-28 3-15 20.0 0-2 0.0 1-4 25.0 2-5 40.0 0-4 0.0Oct 29, 2011 PURDUE W 36-14 7-13 53.8 3-4 75.0 2-4 50.0 1-2 50.0 1-3 33.3Nov 5, 2011 at Iowa L 16-24 7-16 43.8 2-4 50.0 1-3 33.3 3-5 60.0 1-4 25.0Nov 12, 2011 at Illinois W 31-14 6-14 42.9 1-2 50.0 3-6 50.0 1-4 25.0 1-2 50.0Nov 19, 2011 NEBRASKA W 45-17 8-18 44.4 1-3 33.3 4-6 66.7 1-3 33.3 2-6 33.3Nov 26, 2011 OHIO STATE W 40-34 5-11 45.5 0-3 0.0 2-3 66.7 2-3 66.7 1-2 50.0
Michigan 75-155 48.4 18-34 52.9 18-42 42.9 24-42 57.1 15-37 40.5 0-0 0.0Opponents 57-158 36.1 11-33 33.3 14-43 32.6 15-34 44.1 17-48 35.4 0-0 0.0
4th-Down Conversions
Date Opponent Score Overall 1st Qtr 2nd Qtr 3rd Qtr 4th Qtr Overtime
Sep 03, 2011 WESTERN MICHIGAN W 34-10 1-1 100.0 1-1 100.0 0-0 0.0 0-0 0.0Sep 10, 2011 NOTRE DAME W 35-31 0-0 0.0 0-0 0.0 0-0 0.0 0-0 0.0 0-0 0.0Sep 17, 2011 EASTERN MICHIGAN W 31-3 0-1 0.0 0-1 0.0 0-0 0.0 0-0 0.0 0-0 0.0Sep 24, 2011 SAN DIEGO STATE W 28-7 1-1 100.0 0-0 0.0 1-1 100.0 0-0 0.0 0-0 0.0Oct 1, 2011 MINNESOTA W 58-0 0-0 0.0 0-0 0.0 0-0 0.0 0-0 0.0 0-0 0.0Oct 08, 2011 at Northwestern W 42-24 1-1 100.0 0-0 0.0 1-1 100.0 0-0 0.0 0-0 0.0Oct 15, 2011 at Michigan State L 14-28 2-4 50.0 1-1 100.0 0-0 0.0 0-0 0.0 1-3 33.3Oct 29, 2011 PURDUE W 36-14 1-2 50.0 0-0 0.0 1-1 100.0 0-1 0.0 0-0 0.0Nov 5, 2011 at Iowa L 16-24 1-2 50.0 0-0 0.0 0-0 0.0 0-0 0.0 1-2 50.0Nov 12, 2011 at Illinois W 31-14 0-1 0.0 0-0 0.0 0-1 0.0 0-0 0.0 0-0 0.0Nov 19, 2011 NEBRASKA W 45-17 1-1 100.0 0-0 0.0 0-0 0.0 1-1 100.0 0-0 0.0Nov 26, 2011 OHIO STATE W 40-34 1-2 50.0 1-1 100.0 0-0 0.0 0-1 0.0 0-0 0.0
Michigan 9-16 56.2 3-4 75.0 3-4 75.0 1-3 33.3 2-5 40.0 0-0 0.0Opponents 7-18 38.9 2-5 40.0 1-2 50.0 0-1 0.0 4-10 40.0 0-0 0.0
Time of Possession
Date Opponent Score Overall 1st Qtr 2nd Qtr 3rd Qtr 4th Qtr Overtime
Sep 03, 2011 WESTERN MICHIGAN W 34-10 18:15 7:49 6:49 3:37Sep 10, 2011 NOTRE DAME W 35-31 22:59 5:39 5:04 6:16 6:00Sep 17, 2011 EASTERN MICHIGAN W 31-3 32:15 4:25 8:43 11:36 7:31Sep 24, 2011 SAN DIEGO STATE W 28-7 30:13 5:56 7:31 9:21 7:25Oct 1, 2011 MINNESOTA W 58-0 36:22 10:33 7:25 8:17 10:07Oct 08, 2011 at Northwestern W 42-24 37:57 9:11 7:47 12:28 8:31Oct 15, 2011 at Michigan State L 14-28 29:27 8:23 6:31 6:50 7:43Oct 29, 2011 PURDUE W 36-14 36:25 10:01 9:44 8:49 7:51Nov 5, 2011 at Iowa L 16-24 30:06 8:09 6:47 8:53 6:17Nov 12, 2011 at Illinois W 31-14 32:45 10:38 10:14 7:02 4:51Nov 19, 2011 NEBRASKA W 45-17 41:13 11:16 10:14 9:21 10:22Nov 26, 2011 OHIO STATE W 40-34 35:10 8:13 7:35 9:15 10:07
Michigan Total 383:07 100:13 94:24 101:45 86:45 0:00Avg. 31:55 8:21 7:52 8:28 7:13 0:00
Opponents Total 320:18 79:47 85:36 76:40 78:15 0:00Avg. 26:41 6:38 7:08 6:23 6:31 0:00
2011 Michigan FootballMichigan - Long Plays
20-YARD PLUS PLAYSYds Type Player(s) Opponent
94* INT Herron, Brandon Western Michigan83* FR Avery, Courtney Minnesota77 Pass Hemingway, Junior from Robinson, Denard Notre Dame65 Rush Toussaint, Fitz Illinois64 Pass Gallon, Jeremy from Robinson, Denard Notre Dame59* Rush Toussaint, Fitz Purdue57 Pass Roundtree, Roy from Robinson, Denard Northwestern53* Rush Robinson, Denard San Diego State52 Rush Robinson, Denard Eastern Michigan49 Pass Roundtree, Roy from Robinson, Denard Purdue48 Pass Hemingway, Junior from Robinson, Denard Northwestern46 Rush Toussaint, Fitz Ohio State46 Pass Roundtree, Roy from Robinson, Denard Nebraska45 Pass Hemingway, Junior from Robinson, Denard Notre Dame44* Rush Shaw, Michael Western Michigan43 Rush Toussaint, Fitz Western Michigan43 INT Floyd, J.T. Illinois43* Pass Hemingway, Junior from Robinson, Denard Notre Dame42 Pass Gallon, Jeremy from Robinson, Denard Purdue41* Rush Robinson, Denard Ohio State40 Pass Koger, Kevin from Robinson, Denard Illinois39 Rush Robinson, Denard Notre Dame38* Pass Odoms, Martavious from Robinson, Denard Nebraska38 Rush Smith, Vincent Eastern Michigan37 Pass Hemingway, Junior from Robinson, Denard Western Michigan37* Rush Shaw, Michael Purdue35 Rush Toussaint, Fitz Minnesota34* Pass Roundtree, Roy from Robinson, Denard Michigan State34 Rush Robinson, Denard San Diego State33 KR Odoms, Martavious Purdue32 Pass Gallon, Jeremy from Gardner, Devin Michigan State32 Rush Smith, Vincent San Diego State32 Pass Smith, Vincent from Robinson, Denard San Diego State32 KR Odoms, Martavious Nebraska32 PR Gallon, Jeremy Illinois31* Rush Toussaint, Fitz Nebraska30 Rush Robinson, Denard San Diego State29* FR Herron, Brandon Western Michigan29 Pass Hemingway, Junior from Robinson, Denard Michigan State28 KR Odoms, Martavious Iowa28 Pass Hopkins, Stephen from Robinson, Denard Minnesota28 KR Odoms, Martavious Iowa28 Rush Robinson, Denard Purdue28 Pass Dileo, Drew from Robinson, Denard Ohio State28* Pass Smith, Vincent from Robinson, Denard Minnesota27* Pass Odoms, Martavious from Gardner, Devin Illinois27 Pass Hemingway, Junior from Robinson, Denard Northwestern27* Rush Toussaint, Fitz Illinois27 Rush Smith, Vincent Eastern Michigan27 Pass Grady, Kelvin from Robinson, Denard Notre Dame26 Rush Smith, Vincent Michigan State26 Pass Hemingway, Junior from Robinson, Denard Nebraska26 Pass Smith, Vincent from Gardner, Devin Purdue26* Pass Hemingway, Junior from Robinson, Denard Ohio State26 Pass Koger, Kevin from Robinson, Denard Ohio State25 KR Odoms, Martavious Purdue25* Pass Gallon, Jeremy from Robinson, Denard Northwestern25 KR Grady, Kelvin Western Michigan25 Rush Robinson, Denard Northwestern25 Rush Toussaint, Fitz Illinois25 Rush Rawls, Thomas Minnesota25 KR Odoms, Martavious Northwestern25 KR Odoms, Martavious Ohio State25 Rush Rawls, Thomas Minnesota25 Rush Robinson, Denard Northwestern24 KR Smith, Vincent Notre Dame24 KR Odoms, Martavious Nebraska24 Rush Toussaint, Fitz Minnesota24 Pass Gallon, Jeremy from Robinson, Denard Eastern Michigan23 Pass Gallon, Jeremy from Robinson, Denard Nebraska23 Pass Gallon, Jeremy from Robinson, Denard Purdue23 KR Odoms, Martavious Purdue22 Rush Robinson, Denard Iowa22 Rush Robinson, Denard Ohio State22 Rush Robinson, Denard Eastern Michigan22 Pass Hemingway, Junior from Robinson, Denard Northwestern
* touchdown scored on play
LONG PLAYS BY THE NUMBERSLong Plays By Yards No. TD100+ 0 090-99 1 180-89 1 170-79 1 060-69 2 050-59 4 240-49 12 330-39 16 420-29 50 8
Long Plays By Type No. TDRushing 30 7Passing 34 9Punt returns 3 0Kick returns 16 0Interceptions 2 1Fumble returns 2 2Other 0 0TOTAL 87 19
20-YARD PLUS BY PLAYERPlayer No. TD R P KR PR IR FROdoms, Martavious 12 3 0 3 9 0 0 0Smith, Vincent 12 2 4 4 4 0 0 0Robinson, Denard 12 2 12 0 0 0 0 0Hemingway, Junior 11 2 0 11 0 0 0 0Gallon, Jeremy 11 1 0 7 1 3 0 0Toussaint, Fitz 10 3 10 0 0 0 0 0Roundtree, Roy 4 1 0 4 0 0 0 0Grady, Kelvin 3 0 0 1 2 0 0 0Shaw, Michael 2 2 2 0 0 0 0 0Herron, Brandon 2 2 0 0 0 0 1 1Koger, Kevin 2 0 0 2 0 0 0 0Rawls, Thomas 2 0 2 0 0 0 0 0Avery, Courtney 1 1 0 0 0 0 0 1Dileo, Drew 1 0 0 1 0 0 0 0Floyd, J.T. 1 0 0 0 0 0 1 0Hopkins, Stephen 1 0 0 1 0 0 0 0TOTAL 87 19 30 34 16 3 2 2
LONGEST PLAYS OF THE YEARRushing65 Toussaint, Fitz vs Illinois (11/12/2011)Rushing Touchdown59 Toussaint, Fitz vs Purdue (10/29/2011)Passing77 Hemingway, Junior from Robinson, Denard
vs Notre Dame (9/10/2011)Passing Touchdown43 Hemingway, Junior from Robinson, Denard
vs Notre Dame (9/10/2011)Punt Return32 Gallon, Jeremy vs Illinois (11/12/2011)Kick Return33 Odoms, Martavious vs Purdue (10/29/2011)Interception Return94 Herron, Brandon vs Western Michigan (9/3/2011)Fumble Return83 Avery, Courtney vs Minnesota (10/1/2011)Punt51 Wile, Matt vs San Diego State (9/24/2011)Field Goal43 Gibbons, Brendan vs Ohio State (11/26/2011)
Yds Type Player(s) Opponent22 KR Smith, Vincent Notre Dame21 KR Smith, Vincent Notre Dame21* Pass Smith, Vincent from Robinson, Denard Notre Dame21 PR Gallon, Jeremy Notre Dame21 PR Gallon, Jeremy San Diego State20 KR Grady, Kelvin Western Michigan20 Rush Toussaint, Fitz Ohio State20 Pass Hemingway, Junior from Gardner, Devin Illinois20* Pass Odoms, Martavious from Robinson, Denard Ohio State20 KR Smith, Vincent Notre Dame20 KR Gallon, Jeremy Ohio State
M I C H I G A N S I N G L E G A M E B E S T S INdIvIduAL GAME HIGHS
Rushing Attempts: 29, Fitzgerald Toussaint vs. Nebraska (Nov. 19)Rushing Yards: 200, Denard Robinson vs. San Diego State (Sept. 24)Rushing Tds: 3, Denard Robinson vs. San Diego State (Sept. 24)Pass Attempts: 37, Denard Robinson at Iowa (Nov. 5)Pass Completions: 17, Denard Robinson at Northwestern (Oct. 8) 17, Denard Robinson at Iowa (Nov. 5)Passing Yards: 338, Denard Robinson vs. Notre Dame (Sept. 10)Passing Tds: 4, Denard Robinson vs. Notre Dame (Sept. 10)Receptions: 5, Junior Hemingway vs. Minnesota (Oct. 1) 5, Hemingway at Northwestern (Oct. 8) 5, Jeremy Gallon at Northwestern (Oct. 8) 5, Hemingway at Iowa (Nov. 5)Receiving Yards: 165, Junior Hemingway vs. Notre Dame (Sept. 10)Receiving Tds: 1, 20 timesTotal Plays: 51, Denard Robinson at Northwestern (Oct. 8)Total Yards: 454, Denard Robinson at Northwestern (Oct. 8)Points Kicking: 16, Brendan Gibbons vs. Minnesota (Oct. 1)Field Goals Made: 3, Brendan Gibbons vs. Minnesota (Oct. 1)Field Goals Attempted: 3, Brendan Gibbons vs. Minnesota (Oct. 1)PATs Attempted: 7, Brendan Gibbons vs. Minnesota (Oct. 1)PATs Made: 7, Brendan Gibbons vs. Minnesota (Oct. 1)Punting Attempts: 7, Will Hagerup at Michigan State (Oct. 15)Punting Yards: 223, Will Hagerup at Michigan State (Oct. 15)Punting Average: 49.0, Matt Wile vs. San Diego State (Sept. 24)Punt Returns: 4, Jeremy Gallon, at Illinois (Nov. 12)/ vs. Nebraska (Nov. 19)Punt Return Yards: 62, Jeremy Gallon at Illinois (Nov. 12)Kickoff Returns: 5, Vincent Smit vs. Notre Dame (Sept. 10)Kickoff Return Yards: 98, Vincent Smith vs. Notre Dame (Sept. 10)Interceptions: 1, eight times, last Avery vs. Ohio State (Nov. 26)Interception Yards: 94, Brandon Herron vs. Western Michigan (Sept. 3)Tackles: 12, Kenny Demens vs. Notre Dame (Sept. 10)Solo Tackles: 8, Kenny Demens vs. Notre Dame (Sept. 10)Tackles for Loss: 3.0, Ryan Van Bergen at Illinois (Nov. 12)Tackles for Loss Yardage: 28, Ryan Van Bergen at Illinois (Nov. 12)Sacks: 2.5, Ryan Van Bergen at Illinois (Nov. 12)Sack Yardage: 27, Ryan Van Bergen at Illinois (Nov. 12)Pass Breakups: 2, Blake Countess vs. Minnesota (Oct. 1) 2, J.T. Floyd vs. Purdue (Oct. 29) 2, J.T. Floyd at Illinois (Nov. 12)
TEAM GAME HIGHS
Rushing Attempts: 61 vs. Nebraska (Nov. 19)Rushing Yards: 376, vs. Eastern Michigan (Sept. 17)Rushing Tds: 4 vs. San Diego State (Sept. 24) 4 at Northwestern (Oct. 8) 4 vs. Purdue (Oct. 29) 4 vs. Nebraska (Nov. 19)Yards Per Rush: 7.6, vs. Minnesota (Oct. 1)Passing Attempts: 38, at Iowa (Nov. 5)Passing Completions: 19 at Northwestern (Oct. 8)Passing Yards: 362 at Northwestern (Oct. 8)Passing Tds: 4 vs. Notre Dame (Sept. 10)Yards Per Completion: 30.7 vs. Notre Dame (Sept. 10)Total Plays: 80 vs. Nebraska (Nov. 19)Total Yards: 580 vs. Minnesota (Oct. 1)Yards Per Play: 9.0 vs. Notre Dame (Sept. 10)Points: 58 vs. Minnesota (Oct. 1)Touchdowns Scored: 7 vs. Minnesota (Oct. 1)Field Goals Attempted: 3 vs. Minnesota (Oct. 1)Field Goals Made: 3 vs. Minnesota (Oct. 1)PATs Attempted: 7 vs. Minnesota (Oct. 1)PATs Made: 7 vs. Minnesota (Oct. 1)Punting Attempts: 7, at Michigan State (Oct. 15)Punting Yards: 223, at Michigan State (Oct. 15) Punting Average: 49.0 vs. San Diego State (Sept. 24)Punt Return Attempts: 5 vs. Nebraska (Nov. 19)Punt Return Yards: 62, at Illinois (Nov. 12)Kickoff Return Attempts: 5 vs. Notre Dame (Sept. 10)/ at Iowa (Nov. 5)Kickoff Return Yards: 98 vs. Notre Dame (Sept. 10)Interceptions: 2 vs. Notre Dame (Sept. 10)Interception Yards: 94 vs. Western Michigan (Sept. 3)Turnovers Gained: 5 vs. Notre Dame (Sept. 10)Turnovers Lost: 4 vs. San Diego State (Sept. 24)Sacks: 4 at Northwestern (Oct. 8)/ vs. Purdue (Oct. 29)/ at Illinois (Nov. 12)/ vs. Ohio State (Nov. 26)Sacks Against: 7, at Michigan State (Oct. 15) First downs: 32 vs. Minnesota (Oct. 1)Penalties: 9 vs. Notre Dame (Sept. 10)Penalty Yards: 82 vs. Notre Dame (Sept. 10)
MICHIGAN FOOTBALL STATISTICAL FILES PAGE 4
O P P O N E N T S I N G L E G A M E B E S T S
INdIvIduAL GAME HIGHS
Rushing Attempts: 29, Marcus Coker at Iowa (Nov. 5) Rushing Yards: 167, Edwin Baker at Michigan State (Oct. 15) Rushing Tds: 2, Marcus Coker at Iowa (Nov. 5)Pass Attempts: 48, Ryan Lindley vs. San Diego State (Sept. 24)Pass Completions: 32, Dan Persa at Northwestern (Oct. 8)Passing Yards: 331, Dan Persa at Northwestern (Oct. 8)Passing Tds: 3, Tommy Rees vs. Notre Dame (Sept. 10)Receptions: 13, Michael Floyd vs. Notre Dame (Sept. 10)Receiving Yards: 119, Jordan White vs. Western Michigan (Sept. 3)Receiving Tds: 2, twice, last Keshawn Martin at Michigan State (Oct. 15)Total Plays: 53, Dan Persa at Northwestern (Oct. 8)Total Yards: 335, Braxton Miller vs. Ohio State (Nov. 26)Points Kicking: 10, Drew Basil vs. Ohio State (Nov. 26)Field Goals Made: 2, Drew Basil vs. Ohio State (Nov. 26)Field Goals Attempted: 2, twice, last Drew Basil vs. Ohio State (Nov. 26)PATs Attempted: 4, three times, last D. Basil vs. Ohio State (Nov. 26)PATs Made: 4, three times, last D. Basil vs. Ohio State (Nov. 26) Punting Attempts: 10, Dan Orseske vs. Minnesota (Oct. 1)Punting Yards: 374, Justin DuVernois at Illinois (Nov. 12)Punting Average: 46.7, B. Williams at Northwestern (Oct. 8)Punt Returns: 3, John Goodman vs. Notre Dame (Sept. 10)Punt Return Yards: 28, Michah Hyde at Iowa (Nov. 5)Kickoff Returns: 6, Dervon Wallace vs. Western Michigan (Sept. 3)Kickoff Return Yards: 188, Dervon Wallace vs. Western Michigan (Sept. 3)Interceptions: 2, I. Campbell at Northwestern (Oct. 8)Interception Yards: 43, I. Campbell at Northwestern (Oct. 8)Tackles: 17, Lavonte David vs. Nebraska (Nov. 19)Solo Tackles: 14 Lavonte David vs. Nebraska (Nov. 19)Tackles for Loss: 3, Jonathan Brown at Illinois (Nov. 12)Tackles for Loss Yardage: 17, Tyler Nielsen at Iowa (Nov. 5)Sacks: 1.5, Denicos Allen at Michigan State (Oct. 15)Sack Yardage: 16, Tyler Nielsen at Iowa (Nov. 5)Pass Breakups: 3, Broderick Binns at Iowa (Nov. 5)
TEAM GAME HIGHS
Rushing Attempts: 39 at Michigan State (Oct. 15)Rushing Yards: 213 at Michigan State (Oct. 15) Rushing Tds: 3 at Northwestern (Oct. 8)Yards Per Rush: 6.0 vs. Notre Dame (Sept. 10)Passing Attempts: 48 vs. San Diego State (Sept. 24)Passing Completions: 32 at Northwestern (Oct. 8)Passing Yards: 331 at Northwestern (Oct. 8)Passing Tds: 3 vs. Notre Dame (Sept. 10)Yards Per Completion: 16.8 vs. Ohio State (Nov. 26)Total Plays: 77 vs. San Diego State (Sept. 24)Total Yards: 513 vs. Notre Dame (Sept. 10)Yards Per Play: 7.1 vs. Notre Dame (Sept. 10)Points: 34 vs. Ohio State (Nov. 26) Touchdowns Scored: 4 vs. Notre Dame (Sept. 10)/ at Michigan State (Oct. 15)/ vs. Ohio State (Nov. 26)Field Goals Attempted: 2, three times, last vs. Ohio State (Nov. 26)Field Goals Made: 2 vs. Ohio State (Nov. 26)PATs Attempted: 4 vs. Notre Dame (Sept. 10)/ at Michigan State (Oct. 15)/ vs. Ohio State (Nov. 26)PATs Made: 4 vs. Notre Dame (Sept. 10)/ at Michigan State (Oct. 15)/ vs. Ohio State (Nov. 26)Punting Attempts: 10 vs. Minnesota (Oct. 1)Punting Yards: 374 at Illinois (Nov. 12)Punting Average: 46.7 at Northwestern (Oct. 8)Punt Return Attempts: 3 vs. Notre Dame (Sept. 10)Punt Return Yards: 28, at Iowa (Nov. 5)Kickoff Return Attempts: 7 vs. Minnesota (Oct. 1)Kickoff Return Yards: 188 vs. Western Michigan (Sept. 3)Interceptions: 3 at Northwestern (Oct. 8)Interception Yards: 67 at Northwestern (Oct. 8)Turnovers Gained: 4 vs. San Diego State (Sept. 24)Turnovers Lost: 5 vs. Notre Dame (Sept. 10)Sacks: 7, at Michigan State (Oct. 15)Sacks Against: 4 at Northwestern (Oct. 8)/ vs. Purdue (Oct. 29) / at Illinois (Nov. 12)First downs: 28 vs. Notre Dame (Sept. 10)Penalties: 13 at Michigan State (Oct. 15) Penalty Yards: 124 at Michigan State (Oct. 15)
MICHIGAN FOOTBALL STATISTICAL FILES PAGE 5
2011 MICHIGAN SCORING dRIvES
OPPONENT PLAYS YARdS TOP RESuLT QTR PLAYWestern Michigan 16 76 8:33 TD 2 Fitzgerald Toussaint 1 yd run (Brendan Gibbons kick)Western Michigan TD 2 Brandon Herron 94 yd int. return (Brendan Gibbons kick)Western Michigan 9 74 4:17 TD 2 Fitzgerald Toussaint 2 yd run (Brendan Gibbons kick blocked)Western Michigan TD 3 Brandon Herron 29 yd fumble rec. (Brendan Gibbons kick)Western Michigan 3 87 0:40 TD 3 Michael Shaw 44 yd run (Brendan Gibbons kick)Notre Dame 2 45 0:48 TD 2 Junior Hemingway 43 yd pass from Denard Robinson (Brendan Gibbons kick)Notre Dame 4 83 2:19 TD 4 Denard Robinson 1 yd run (Brendan Gibbons kick)Notre Dame 5 40 2:35 TD 4 Jeremy Gallon 14 yd pass from Denard Robinson (Brendan Gibbons kick)Notre Dame 5 58 1:04 TD 4 Vincent Smith 21 yd pass from Denard Robinson (Brendan Gibbons kick)Notre Dame 3 80 0:30 TD 4 Roy Roundtree 16 yd pass from Denard Robinson (Brendan Gibbons kick)Eastern Michigan 7 97 3:43 TD 2 Kevin Koger 9 yd pass from Denard Robinson (Brendan Gibbons kick)Eastern Michigan 6 87 2:24 TD 2 Denard Robinson 11 yd run (Brendan Gibbons kick)Eastern Michigan 13 83 5:43 TD 3 Fitzgerald Toussaint 1 yd run (Brendan Gibbons kick)Eastern Michigan 11 75 5:53 TD 3 Drew Dileo 19 yd pass from Denard Robinson (Brendan Gibbons kick)Eastern Michigan 13 84 6:14 FG 4 Brendan Gibbons 21 yd field goalSan Diego State 6 61 2:43 TD 1 Denard Robinson 5 yd run (Brendan Gibbons kick)San Diego State 3 61 0:50 TD 1 Denard Robinson 53 yd run (Brendan Gibbons kick)San Diego State 12 81 5:57 TD 2 Denard Robinson 1 yd run (Brendan Gibbons kick)San Diego State 4 57 1:44 TD 4 Vincent Smith 7 yd run (Brendon Gibbons kick)Minnesota 7 80 3:35 TD 1 Vincent Smith 3 yd run (Brendan Gibbons kick)Minnesota 6 75 3:01 TD 1 Denard Robinson 9 yd run (Brendan Gibbons kick)Minnesota 9 85 4:05 TD 2 Drew Dileo 17 yd pass from Vincent Smith (Brendan Gibbons kick)Minnesota 4 69 2:25 TD 2 Vincent Smith 28 yd pass from Denard Robinson (Brendan Gibbons kick)Minnesota 5 29 2:30 FG 2 Brendan Gibbons 25 yd field goalMinnesota 10 56 2:22 TD 2 Kevin Koger 18 yd pass from Denard Robinson (Brendan Gibbons kick)Minnesota 5 54 2:23 TD 3 Fitzgerald Toussaint 1 yd run (Brendan Gibbons kick)Minnesota 9 38 4:17 FG 3 Brendan Gibbons 32 yd field goalMinnesota 10 58 5:28 FG 4 Brendan Gibbons 38 yd field goalMinnesota TD 4 Courtney Avery 83 yd fumble rec. (Brendan Gibbons kick)Northwestern 8 74 3:34 TD 1 Steve Watson 9 yd pass from Denard Robinson (Brendan Gibbons kick)Northwestern 8 67 4:11 TD 2 Jeremy Gallon 25 yd pass from Denard Robinson (Brendan Gibbons kick)Northwestern 8 80 4:08 TD 3 Denard Robinson 2 yd run (Brendan Gibbons kick)Northwestern 12 80 6:29 TD 3 Devin Gardner 1 yd run (Brendan Gibbons kick)Northwestern 6 47 1:56 TD 4 Michael Shaw 2 yd run (Brendan Gibbons kick)Northwestern 9 53 4:43 TD 4 Denard Robinson 5 yd run (Brendan Gibbons kick)Michigan St. 10 80 6:10 TD 1 Denard Robinson 15 yd run (Brendan Gibbbons kick)Michigan St. 1 34 0:07 TD 4 Roy Roundtree 34 yd pass from Denard Robinson (Brendan Gibbons kick)Purdue 12 70 6:06 TD 1 Denard Robinson 2 yd run (Brendan Gibbons kick)Purdue Safety 2 Mike Martin safetyPurdue 5 25 2:44 FG 2 Brendan Gibbons 37 yd field goalPurdue 5 83 2:56 TD 2 Fitzgerald Toussaint 2 yd run (Brendan Gibbons kick)Purdue 11 47 3:17 FG 2 Brendan Gibbons 22 yd field goalPurdue 4 80 2:13 TD 3 Fitzgerald Toussaint 59 yd run (Brendan Gibbons kick)Purdue 7 86 3:30 TD 4 Michael Shaw 37 yd run (Brendan Gibbons kick)Iowa 12 61 5:33 TD 1 Fitzgerald Toussaint 5 yd pass from Denard Robinson (PAT failed) Iowa 10 45 5:17 FG 3 Brendan Gibbons 32 yd field goalIowa 8 57 2:49 TD 4 Kevin Koger 7 yd pass from Denard Robinson (Brendan Gibbons kick)Illinois 4 80 1:45 TD 1 Denard Robinson 9 yd run (Brendan Gibbons kick)Illinois 7 41 3:59 TD 2 Denard Robinson 2 yd run (Brendan Gibbons kick)Illinois 7 23 2:52 FG 3 Brendan Gibbons 27 yd field goalIllinois 3 22 0:54 TD 4 Martavious Odoms 27 yd pass from Devin Gardner (Brendan Gibbons kick)Illinois 2 40 0:48 TD 4 Fitzgerald Toussaint 27 yd run (Brendan Gibbons kick)Nebraska 8 79 4:01 TD 1 Jeremy Gallon 6 yd pass from Denard Robinson (Brendan Gibbons kick)Nebraska 9 30 4:20 FG 1 Brendan Gibbons 42 yd field goalNebraska 12 74 6:07 TD 2 Denard Robinson 14 yd run (Brendan Gibbons kick)Nebraska 7 33 3:29 TD 3 Denard Robinson 1 yd run (Brendan Gibbons kick)Nebraska 8 50 3:29 TD 3 Fitzgerald Toussaint 1 yd run (Brendan Gibbons kick)Nebraska 10 86 5:46 TD 4 Martavious Odoms 38 yd pass from Denard Robinson (Brendan Gibbons kick)Nebraska 1 31 0:08 TD 4 Fitzgerald Toussaint 31 yd run (Brendan Gibbons kick)Ohio St. 2 47 0:35 TD 1 Denard Robinson 41 yd run (Brendan Gibbons kick)Ohio St. Safety 1 TEAM SafetyOhio St. 8 52 3:02 TD 1 Junior Hemingway 26 yd pass from Denard Robinson (Brendan Gibbons kick)Ohio St. 9 80 4:35 TD 2 Denard Robinson 6 yd run (Brendan Gibbons kick)Ohio St. 11 80 5:55 TD 3 Martavious Odoms 20 yd pass from Denard Robinson (Brendan Gibbons kick)Ohio St. 8 75 4:18 TD 4 Kevin Koger 4 yd pass from Denard Robinson (Brendan Gibbons kick)Ohio St. 11 54 5:10 FG 4 Brendan Gibbons 43 yd field goal
MICHIGAN OFFENSIvE SCORING dRIvE ANALYSISCategory Minus 0-9 10-19 20-29 30-39 40-49 50-59 60-69 70-79 80-89 90-99Michigan TD 0 0 0 1 3 6 8 5 9 18 1Michigan FG 0 0 0 3 2 2 2 0 0 1 0
Longest drives:Plays: 16, vs. Western Michigan (Sept. 3)Yards: 97, vs. Eastern Michigan (Sept. 17)Time of Possession: 8:33, vs. Western Michigan (Sept. 3)
2 0 1 1 M I C H I G A N S C O R I N G D R I V E S / P L A Y S
MICHIGAN FOOTBALL STATISTICAL FILES PAGE 6
2011 OPPONENT SCORING dRIvES
OPPONENT PLAYS YARdS TOP RESuLT QTR PLAYWestern Michigan 15 74 7:11 TD 1 Antoin Sciven 1 yd run (John Potter kick)Western Michigan 7 43 1:06 FG 2 John Potter 36 yd FGNotre Dame 7 57 3:46 TD 1 Theo Riddick 7 yd pass from Tommy Rees (David Ruffer kick)Notre Dame 10 83 5:35 TD 1 Cierre Wood 4 yd runNotre Dame 8 29 2:53 FG 2 David Ruffer 38 yd FGNotre Dame 7 71 3:55 TD 3 TJ Jones 15 yd pass from Tommy ReesNotre Dame 4 61 0:42 TD 4 Theo Riddick 29 yd pass from Tommy ReesEastern Michigan 7 20 3:20 FG 2 Kody Fulkerson 21 yd field goalSan Diego State 6 38 2:28 TD 3 Colin Lockett 16 yd pass from Ryan Lindley (Abelardo Perez kick)Northwestern 6 80 2:05 TD 1 Kain Colter 15 yd run (Jeff Budzien kick)Northwestern 8 63 3:13 TD 1 Treyvon Green 7 yd run (Jeff Budzien kick)Northwestern 7 82 1:52 TD 2 Adonis Smith 2 yd run (Jeff Budzien kick)Northwestern 7 49 1:05 FG 2 Jeff Budzien 20 yd field goalMichigan St. 9 63 3:37 TD 1 Edwin Baker 1 yd run (Dan Conroy kick)Michigan St. 9 54 3:49 TD 3 Keshawn Martin 10 yd pass from Kirk Cousins (Dan Conroy kick)Michigan St. 10 61 4:08 TD 3 Keshawn Martin 13 yd pass from Kirk Cousins (Dan Conroy kick)Michigan St. TD 4 Isaiah Lewis 39 yd interception return (Dan Conroy kick)Purdue 5 67 1:24 TD 1 Gary Bush 48 yd pass from Caleb TerBush (Carson Wiggs kick)Purdue 6 48 1:37 TD 4 O.J. Ross 19 yd pass from Robert Marve (Carson Wiggs kick)Iowa 6 76 3:01 TD 1 Marcus Coker 4 yd run (Mike Meyer kick)Iowa 11 78 5:15 TD 2 Brad Herman 1 yd pass from James Vandenberg (Mike Meyer kick)Iowa 4 7 1:56 FG 2 Mike Meyer 42 yd field goalIowa 11 62 5:27 TD 4 Marcus Coker 13 yd run (Mike Meyer kick)Illinois 11 75 4:12 TD 3 Nathan Scheelhaase 13 yd run (Derek Dimke kick)Illinois 18 80 6:46 TD 4 Jason Ford 1 yd run (Derek Dimke kick)Nebraska 3 65 0:46 TD 1 Brandon Kinnie 54 yd pass from Taylor Martinez (Brett Maher kick)Nebraska 4 1 1:29 FG 2 Brett Maher 51 yd field goalNebraska 7 31 1:41 TD 3 Ameer Abdullah 3 yd run (Brett Maher kick)Ohio St. 6 80 2:17 TD 1 Corey Brown 54 yd pass from Braxton Miller (Drew Basil kick)Ohio St. 10 42 4:15 FG 2 Drew Basil 45 yd field goalOhio St. 3 31 1:15 TD 2 Braxton Miller 19 yd run (Drew Basil kick)Ohio St. 6 66 1:55 TD 2 DeVier Posey 43 yd pass from Braxton Miller (Drew Basil kick)Ohio St. 6 28 3:20 FG 4 Drew Basil 21 yd field goalOhio St. 5 80 1:23 TD 4 Dan Herron 4 yd run ((Drew Basil kick)
OPPONENT SCORING dRIvE ANALYSISCategory Minus 0-9 10-19 20-29 30-39 40-49 50-59 60-69 70-79 80-89 90-99Opponent TD 0 0 0 0 3 1 2 8 5 6 0Opponent FG 0 2 0 3 0 3 0 0 0 0 0
Longest drives:Plays: 18, Illinois (Nov. 12)Yards: 83, Notre Dame (Sept. 10)Time of Possession: 7:11, Western Michigan (Sept. 3)
2 0 1 1 O P P O N E N T S C O R I N G D R I V E S / P L A Y S
MICHIGAN FOOTBALL STATISTICAL FILES PAGE 7
MICHIGAN WEEK-BY-WEEK LEAdERSOpponent Rushes Rushing Yards Receptions Receiving Yards Tackles TFLs SacksWestern Michigan 11, Toussaint 80, Toussaint 2, Koger/Gallon/Roundtree 37, Hemingway 10, Kovacs 2.0, Kovacs 2.0, KovacsNotre Dame 16, D. Robinson 108, D. Robinson 3, Hemingway 165, Hemingway 12, Demens 1.0, Many -- Eastern Michigan 26, D. Robinson 198, D. Robinson 3, Gallon 43, Gallon 10, Hawthorne 1.0, Many 1.0, RohSan Diego State 21, D. Robinson 200, D. Robinson 3 Smith 44, Smith 7, Many 2.0, Roh 1.0, Roh Minnesota 11, Toussaint 108, Toussaint 5, Hemingway 56, Hemingway 5, Many 1.0, Many 1.0, Black, Van Bergen, Ryanat Northwestern 25, D. Robinson 117, D. Robinson 5, Hemingway/Gallon 124, Hemingway 10, Demens 2.0, Kovacs 1.0, Demens, Kovacs, Campbell at Michigan State 18, D. Robinson 42, D. Robinson 4, Roundtree 66, Roundtree 8, T. Gordon 2.0, Roh/Heininger -- Purdue 20, Toussaint 170, Toussaint 3, Gallon 79, Gallon 9, D. Morgan 2.0, Martin 2.0, Martin at Iowa 16, Toussaint 58, Toussaint 5, Hemingway 64, Hemingway 11, Demens 1.5, Martin 1.0, Roh, Heininger at Illinois 27, Toussaint 192, Toussaint 3, Hemingway 46, Odoms 9, Martin 3.0, Van Bergen 2.5, Van Bergen Nebraska 29, Toussaint 138, Toussaint 3, Gallon 47, Odoms 7, Kovacs 2.0, Van Bergen 1.0, Campbell, Van Bergen Ohio State 26, Robinson 170, Robinson 4, Koger 45, Hemingway 10, Morgan 2.0, Van Bergen/Kovacs 1.0, Morgan, Kovacs
MICHIGAN (FORCEd 27)
How obtained Qtr Player Plays/Yards First downs ConclusionWestern Michigan (3)Interception 2 Carder by Herron Touchdown; Herron 94-yard touchdown returnFumble 3 Herron Touchdown, Herron 29-yard touchdown returnFumble 3 Van Bergen 4/51 2 End of Game (Called due to weather)Notre dame (5)Interception 2 Rees by Kovacs 2/45 Touchdown, Hemingway 43-yard touchdown pass from RobinsonInterception 2 Rees by Floyd 3/-1 0 PuntFumble 3 Campbell 4/14 1 InterceptionFumble 4 Van Bergen 3/61 2 InterceptionFumble 4 T.Robinson End of HalfEastern Michigan (2)Fumble 1 T.Gordon 7/31 2 InterceptionInterception 2 Gillett by T.Gordon 7/97 2 Touchdown, Koger 9-yard touchdown pass from RobinsonSan diego State (3)Fumble 1 T.Gordon 3/61 1 Touchdown, D.Robinson 53-yard runFumble 3 J.Ryan 11/70 3 Missed FGFumble 4 J.Ryan 3/-1 0 PuntMinnesota (2)Fumble 2 Countess 10/56 3 Touchdown, Koger 18-yard touchdown pass from RobinsonNorthwestern (2)Interception 3 Persa by Hawthorne 6/47 3 Touchdown, Shaw 2-yard runFumble 4 T.Gordon 7/28 1 Missed FGMichigan State (2)Fumble 3 Morgan 3/-5 0 PuntFumble 4 Kovacs 8/13 1 Turnover on DownsPurdue (1)Interception 2 TerBush by Avery 5/83 2 Touchdown, Toussaint 2 yd runIowa (0)Illinois (3)Fumble 2 T.Gordon 3/(-17) 0 FumbleFumble 3 McColgan 7/23 1 27-yard Gibbons field goalInterception 4 Scheelhaase by Floyd 3/22 1 Touchdown, Odoms 27 yd touchdown pass from Gardner Nebraska (3)Fumble 3 Avery 7/33 3 TouchdownFumble 4 JB Fitzgerald 4/(-3) 0 Missed FGFumble 4 Van Bergen 1/31 1 Touchdown, Fitzgerald 31 yd runOhio State (1)Interception 4 Miller by Avery 1/(-2) 0 End of Game
OPPONENT (FORCEd 21)
How obtained Qtr Player Plays/Yards First downs ConclusionWestern Michigan (0) -- -- -- -- --Notre dame (3) Interception 2 Robinson by Gray 3/2 0 PuntInterception 3 Robinson by Motta 7/71 4 Touchdown; TJ Jones 15 yard touchdown pass from ReesInterception 4 Robinson by Blanton 3/7 0 PuntEastern Michigan (1)Interception 1 Robinson by Scott 10/72 3 Turnover on downsSan diego State (4)Fumble 1 N.Tenhaeff 3/4 0 PuntInterception 3 Robinson by Parker 3/-7 0 PuntInterception 3 Robinson by Berhe 3/32 0 FumbleFumble 3 Parker 6/48 2 TouchdownMinnesota (0) Northwestern (3)Interception 1 Robinson by Campbell 8/63 4 Touchdown, Green 7-yard runInterception 2 Robinson by Campbell 6/18 1 PuntInterception 2 Robinson by Peters 7/49 3 Jeff Budzien 20-yard field goalMichigan State (1) Interception 4 Robinson by Lewis 39 yd interception touchdown return Purdue (2)Interception 1 Robinson by Holland 3/8 0 PuntInterception 2 Gardner by Johnson 1/-5 0 Safety by MartinIowa (2)Fumble 2 Nielsen 4/7 0 Field GoalInterception 2 Robinson by Kirskey 2/-1 0 HalftimeIllinois (3)Fumble 1 Onyegbule 3/4 0 PuntFumble 2 Wilson 3/(-14) 0 PuntInterception 2 Robinson by Wilson 0/0 0 HalftimeNebraska (1)Interception 2 Robinson by Moore 4/1 0 Brett Maher 51 yd field goalOhio State (1)Fumble 2 Howard 3/31 2 Touchdown, Miller 19-yd run
MICHIGAN FOOTBALL STATISTICAL FILES PAGE 8
T U R N O V E R C H A R T
Nate allspach #40 • Tight End6-6 • 224 • So./Fr.Grand Rapids, Mich.Grandville HS
Sophomore/Freshman (2011) ... has not seen game action.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Grandville High School.
Personal ... enrolled in the College of Literature, Science and the Arts, major undeclared.
toNy aNdersoN ***#17 • Cornerback5-11 • 195 • 5th-Sr.Redondo Beach, Calif.Redondo Union HS
At Michigan ... three-year letterman ... played in 23 games ... registered seven tackles.
Fifth-Year Senior (2011) ... appeared in one game on special teams ... NORTHWESTERN (Oct. 8) ... honorary senior game captain ... SAN DIEGO STATE (Sept. 24) ... Made season debut on special teams.
Senior/Junior (2010) ... earned third varsity letter ... appeared in 11 games ... played four contests at cornerback ... registered four tackles ... did not see game action in the opener vs. Connecticut (Sept. 4) ... made season debut on special teams units at Notre Dame (Sept. 11) ... contributed on kickoff cov-erage unit vs. Massachusetts (Sept. 18) ... assisted on a tackle at cornerback vs. Bowling Green (Sept. 25) ... played on kickoff coverage units against Indiana (Oct. 2), Michigan State (Oct. 9) and Iowa (Oct. 16) ... did not play vs. Penn State (Oct. 30) ... made one solo tackle as a reserve cornerback and on special teams vs. Illinois (Nov. 6) ... tallied two solo tackles on special teams against Purdue (Nov. 13) ... saw game action as a reserve cornerback and on special teams vs. Wisconsin (Nov. 20) ... contributed on spe-cial teams at Ohio State (Nov. 27) ... saw game action at cornerback and on special teams vs. Mississippi State (Jan. 1) in Gator Bowl.
Junior/Sophomore (2009) ... earned second var-sity letter ... played in six games ... contributed two assisted tackles ... saw first action of the season at cornerback and on special teams vs. Delaware State (Oct. 17) ... participated on special teams vs. Penn State (Oct. 24) ... assisted on a tackle on kickoff coverage at Illinois (Oct. 31) ... appeared on special teams vs. Purdue (Nov. 7) ... assisted on one special teams stop at Wisconsin (Nov. 14) ... played on spe-cial teams vs. Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... earned first var-sity letter ... played in five games ... made career debut vs. Michigan State (Oct. 25), playing on punt return unit ... contributed on special team units at Purdue (Nov. 1) and Minnesota (Nov. 8) ... played special teams vs. Northwestern (Nov. 15) ... saw spe-cial teams action at Ohio State (Nov. 22).
Prep ... attended Redondo Union High School (2007) ... Honors and Rankings ... two-year letterman
in football ... selected team’s most valuable player as a senior ... earned first-team All-CIF at wide receiver following senior year ... received all-league honors at wide receiver and all-area as a defensive back as a senior ... Other Sports ... ran track for four years ... received all-league honors his freshman year.
Personal ... Tony Michael Anderson was born July 7, 1989 ... enrolled in the College of Literature, Science and the Arts, majoring in Arab, Armenian, Persian, Turkish & Islamic studies with a minor in Applied Statistics.
Tony Anderson’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2008 5/0 0-0-0 0-0 0-0 0-0 0-0 02009 6/0 0-2-2 0-0 0-0 0-0 0-0 02010 11/0 3-1-4 0-0 0-0 0-0 0-0 02011 1/0 0-0-0 0-0 0-0 0-0 0-0 0Career 23/0 3-3-6 0-0 0-0 0-0 0-0 0
richard ash #54 • Defensive Tackle6-3 • 301 • So./Fr.Pahokee, Fla.Pahokee HS
Sophomore/Freshman (2011) ... appeared in two games; played two games as a reserve nose tackle, one game on special teams ... PURDUE (Oct. 29) ... played nose tackle ... MINNESOTA (Oct. 1) ... made collegiate debut as a reserve nose tackle.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Pahokee High School (2010) coached by Donald Thompson ... three-year varsity letterman ... ran 40-yard dash in 4.85 seconds ... Key Statistics ... registered 45 tackles, 13 tackles for loss, four sacks and recovered two fumbles as a senior ... recorded 84 tackles, seven TFLs, five sacks, one interception, five forced fumbles and two fumble recoveries junior year ... made 15 tackles, three TFLs, two sacks and one fumble recovery as a sophomore ... Honors and Rankings ... four-star prospect and the nation’s No. 25 defensive tackle according to Rivals.com ... rated as the 45th-best player in the state of Florida by Rivals.com ... three-star prospect and the No. 54 defensive tackle nationally according to scout.com ... rated as the No. 100 player in Florida by SuperPrep ... three-star and the nation’s No. 54 defensive tackle according to Scouts, Inc. ... played in the Outback Bowl All-Star game ... earned all-county honors as a senior ... MaxPreps Small School All-American second team as a senior.
Personal ... Richard Ash was born Aug. 4, 1992 ... enrolled in the College of Literature, Science, and the Arts, major undeclared ... attended same high school as current Wolverines Brandin Hawthorne, Martavious Odoms and Vincent Smith.
Richard Ash’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 0/0 0-0-0 0-0 0-0 0-0 0-0 02011 2/0 0-0-0 0-0 0-0 0-0 0-0 0Career 2/0 0-0-0 0-0 0-0 0-0 0-0 0
courtNey avery * #5 • Cornerback5-11 • 173 • So.Mansfield, OhioLexington HS
At Michigan ... one-year letterman ... seven career starts ... tied Michigan record for longest fumble return for a touchdown (83) yards vs. Minnesota (10/1/11).
Sophomore (2011) ... has played in all 12 games; 11 at cornerback, making two starts (Western Michigan, Notre Dame), and 12 on special teams ... tied for first on the team with two interceptions ... OHIO STATE (Nov. 26) ... Second career forced fumble and second career interception ... made interception with 39 seconds left on OSU’s final drive to seal the win ... NEBRASKA (Nov. 19) ... recorded first career solo tackle-for-loss, second career fumble recovery on kickoff return to open the second half and a PBU ... PURDUE (Oct. 29) ... made two tackles, including first career sack (half-sack), and recorded first career interception ... MINNESOTA (Oct. 1) ... appeared as a reserve cornerback, tied the Michigan record for longest fumble return for a touchdown (83 yards) to go along with two tackles ... SAN DIEGO STATE (Sept. 24) ... recorded season-high 4 solo tackles ... WESTERN MICHIGAN (Sept. 3) ... started, set season high with four tackles and had a pass break-up.
Freshman (2010) ... earned first varsity letter ... played in all 13 games, started five contests ... regis-tered 36 tackles, 0.5 tackles for loss, a forced fumble and four pass breakups ... made collegiate debut on kickoff coverage unit vs. Connecticut (Sept. 4) ... saw first action at cornerback and contributed on special teams at Notre Dame (Sept. 11) ... recorded first collegiate tackle on kickoff coverage unit vs. Massachusetts (Sept. 18) ... made two tackles and broke up a team-high two passes at cornerback and special teams vs. Bowling Green (Sept. 25) ... switched from jersey #9 to #5 prior to the Indiana (Oct. 2) game ... recorded two tackles as a reserve cornerback against the Hoosiers ... posted one solo tackle at nickelback vs. Michigan State (Oct. 9) ... assisted on two tackles at nickelback vs. Iowa (Oct. 16) ... recorded one solo tackle and one assisted tackle at nickelback at Penn State (Oct. 30) ... tal-lied a career-high five tackles and a pass breakup in first career start at cornerback vs. Illinois (Nov. 6) ... matched his career-high with five tackles and broke up a pass in start at Purdue (Nov. 13) ... reset his career-high with seven tackles, including an assisted tackle for loss, and forced his first career fumble in start vs. Wisconsin (Nov. 20) ... registered three tackles in start at Ohio State (Nov. 27) ... tallied six tackles in start at cornerback vs. Mississippi State (Jan. 1) in Gator Bowl.
Prep ... attended Lexington High School (2010) coached by B.J. Payne ... four-year starter at quar-terback and two-year starter at cornerback ... ran 40-yard dash in 4.54 seconds and had a 36-inch ver-tical leap ... Key Statistics ... completed 413-of-674 passes (61%) for 5,926 yards and 56 touchdowns with 17 interceptions during his career ... carried the ball 175 times for 1,175 yards and scored 16 TDs ... holds seven school records at quarterback ... regis-tered 54 tackles, 21 pass breakups and one inter-ception in two years at cornerback ... threw for over 1,828 yards on 136-of-220 passing and accounted for 22 TDs as a senior ... made 25 stops, eight PBUs and one pick during senior year ... completed 150-
for-215 for 2,482 yards and 24 TDs with three inter-ceptions junior year ... made 29 tackles, 13 PBUs and recovered one fumble from cornerback spot as a junior ... completed 72-of-125 passes for 973 yards and 12 TDs as a sophomore ... passed for 643 yards on 55-of-114 passing with three touchdowns as a freshman ... Honors and Rankings ... three-star pros-pect by Rivals.com and scout.com ... listed as the No. 34 cornerback in the country according to scout.com ... two-star and the nation’s No. 92 cornerback according to Scouts, Inc. ... earned All-Ohio Division II first-team selection as a junior and senior ... named the Ohio Cardinal Conference Offensive Player of the Year as a junior and senior ... Mansfield News Journal/Brown Derby Roadhouse Offensive Player of the Year as a junior ... named to the Ohio High School Coaches Association North-South All-Star Classic ... three-time all-conference and all-district selection ... 2009 runner-up for the Art Teynor Award which is Ohio coaches association’s version of the Mr. Football Award given to the top academic/foot-ball player in the state of Ohio.
Personal ... Courtney Avery was born April 3, 1991 ... enrolled in the College of Literature, Science, and the Arts, major undeclared ... relative of George Jewett, the first African-American football player at Michigan and in the Big Ten Conference (1890).
Courtney Avery’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 13/5 22-14-36 0.5-1 0-0 0-0 0-0 42011 12/2 16-8-24 1.5-13 0.5-6 2-1 2-83 3Career 25/7 38-22-60 2.0-14 0.5-6 2-1 2-83 7
Courtney Avery’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 3-1-4 0-0 0-0 0-0 0-0 1Notre Dame 0-2-2 0-0 0-0 0-0 0-0 0Eastern Michigan 0-1-1 0-0 0-0 0-0 0-0 0San Diego State 4-0-4 0-0 0-0 0-0 0-0 0Minnesota 1-1-2 0-0 0-0 0-0 1-83 0at Northwestern 1-0-1 0-0 0-0 0-0 0-0 0at Michigan State 1-1-2 0-0 0-0 0-0 0-0 0Purdue 1-1-2 0.5-6 0.5-6 1-0 0-0 0at Iowa 1-1-2 0-0 0-0 0-0 0-0 0at Illinois 2-0-2 0-0 0-0 0-0 0-0 1Nebraska 1-0-1 1-7 0-0 0-0 1-0 1Ohio State 1-0-1 0-0 0-0 1-0 0-0 0Season Totals 16-8-24 1.5-13 0.5-6 2-1 2-83 3
Avery’s Career BestsTackles: 7, vs. Wisconsin (Nov. 20, 2010)Solos: 5, two times (last vs. Mississippi State, Jan. 1, 2011)Asst: 4, vs. Wisconsin (Nov. 20, 2010)TFLs: 1, vs. Nebraska (Nov. 19, 2011)Sacks: 0.5, vs. Purdue (Oct. 29, 2011)Int.: 1, twice (last vs. Ohio State, Nov. 26, 2011)FR: 1, twice (last vs. Nebraska, Nov. 19, 2011)PBUs: 2, vs. Bowling Green (Sept. 25, 2010)
al Backey *#38 • Cornerback5-10 • 181 • Jr./So.Ypsilanti, Mich.Ypsilanti HS
At Michigan ... one-year letterman ... switched from jersey #42 to #24 prior to 2010 spring practice ... switched from jersey #24 to #38 prior to the 2010 Indiana game (Oct. 2).
Junior/Sophomore (2011) ... did not see game action.
Sophomore/Freshman (2010) ... earned first varsi-ty letter ... appeared in 10 games ... made collegiate debut on special teams vs. Bowling Green (Sept. 25) ... posted first collegiate tackle on special teams against Indiana (Oct. 2) ... contributed on special teams units vs. Michigan State (Oct. 9), Iowa (Oct. 16), at Penn State (Oct. 30) ... appeared on special teams against Illinois (Nov. 6), Purdue (Nov. 13), Wisconsin (Nov. 20), at Ohio State (Nov. 27) ... con-tributed on special teams vs. Mississippi State (Jan. 1) in Gator Bowl.
Freshman (2009) ... did not see game action ... redshirted.
Prep ... attended Ypsilanti High School (2009) coached by Dave Poole ... three-year varsity per-former ... Honors and Rankings ... All-Mega Red conference and all-area selection as a senior ... all-area honoree as a junior ... Other Sports ... four-year letterman in track ... earned all-state honors all four years.
Personal ... Albert Charles Backey III was born May 29, 1991 ... enrolled in the College of Literature, Science and the Arts, majoring in sociology.
Al Backey’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 0/0 0-0-0 0-0 0-0 0-0 0-0 02010 10/0 0-1-1 0-0 0-0 0-0 0-0 02011 0/0 0-0-0 0-0 0-0 0-0 0-0 0Career 10/0 0-1-1 0-0 0-0 0-0 0-0 0
ricky BarNum ** #52 • Offensive Lineman6-3 • 292 • Sr./Jr.Lakeland, Fla.Lake Gibson HS
At Michigan ... two-year letterman ... appeared in nine contests along the offensive line, making three starts.
Senior/Junior (2011) ... played in four games at left guard; started three games (Notre Dame, Eastern Michigan, San Diego State).
Junior/Sophomore (2010) ... earned second varsity letter ... appeared in three contests ... made season debut as a reserve at left guard and special teams vs. Bowling Green (Sept. 25) ... substituted in at left tackle against Ohio State (Nov. 27) ... entered the game at right guard in Gator Bowl vs. Mississippi State (Jan. 1).
Sophomore/Freshman (2009) ... earned first var-sity letter ... appeared in two games ... made career debut as a reserve at left guard vs. Eastern Michigan (Sept. 19) ... played left tackle against Delaware State (Oct. 17), his first appearance at the position.
Freshman (2008) ... did not see game action ... redshirted.
Prep ... attended Lake Gibson High School (2008) coached by Keith Demyer ... three-year varsity let-terman in football ... Key Statistics ... recorded over 75 pancake blocks as an offensive tackle ... Honors and Rankings ... four-star prospect and the nation’s fifth-best center according to Rivals.com ... rated as the No. 37 player in the state of Florida by Rivals.com ... PrepStar Magazine All-Southeast Region ...
rated as the 148th-best player nationally on the ESPN 150 rankings ... fourth-rated offensive guard prospect by Scouts, Inc. ... participated in the Under Armour All-American game ... first-team All-Polk County selection as a senior ... Class 5A first-team all-state honoree senior year ... second-team Class 5A all-state as a junior.
Personal ... Ricky Lovell Barnum Jr. was born on June 25, 1989 ... enrolled in the College of Literature, Science and the Arts, majoring in Afro-American and African studies.
JordaN Barpal#35 • Wide Receiver5-10 • 166 • Sr./Jr.West Bloomfield, Mich.Seaholm HS
Senior/Junior (2011) ... did not see game action.
Junior/Sophomore (2010) ... did not see game action.
Sophomore/Freshman (2009) ... U-M Athletic Academic Achievement award ... did not see game action ... walked onto team during fall camp.
Prep ... attended Seaholm High School (2008) coached by Chris Fahr ... National Honor Society member ... AP Scholar ... three-year varsity letter-man in football ... Key Statistics ... gained 744 total offensive yards as a senior ... had 10 carries, 21 receptions, eight punt returns and 14 kickoff returns senior year ... scored two rushing touchdowns as a senior ... registered 22 tackles, one sack and two interceptions as a senior ... Honors and Rankings ... OAA preview/preseason watch list ... named team’s most improved player as a senior ... Other Sports ... earned a varsity letter in track and two in baseball ... qualified for states in the 4x100 relay as a junior ... starting shortstop for two seasons.
Personal ... Jordan Joseph Barpal was born Sept. 17, 1989 ... enrolled in the College of Literature, Science and the Arts, majoring in political science.
isaiah Bell#34 • Linebacker6-1 • 250 • Jr./So.Youngstown, OhioLiberty HS
Junior/Sophomore (2011) ... did not see game action.
Sophomore/Freshman (2010) ... did not see game action.
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Liberty High School (2009) coached by Jeff Whittaker ... three-year varsity start-er ... ran 40-yard dash in 4.5 seconds ... Key Statistics ... posted 124 tackles, two forced fumbles and eight interceptions during his career ... caught 11 passes for 222 yards and four touchdowns in his career ... recorded 62 tackles, four interceptions, two pass breakups and a forced fumble as a senior ... tallied 59 stops and four interceptions junior year ... returned two of his four picks for touchdowns as a junior ...
Honors and Rankings ... three-star prospect and the 27th-best prospect in the state of Ohio according to Rivals.com ... rated as the No. 26 linebacker nation-ally by Rivals.com ... listed as the 11th-best safety prospect by Scouts, Inc. ... selected as the No. 95 overall player nationally by Scouts, Inc. ... three-star prospect and the 46th-best safety by scout.com ... SuperPrep All-American and the No. 35 overall defensive back prospect according to the publica-tion ... listed as the No. 26 player in the Midwest by SuperPrep ... All-Midwest region selection by Prep Star ... Under Armour All-American game participant ... selected to the Ohio vs. Pennsylvania Big 33 Game ... earned all-conference, all-county and all-district accolades as a senior ... named All-Trumbull County first team as a junior and senior ... received Division III All-State honors senior year ... Other Sports ... three-year varsity basketball letterman ... averaged 18 points per game as a junior.
Personal ... Isaiah Maurice Bell was born July 9, 1991 ... attended the same high school as running back Fitzgerald Toussaint ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
russell Bellomy #3 • Quarterback6-3 • 189 • Fr.Arlington, TexasMartin HS
Freshman (2011) ... did not see game action.
Prep ... attended Martin High School (2011) coached by Bob Wager ... led team to 10-3 record and Class 5A Division I regional semifinals as a senior ... Key Statis-tics ... passed for 1,564 yards and 15 touchdowns as a senior ... rushed for 804 yards and scored nine TDs senior year ... finished junior season with 1,546 pass-ing yards and 13 touchdowns as well as 436 rushing yards and six touchdowns .... Honors and Rankings ... participated at the Elite 11 quarterback camp ... three-star recruit according to Rivals.com and Scout.com ... was the No. 4 QB in HSGameTime’s Dallas-area top 100 and the No. 61 overall player in Texas according to the Dallas Morning News ... listed as the No. 35 quarterback nationally by ESPN ... named to the first 4-5A All-District Football team.
Personal ... Russell Bellomy was born August 8, 1992 ... enrolled in the School of Kinesiology, major unde-clared.
BreNNeN Beyer#97 • Linebacker6-3 • 225 • Fr.Canton, Mich.Plymouth HS
Freshman (2011)... appeared in 10 games; played eight games as a reserve linebacker and nine con-tests on special teams ... IOWA (Nov. 5) ... tallied a ca-reer-high four tackles ... WESTERN MICHIGAN (Sept. 3) ... made collegiate debut as a reserve linebacker with two assisted tackles.
Prep ... attended Plymouth High School (2011) coached by Mike Swachuck ... led team to an 11-3 record and appearance in the state finals as a senior ... started on both sides of the ball final three years ... ran 40-yard dash in 4.5 seconds ... Key Statistics ...
registered 65 tackles and 12 sacks at defensive end as a senior year ... caught 31 passes for 10 TDs as a senior ... compiled 45 tackles, nine tackles for loss and nine sacks during his junior season ... Honors and Rankings ... listed as a four-star recruit and the 12th-best defensive end nationally by Scout.com ... received a four-star grade from ESPN.com and was selected as the No. 24 defensive end in the country ... four-star prospect, the 16th-best defensive end nationally and the 201st-best player in the country by Rivals.com ... listed as the fifth-best prospect in the state of Michigan by Rivals.com ... earned AP all-state honorable mention as a lineman ... rated as the seventh-best player on The Detroit News Blue Chip list ... listed as the seventh-best player in Michi-gan according to the Detroit Free Press ... named first-team all-conference, first-team all-league, All-Detroit West and All-Metro Detroit as a junior and senior.
Personal ... Brennen Beyer was born November 25, 1992 ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Brennen Beyer’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2011 10/0 5-6-11 0-0 0-0 0-0 0-0 0Career 10/0 5-6-11 0-0 0-0 0-0 0-0 0
Brennen Beyer’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-2-2 0-0 0-0 0-0 0-0 0Notre Dame - - - - - -Eastern Michigan 1-0-1 0-0 0-0 0-0 0-0 0San Diego State 0-0-0 0-0 0-0 0-0 0-0 0Minnesota 2-0-2 0-0 0-0 0-0 0-0 0at Northwestern 0-0-0 0-0 0-0 0-0 0-0 0at Michigan State 0-0-0 0-0 0-0 0-0 0-0 0Purdue 0-2-2 0-0 0-0 0-0 0-0 0at Iowa 2-2-4 0-0 0-0 0-0 0-0 0at Illinois 0-0-0 0-0 0-0 0-0 0-0 0-0Nebraska 0-0-0 0-0 0-0 0-0 0-0 0-0Ohio State - - - - - -Season Totals 5-6-11 0-0 0-0 0-0 0-0 0
Beyer’s Career BestsTackles: 4, at Iowa (Nov. 5, 2011)Solos: 2, twice (last at Iowa, Nov. 5, 2011)Asst: 2, three times (last at Iowa, Nov. 5, 2011)TFLs: NoneSacks: NoneInt.: NoneFR: NonePBUs: None
JiBreel Black *#55 • Defensive End6-2 • 260 • So.Cincinnati, OhioWyoming HS
Sophomore (2011)... has played in all 12 games; appeared as a reserve defensive lineman in each game, contributed on special teams in four games ... OHIO STATE (Nov. 26) ... recorded an assisted sack ... MINNESOTA (Oct. 1) ... made first career sack and tackle-for-loss for nine yards ... EASTERN MICHIGAN (Sept. 17) ... made career-high four tackles, tying career high with three solos ... NOTRE DAME (Sept. 10) ... set career high with three solo stops.Freshman (2010) ... earned first varsity letter ... played in all 13 contests at defensive end ... tallied seven tackles ... made collegiate debut at defen-
sive end vs. Connecticut (Sept. 4) ... saw game action as a reserve at defensive end against Notre Dame (Sept. 11) and Massachusetts (Sept. 18) ... appeared at defensive end vs. Bowling Green (Sept. 25) ... recorded his first collegiate tackle in Big Ten opener at Indiana (Oct. 2) ... assisted on a tackle as a reserve defensive end vs. Michigan State (Oct. 9) ... appeared as a reserve at defensive end vs. Iowa (Oct. 16), at Penn State (Oct. 30) and vs. Illinois (Nov. 6) ... substituted in as a defensive end at Purdue (Nov. 13) ... assisted on a tackle as a reserve defensive end vs. Wisconsin (Nov. 20) ... assisted on two tackles as a backup defensive end at Ohio State (Nov. 27) ... made two solo tackles as a reserve defensive end vs. Mississippi State (Jan. 1) in the Gator Bowl.
Prep ... attended Wyoming High School (2010) coached by Bernie Barre ... ran 40-yard dash in 4.8 seconds ... benched 325 pounds, squatted 650 and had a 28-inch vertical leap ... started 35 games over three years ... Key Statistics ... recorded 77 tackles, 10 sacks, two fumbles caused and two fumbles recovered as a senior ... posted 73 stops, seven sacks, forced two fumbles and had one touchdown junior year ... registered 58 tackle and three sacks as a sophomore ... Honors and Rankings ... four-star and the nation’s No. 15 defensive tackle pros-pect by scout.com ... three-star and the 25th-best defensive end according to Rivals.com ... listed as the 26th-best player in the state of Ohio by Rivals.com ... three-star and the nation’s No. 45 defensive end according to Scouts, Inc. ... earned first-team Division III all-state honors senior year ... named Southwest District Division III defensive player of the year as a senior ... named to the Ohio High School Coaches Association North-South All-Star Classic ... two-time first-team All-Cincinnati Hills League selection.
Personal ... Jibreel Waverly Black was born Oct. 8, 1991 ... enrolled in the College of Literature, Science and the Arts, major undeclared ... brother, Larry, plays on the defensive line at Indiana.
Jibreel Black’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 13/0 3-4-7 0-0 0-0 0-0 0-0 02011 12/0 11-6-17 1.5-10 1.5-10 0-0 0-0 0Career 25/0 14-10-24 1.5-10 1.5-10 0-0 0-0 0
Jibreel Black’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 1-2-3 0-0 0-0 0-0 0-0 0Notre Dame 3-0-3 0-0 0-0 0-0 0-0 0Eastern Michigan 3-1-4 0-0 0-0 0-0 0-0 0San Diego State 0-0-0 0-0 0-0 0-0 0-0 0Minnesota 2-1-3 1-9 1-9 0-0 0-0 0at Northwestern 1-0-1 0-0 0-0 0-0 0-0 0at Michigan State 0-1-1 0-0 0-0 0-0 0-0 0Purdue 0-0-0 0-0 0-0 0-0 0-0 0at Iowa 0-0-0 0-0 0-0 0-0 0-0 0at Illinois 1-0-1 0-0 0-0 0-0 0-0 0Nebraska 0-0-0 0-0 0-0 0-0 0-0 0Ohio State 0-1-1 0.5-1 0.5-1 0-0 0-0 0Season Totals 11-6-17 1.5-10 1.5-10 0-0 0-0 0
Black’s Career BestsTackles: 4, vs. Eastern Michigan (Sept. 17, 2011)Solos: 3, twice (last vs. Eastern Michigan, Sept. 17, 2011Asst: 2, twice (last vs. Western Michigan, Sept. 3, 2011)TFLs: 1, vs. Minnesota (Oct. 1, 2011)Sacks: 1, vs. Minnesota (Oct. 1, 2011)Int.: NoneFR: NonePBUs: None
NathaN BriNk#67 • Defensive Tackle6-5 • 263 • Jr.-So.Holland, Mich.Holland Christian HS
Junior/Sophomore (2011)... saw action in 11 games; played 11 games as defensive reserve, start-ing once (Purdue); played twice on special teams ... PURDUE (Oct. 29) ... made first career start at defen-sive end ... MINNESOTA (Oct. 1) ... first career tackle was a TFL for four yards.
Sophomore/Freshman (2010) ... made collegiate debut as a reserve at defensive end vs. Bowling Green (Sept. 25).
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Holland Christian High School (2009) coached by Willie Snead III ... two-year varsity performer ... part of state championship team as a senior ... elected co-captain as a senior ... Honors and Rankings ... all-area and All-O.K. Green selection as a senior ... earned Army scholar athlete award as a senior ... all-conference honorable mention junior year ... Other Sports ... three-year varsity basketball performer ... all-area and all-conference in basket-ball as a senior ... elected co-captain senior year ... all-conference honorable mention junior year.
Personal ... Nathan Alan Brink was born November 6, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in sociology ... high school teammate of placekicker Seth Broekhuizen.
Nathan Brink’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 1/0 0-0-0 0-0 0-0 0-0 0-0 02011 11/0 1-0-1 1-4 0-0 0-0 0-0 0Career 12/0 1-0-1 1-4 0-0 0-0 0-0 0
Nathan Brink’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-0-0 0-0 0-0 0-0 0-0 0Notre Dame 0-0-0 0-0 0-0 0-0 0-0 0Eastern Michigan 0-0-0 0-0 0-0 0-0 0-0 0San Diego State 0-0-0 0-0 0-0 0-0 0-0 0Minnesota 1-0-1 1-4 0-0 0-0 0-0 0at Northwestern - - - - - -at Michigan State 0-0-0 0-0 0-0 0-0 0-0 0Purdue 0-0-0 0-0 0-0 0-0 0-0 0 at Iowa 0-0-0 0-0 0-0 0-0 0-0 0at Illinois 0-0-0 0-0 0-0 0-0 0-0 0Nebraska 0-0-0 0-0 0-0 0-0 0-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 1-0-1 1-4 0-0 0-0 0-0 0
seth BroekhuizeN *#46 • Placekicker6-1 • 200 • Jr.-So.Holland, Mich.Holland Christian HS
Junior/Sophomore (2011) ... has not seen game action.
Sophomore/Freshman (2010) ... earned first var-sity letter ... played 11 games and made nine starts at placekicker and one at punter ... made 3-of-9 field goals and 42-of-43 PATs ... recorded two touchbacks
in six contests as kickoff specialist ... made his col-legiate debut at placekicker against Notre Dame (Sept. 11), converting Michigan’s final PAT with 27 seconds remaining for a four-point lead ... made his first career start at placekicker vs. Massachusetts (Sept. 18), converting all six PATs ... served as the kickoff specialist on three kickoffs against UMass ... connected on all eight extra-point attempts in start vs. Bowling Green (Sept. 25) ... posted one touchback against the Falcons ... made all six PATs in start at Indiana (Oct. 2) ... kicked first career field goal -- a 34-yarder -- in the first quarter and made both PATs in start vs. Michigan State (Oct. 9) ... made all four PATs and recorded one touchback as starting placekicker and kickoff specialist vs. Iowa (Oct. 16) ... converted the longest field goal -- 37-yarder -- of his career in the second quarter and made all four of his PATs at Penn State (Oct. 30) ... knocked a 35-yard field goal through the uprights in the second quar-ter and made all eight PATs in start vs. Illinois (Nov. 6) ... missed a 42-yard field goal in the fourth quarter and made 3-of-4 PATs in start at Purdue (Nov. 13) ... missed a 30-yard field goal in the second quarter in start vs. Wisconsin (Nov. 20) ... started at punter and kickoff specialist against Ohio State (Nov. 27), aver-aging 28.7 yards on three punts ... did not see game action vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... U-M Athletic Academic Achievement award ... redshirted ... did not see game action.
Prep ... attended Holland Christian High School (2009) coached by Willie Snead III ... was part of state champion football team as a senior ... National Honor Society member ... Other Sports ... four-year varsity soccer performer ... four-time all-district and All-O.K. Green soccer team selection ... all-state in soccer as a senior.
Personal ... Seth Daniel Broekhuizen was born December 26, 1990 ... enrolled in the School of Kinesiology, majoring in movement science ... high school teammate of defensive end Nathan Brink.
Broekhuizen’s Career Field Goal StatisticsYear GP FM-FA Pct. PATs Long Points2010 11 3-9 33.3 42-43 37 512011 0 0-0 0.0 0-0 0 0Career 11 3-9 33.3 42-43 37 51
chris BryaNt #58 • Offensive Lineman6-4 • 341 • Fr.Chicago, Ill.Simeon HS
Freshman (2011) ... has not seen game action.
Prep ... attended Chicago Simeon High School (2011) coached by Dante Culbreath ... helped team post an 11-1 record as a senior ... Key Statistics ... benched 395 pounds and squatted 420 pounds ... had a 24-inch vertical jump ... Honors and Rank-ings ... four-star recruit according to Rivals.com and a three-star prospect by Scout.com and ESPN.com ... listed as the No. 19 offensive tackle nationally by Rivals.com ... rated as the sixth-best prospect in the state of Illinois and the 203rd overall player nation-ally by Rivals.com ... received three-star rating from Scout.com and is listed as the 21st-best offensive guard prospect by the service ... rated as the 15th-best offensive guard/center by MaxPreps’ Tom Lem-
ming ... named to the 2010 Rivals Class 5A-8A All-State team as a senior.
Personal ... Chris Bryant was born November 7, 1992 ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Joey BurzyNski #56 • Offensive Lineman6-1 • 284 • So.-Fr.Carlsbad, Calif.Carlsbad HS
Sophomore/Freshman (2011) ... .appeared in four games, playing as a reserve left guard each game ... EASTERN MICHIGAN (Sept. 17) ... made collegiate debut substituting in at left guard.
Prep … attended Palomar H.S. (2010) … two-year varsity letterman … named Lineman of the Year … second team all-conference selection as a senior … selected to North County All-Star team … two-time scholar-athlete … only played in three games as a junior (injury) … Honor Roll student.
Personal … Joseph Samuel Burzynski was born August 12, 1992 … son of William and Margaret Burzynski … both parents are University of Michigan graduates … enrolled in the College of Literature, Science and the Arts, major undeclared.
Will campBell **#73 • Defensive Tackle6-5 • 322 • Jr.Detroit, Mich.Cass Tech HS
At Michigan ... two-year letterman ... appeared in 37 consecutive contests ... moved to offensive line prior to Penn State game in 2010 (Oct. 30) ... switched back to defensive line during offseason prior to the 2011 season ... special teams contributor.
Junior (2011)... played in all 12 games; appeared in each game as a defensive reserve and on special teams ... NEBRASKA (Nov. 19) ... tied his career high with two tackles, including a career-best two solo stops, and added second career unassisted sack ... PURDUE (Oct. 29). ... matched career high with two assisted tackles and added fourth career pass break-up ... MICHIGAN STATE (Oct. 15) ... matched career-high with two tackles, including an assisted tackle-for-loss ... NORTHWESTERN (Oct. 8) ... earned first career sack for seven yards ... NOTRE DAME (Sept. 10) ... first career fumble recovery.
Sophomore (2010) ... earned second varsity letter ... saw action in all 13 contests ... played on field goal/PAT protection unit and punt team vs. Connecticut (Sept. 4) ... saw game action at fullback in goal line package against Notre Dame (Sept. 11), blocking on Stephen Hopkins’ one-yard touchdown run ... appeared at nose tackle, on field goal/PAT protec-tion unit and punt team against the Fighting Irish ... played as backup nose tackle and on special teams vs. Massachusetts (Sept. 18) ... batted down one pass at nose tackle and contributed on the field goal/PAT protection unit vs. Bowling Green (Sept. 25) ... appeared as reserve nose tackle and on the field goal/PAT protection units at Indiana (Oct. 2) ... made first tackle of the season as reserve nose tackle and contributed on special teams vs.
Michigan State (Oct. 9) ... played on field goal/PAT protection units vs. Iowa (Oct. 16) ... switched to the offensive line before the Penn State (Oct. 30) game ... appeared on the field goal/PAT protection units against the Nittany Lions ... contributed on the field goal/PAT protection units against Illinois (Nov. 6), Purdue (Nov. 13) and Wisconsin (Nov. 20) ... played on the field goal/PAT protection units at Ohio State (Nov. 27) ... appeared on special teams units vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... earned first varsity letter ... played on field goal/PAT protection unit in all 12 games ... appeared at defensive tackle in nine con-tests ... registered four tackles, one tackle for loss and two pass breakups ... made career debut at defensive tackle vs. Western Michigan (Sept. 5), making one tackle ... contributed on special teams vs. Notre Dame (Sept. 12) ... assisted on a tackle vs. Eastern Michigan (Sept. 19), playing defensive tackle and on special teams ... contributed on spe-cial teams vs. Indiana (Sept. 26) ... played on special teams and on goal line defense At Michigan State (Oct. 3) ... appeared at defensive tackle and on spe-cial teams at Iowa (Oct. 10), assisting on a tackle ... saw action at nose tackle and on special teams vs. Delaware State (Oct. 17), posting his first career PBU ... contributed on special teams vs. Penn State (Oct. 24) ... played nose tackle and on field goal/PAT pro-tection unit at Illinois (Oct. 31) and vs. Purdue (Nov. 7) ... contributed a pass breakup at Wisconsin (Nov. 14) ... posted one tackle vs. Ohio State (Nov. 21).
Prep ... attended Cass Technical High School (Dec. 2008) coached by Thomas Wilcher ... three-year starter at offensive tackle and two-year starter at defensive tackle ... team’s punter and kicker ... ran 40-yard dash in 4.9 seconds ... did 15 reps of 315 pounds ... Key Statistics ... registered 55 tackles, 22 tackles for loss, nine sacks, two fumbles caused, two fumbles recovered and one touchdown off a fumble as a senior ... graded out at 98 percent offensively for his blocking senior year ... Honors and Rankings ... PARADE Magazine All-American ... EA Sports All-America first team ... SuperPrep All-American and the sixth-best defensive linemen according to the publication ... SuperPrep Midwest Defensive Player of the Year and the No. 27 overall player in the country ... Prep Star All-American and named to Top 100 Dream Team ... top rated player in the state of Michigan by The Detroit News and Detroit Free Press ... Detroit Free Press All-State Dream Team ... listed as the No. 2 overall player on the Detroit Free Press Best of the Midwest rankings ... five-star prospect and the nation’s fifth-best defensive tackle accord-ing to Rivals.com and scout.com ... top prospect in the state of Michigan and rated as the No. 26 overall player nationally according to Rivals.com ... rated as the nation’s top runner stuffer and as the second strongest defensive lineman in the country by Rivals.com ... selected as the No. 35 overall player nationally by scout.com ... selected to The Detroit News Blue Chip list ... selected 27th-best prospect nationally by Athlon Sports ... selected 22nd-best player in the country by SuperPrep ... rated as the No. 42 overall player nationally by Tom Lemming ... committed to Michigan during the U.S. Army All-American game ... MaxPreps All-America second team.
Personal ... William Campbell was born July 6, 1991 ... high school teammate of current Wolverines Thomas Gordon and Delonte Hollowell ... enrolled in College of Literature, Science and the Arts, majoring in general studies.
Will Campbell’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 12/0 2-2-4 1-1 0-0 0-0 0-0 22010 13/0 1-0-1 0-0 0-0 0-0 0-0 12011 12/0 5-6-11 2.5-9 2-8 0-0 1-0 1Career 37/0 6-8-14 2.5-9 1-7 0-0 1-0 4
Campbell’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-0-0 0-0 0-0 0-0 0-0 0Notre Dame 0-0-0 0-0 0-0 0-0 1-0 0Eastern Michigan 1-0-1 0-0 0-0 0-0 0-0 0San Diego State 1-1-2 0-0 0-0 0-0 0-0 0Minnesota 0-1-1 0-0 0-0 0-0 0-0 0at Northwestern 1-0-1 1-7 1-7 0-0 0-0 0at Michigan State 0-2-2 0.5-1 0-0 0-0 0-0 0Purdue 0-2-2 0-0 0-0 0-0 0-0 1at Iowa 0-0-0 0-0 0-0 0-0 0-0 0at Illinois 0-0-0 0-0 0-0 0-0 0-0 0Nebraska 2-0-2 1-1 1-1 0-0 0-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 5-6-11 2.5-9 2-8 0-0 1-0 1
Campbell’s Career BestsTackles: 2, four times (last vs. Nebraska, Nov. 19, 2011)Solos: 2, vs. Nebraska (Nov. 19, 2011)Asst: 2, twice (last vs. Purdue, Oct. 29, 2011)TFLs: 1, three times (last vs. Nebraska, Nov. 19, 2011)Sacks: 1, twice (last vs. Nebraska, Nov. 19, 2011)Int.: NoneFR: 1, vs. Notre Dame (Spet. 10, 2011)PBUs: 1, four times (last vs. Purdue, Oct. 29, 2011)
tamaNi carter #20 • Defensive Back5-11 • 175 • Fr.Pickerington, OhioPickerington Central HS
Freshman (2011) ... has not seen game action.
Prep ... attended Pickerington Central High School (2011) coached by Jay Sharrett ... led team to 11-1 record, fifth consecutive Ohio Capitol Conference championship and Division I, Region 3 final ... ran 40-yard dash in 4.48 seconds ... benched 295 pounds and squatted 385 pounds ... had a 35-inch vertical jump ... Key Statistics ... registered 55 tackles and three interceptions during his senior season, two of the three picks were returned for touchdowns ... made 25 receptions for over 300 yards as a senior ... had 48 tackles, three tackles for loss, five intercep-tions and four pass breakups as a junior ... made six receptions for 107 yards and one TD junior year ... caught 17 passes for 329 yards and five TDs as a sophomore ... Honors and Rankings ... three-star recruit and the No. 60 prospect in the state of Ohio according to Rivals.com ... three-star recruit and the 103rd-rated defensive back nationally by Scout.com ... earned first-team all-league, first-team all-district and second-team all-state accolades as a senior ... named all-district as a junior.
Personal ... Tamani Carter was born September 22, 1993 ... enrolled in the College of Literature, Science and the Arts, major undeclared.
mattheW cavaNaugh **#28 • Safety5-10 • 190 • Sr.-Jr.Alto, Mich.Caledonia HS
At Michigan ... two-year letterman ... two-time Academic All-Big Ten ... three-time U-M Athletic Academic Achievement award recipient (2008-10) ... appeared in 19 games ... special teams contributor with 10 tackles.
Senior/Junior (2011) ... Academic All-Big Ten ... appeared in all 12 games; played all 12 on special teams ... SAN DIEGO STATE (Sept. 24) ... served as the honorary senior game captain.
Junior/Sophomore (2010) ... earned second varsity letter ... did not see game action.
Sophomore/Freshman (2009) ... earned first var-sity letter ... Academic All-Big Ten ... U-M Athletic Academic Achievement ... played in seven games on special teams ... made career debut on special teams vs. Indiana (Sept. 26) ... contributed on special teams at Iowa (Oct. 10) and against Delaware State (Oct. 17) ... saw special teams action at Illinois (Oct. 31) and vs. Purdue (Nov. 7) ... played on special teams at Wisconsin (Nov. 14) ... appeared on special teams vs. Ohio State (Nov. 21).
Freshman (2008) ... U-M Athletic Academic Achievement award ... did not see game action.
Prep ... attended Caledonia High School (2008) ... National Honor Society member ... NFSCA Student-Athlete Award recipient as a junior ... three-year var-sity letterman ... helped lead team to three straight conference titles ... squad won district champion-ships as a sophomore and junior and claimed the regional and state titles as a sophomore ... Key Statistics ... posted 12 career interceptions and scored 33 career touchdowns ... had 1,300 rushing yards and scored 15 touchdowns as a senior ... tal-lied three interceptions as a junior and senior after picking six passes during sophomore year ... Honors and Rankings ... second-team all-state on defense as a senior ... Grand Rapids Press All-Area Dream Team member senior year ... all-conference and all-area as a junior and senior ... Other Sports ... member of the conference champion lacrosse team as a senior ... two-year varsity letterman in track.
Personal ... Matthew Peter Cavanaugh was born June 1, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in economics.
Matthew Cavanaugh’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 7/0 0-0-0 0-0 0-0 0-0 0-0 02010 0/0 0-0-0 0-0 0-0 0-0 0-0 02011 12/0 3-7-10 0-0 0-0 0-0 0-0 0Career 19/0 3-7-10 0-0 0-0 0-0 0-0 0
Cavanaugh’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-2-2 0-0 0-0 0-0 0-0 0Notre Dame 0-0-0 0-0 0-0 0-0 0-0 0Eastern Michigan 0-0-0 0-0 0-0 0-0 0-0 0San Diego State 0-0-0 0-0 0-0 0-0 0-0 0Minnesota 0-1-1 0-0 0-0 0-0 0-0 0at Northwestern 0-0-0 0-0 0-0 0-0 0-0 0at Michigan State 0-1-1 0-0 0-0 0-0 0-0 0Purdue 0-1-1 0-0 0-0 0-0 0-0 0
at Iowa 1-1-2 0-0 0-0 0-0 0-0 0at Illinois 1-1-2 0-0 0-0 0-0 0-0 0Nebraska 1-0-1 0-0 0-0 0-0 0-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 3-7-10 0-0 0-0 0-0 0-0 0
FraNk clark#57 • Defensive End6-2 • 228 • Fr.Cleveland, OhioGlenville HS
Freshman (2011)... appeared in 11 games; played as reserve on defense in nine games and eight on special teams ... NOTRE DAME (Sept. 10) ... saw first action as a defensive end, making one tackle ... WESTERN MICHIGAN (Sept. 3) ... Made one tackle in career debut on special teams.
Prep ... attended Glenville High School (2011) coached by Ted Ginn Sr. ... ran 40-yard dash in 4.53 seconds ... Key Statistics ... recorded 70 tackles and 19 sacks as a senior ... caught 12 passes, including three for touchdowns, senior year ... Honors and Rankings ... three-star recruit and the 52nd-best player in Ohio according to Rivals.com ... three-star recruit and the nation’s 33rd-best tight end accord-ing to Scout.com ... three-star recruit and nation’s 83rd-best defensive end according to ESPN.com.
Personal ... Frank Clark was born June 14, 1993 ... enrolled in the School of Kinesiology, major unde-clared.
Frank Clark’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2011 11/0 2-3-5 0-0 0-0 0-0 0-0 0Career 11/0 2-3-5 0-0 0-0 0-0 0-0 0
Frank Clark’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 1-0-1 0-0 0-0 0-0 0-0 0Notre Dame 1-0-1 0-0 0-0 0-0 0-0 0Eastern Michigan 0-1-1 0-0 0-0 0-0 0-0 0San Diego State 0-0-0 0-0 0-0 0-0 0-0 0Minnesota 0-0-0 0-0 0-0 0-0 0-0 0at Northwestern 0-0-0 0-0 0-0 0-0 0-0 0at Michigan State - - - - - -Purdue 0-1-1 0-0 0-0 0-0 0-0 0at Iowa 0-0-0 0-0 0-0 0-0 0-0 0at Illinois 0-1-1 0-0 0-0 0-0 0-0 0Nebraska 0-0-0 0-0 0-0 0-0 0-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 2-3-5 0-0 0-0 0-0 0-0 0
Blake couNtess#18 • Defensive Back5-10 • 176 • Fr.Owings Mills, Md.Our Lady of Good Counsel HS
Freshman (2011) ... appeared in 11 games; played 10 games at cornerback, starting last five games (Purdue, Iowa, Illinois, Nebraska, Ohio State) and participating in 11 games on special teams ... sec-ond on the team with six pass break-ups ... made five-plus tackles in five games ... PURDUE (Oct. 29) ... made first collegiate start at cornerback, registering three tackles and first career TFL ... MINNESOTA (Oct. 1) ... forced first career fumble and recorded career-high two PBUs along with a team-high five tackles as a reserve cornerback ... SAN DIEGO STATE (Sept. 24)
... posted a career-high for tackles (7), solo stops (5) and broke up first career pass ... WESTERN MICHIGAN (Sept. 3) ... made collegiate debut on special teams.
Prep ... attended Our Lady Of Good Counsel High School (2011) coached by Bob Milloy ... played defensive back, wide receiver and kick returner ... helped team win back-to-back Washington Catho-lic Athletic Conference championships ... posted a shuttle time of 3.97 seconds and a vertical leap of 37 inches ... benched 255 pounds and squatted 395 pounds ... Key Statistics ... recorded 44 total pass breakups during his high school career ... posted 50 tackles and returned one kickoff for a touchdown as a junior ... Honors and Rankings ... participated in the U.S. Army All-American game ... four-star prospect, the No. 10 cornerback nationally according to Rivals.com ... listed as the third-best prospect in Maryland and the 131st overall player in the country by Rivals.com ... four-star recruit and the No. 14 cornerback prospect nationally according to ESPN.com ... four-star prospect and the No. 20 cornerback nationally according to Scout.com ... named to RivalsHigh.com second-team All-American defense in 2010 ... earned first-team all-state honors as a senior ... second-team Washington Post All-Met selection as a senior.
Personal ... Blake Countess was born August 8, 1993 ... enrolled in the School of Kinesiology, major unde-clared.
Blake Countess’ Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2011 11/5 24-12-36 1.0-1 0-0 0-0 0-0 6Career 11/5 24-12-36 1.0-1 0-0 0-0 0-0 6
Blake Countess’ Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-0-0 0-0 0-0 0-0 0-0 0Notre Dame - - - - - -Eastern Michigan 1-0-1 0-0 0-0 0-0 0-0 0San Diego State 5-2-7 0-0 0-0 0-0 0-0 1Minnesota 4-1-5 0-0 0-0 0-0 0-0 2at Northwestern 4-1-5 0-0 0-0 0-0 0-0 1at Michigan State 3-3-6 0-0 0-0 0-0 0-0 0Purdue 2-1-3 1.0-1 0-0 0-0 0-0 0at Iowa 4-2-6 0-0 0-0 0-0 0-0 1at Illinois 0-1-1 0-0 0-0 0-0 0-0 1Nebraska 1-1-2 0-0 0-0 0-0 0-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 24-12-36 1.0-1 0-0 0-0 0-0 6
Countess’ Career BestsTackles: 7, vs. San Diego State (Sept. 24, 2011)Solos: 5, vs. San Diego State (Sept. 24, 2011)Asst: 3, at Michigan State (Oct. 15, 2011)TFLs: 1, vs. Purdue (Oct. 29, 2011)Sacks: NoneInt.: NoneFR: NonePBUs: 2, vs. Minnesota (Oct. 1, 2011)
michael cox **#15 • Running Back6-0 • 214 • Sr.-Jr.Dorchester, Mass.Avon Old Farms HS
At Michigan ... two-year letterman ... appeared in 11 contests ... recorded 19 rushes for 169 yards and two touchdowns.
Senior/Junior (2011) ... appeared in five games;
played five on special teams ... PURDUE (Oct. 29) ... made season debut on special teams.
Junior/Sophomore (2010) ... earned second varsity letter ... appeared in two contests ... made season debut at running back vs. Bowling Green (Sept. 25), rushing six times for 56 yards, including a 35-yard long ... appeared as a reserve superback vs. Michigan State (Oct. 9).
Sophomore/Freshman (2009) ... earned first var-sity letter ... appeared in four games ... played three contests at running back and one contest on special teams ... carried the ball 13 times for 113 yards and scored two touchdowns ... made career debut at running back vs. Western Michigan (Sept. 5) ... rushed for 31 yards on two carries late in the fourth quarter vs. Eastern Michigan (Sept. 19) ... carried the ball 11 times for a career-high 82 yards and scored two TDs against Delaware State (Oct. 17) ... scored first collegiate touchdowns on three- and 57-yard rushes in the fourth quarter against the Hornets ... caught his first career pass for 11 yards late in the third quarter against the Hornets ... traveled but did not see game action at Illinois (Oct. 31) ... con-tributed on the kick return unit vs. Purdue (Nov. 7).
Freshman (2008) ... did not see game action ... redshirted.
Prep ... attended Avon Old Farms High School (2007) coached by Kevin Driscoll ... ran 40-yard dash in 4.47 seconds ... measured a 36-inch vertical jump ... Key Statistics ... rushed for more than 2,400 yards in three seasons at running back ... tallied 222 yards on 41 carries before senior season that was cut short due to an ankle injury ... rushed for over 1,000 yards as a junior, averaging nearly 10 yards per carry, and scored 16 rushing touchdowns ... Honors and Rankings ... four-star prospect and the No. 35 running back nationally according to Scout.com ... ranked No. 30 in Rivals.com Prep School Top 50 ... tabbed as No. 69 running back recruit in the country by ESPN.com ... PrepStar Magazine All-East Region ... participated in the Piscataway NIKE Training Camp ... attended the New Jersey NIKE Combine.
Personal ... Michael A. Cox Jr. was born Nov. 14, 1989, in Boston ... attended Michigan Summer Football Camp ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Cox’s Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2009 4/0 13 113 8.7 28.3 2 572010 2/0 6 56 9.3 28.0 0 352011 5/0 0 0 0.0 0.0 0 0Career 11/0 19 169 8.9 18.8 2 57
keNNy demeNs **#25 • Linebacker6-1 • 248 • Sr.-Jr.Oak Park, Mich.Detroit Country Day HS
At Michigan ... two-year letterman ... appeared in 37 consecutive contests; made 19 starts at middle linebacker ... surpassed 100 career tackles vs. Notre Dame (Sept. 10, 2011) ... recorded double digit tack-les in seven games.
Senior/Junior (2011) ... All-Big Ten honorable men-tion (coaches/media) ... Phil Steele’s Midseason All-
Big Ten third team selection ... appeared in all 12 games; started all 12 games at middle linebacker and played in all 12 on special teams ... team’s leading tackler with 86 stops ... OHIO STATE (Nov. 26) ... registered eight tackles and an assisted sack ... NEBRASKA (Nov. 19) ... posted five tackles, an assisted sack and first career PBU ... ILLINOIS (Nov. 12) ... recorded seven tackles, a TFL and second career sack for a loss of 14 yards ... IOWA (Nov. 5) ... seventh career game with double-digit tackles (11), had one TFL ... NORTHWESTERN (Oct. 8).. ... led the team with 10 tackles, posting a TFL and first career sack ... sixth career double-digit tackle performance ... SAN DIEGO STATE (Sept. 24) ... tied for the team lead with seven tackles and recorded first career forced fumble ... NOTRE DAME (Sept. 10) ... tallied a team-high 12 tackles.
Junior/Sophomore (2010) ... earned second varsity letter ... played in all 13 games and started seven at middle linebacker ... team’s third-leading tackler with 82 tackles ... also recorded 1.5 TFLs and one pass breakup ... special teams contributor ... saw game action on special teams vs. Connecticut (Sept. 4) ... played as reserve at middle linebacker and contributed on special teams against Notre Dame (Sept. 11), assisting on one tackle ... had four tackles as a reserve strongside linebacker and on special teams vs. Massachusetts (Sept. 18) ... set career-high with five tackles, including one for a loss of two yards, at middle linebacker and special teams vs. Bowling Green (Sept. 25) ... recorded one solo tackle as reserve middle linebacker at Indiana (Oct. 2) ... appeared as reserve middle linebacker and on special teams vs. Michigan State (Oct. 9) ... made first collegiate start at middle linebacker vs. Iowa (Oct. 16), setting career-high with eight tackles ... finished with career-best 12 tackles, including an assisted TFL, in start at Penn State (Oct. 30) ... posted double-digit tackles (10) for second consecutive week and broke up first career pass in start vs. Illinois (Nov. 6) ... tallied seven tackles in start at Purdue (Nov. 13) ... set new career-high with 13 stops in start vs. Wisconsin (Nov. 20) ... registered eight tackles in start at Ohio State (Nov. 27) ... matched career-high with a game-high 13 tackles in start vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore/Freshman (2009) ... earned first var-sity letter ... played in all 12 games on special teams ... posted seven special teams stops ... made career debut on special teams vs. Western Michigan (Sept. 5), making two tackles ... saw action on special teams vs. Notre Dame (Sept. 12) ... played linebacker and special teams vs. Eastern Michigan (Sept. 19) ... assisted on a special teams stop vs. Indiana (Sept. 26) ... played special teams and on goal line defense at Michigan State (Oct. 3) and Iowa (Oct. 10) ... appeared at middle linebacker and on special teams units vs. Delaware State (Oct. 17), assisting on a tackle ... earned an assisted tackle on special teams against Penn State (Oct. 24) ... saw game action at weakside linebacker and on special teams against Illinois (Oct. 31) ... contributed on special teams vs. Purdue (Nov. 7) ... posted two stops at linebacker and played on special teams against Wisconsin (Nov. 14) ... played linebacker and special teams vs. Ohio State (Nov. 21).
Freshman (2008) ... played in one game, making assisted tackle on special teams vs. Miami (Ohio).
Prep ... attended Detroit Country Day High School (2007) coached by Dan McClean ... Great 8 Award recipient from the Mid-Michigan Touchdown Club,
a chapter of the National Football Foundation ... maxed out at 375 pounds on bench press ... Key Statistics ... collected 163 tackles, 14.5 tackles for loss, 7.5 sacks, three forced fumbles as linebacker during senior year ... tallied 11 tackles in the Division 4 title game ... threw for three touchdowns and returned a kickoff for a 67-yard touchdown as a senior ... totaled 90 tackles and 15 TFLs as a junior ... Honors and Rankings ... rated four stars, the No. 23 linebacker and No. 8-ranked player in the state of Michigan by Rivals.com ... three-star prospect and No. 22 player at his position by Scout.com ... PrepStar Magazine All-Midwest Region team ... Detroit Free Press All-State Dream Team.
Personal ... Kenny Demens was born Feb. 4, 1990 ... attended Michigan Summer Football Camp ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Kenny Demens’ Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 12/0 2-5-7 0-0 0-0 0-0 0-0 02010 13/7 47-35-82 1.5-2 0-0 0-0 0-0 12011 12/12 45-41-86 5-20 3-18 0-0 0-0 1Career 37/19 94-81-175 6.5-22 3-18 0-0 0-0 2
Kenny Demens’ Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 4-2-6 1-2 0-0 0-0 0-0 0Notre Dame 8-4-12 0-0 0-0 0-0 0-0 0Eastern Michigan 4-1-5 0-0 0-0 0-0 0-0 0San Diego State 4-3-7 0-0 0-0 0-0 0-0 0Minnesota 3-2-5 0-0 0-0 0-0 0-0 0at Northwestern 5-5-10 1-3 1-3 0-0 0-0 0at Michigan State 4-1-5 0-0 0-0 0-0 0-0 0Purdue 1-4-5 0-0 0-0 0-0 0-0 0at Iowa 3-8-11 1-0 0-0 0-0 0-0 0at Illinois 5-2-7 1-14 1-14 0-0 0-0 0Nebraska 2-3-5 0.5-0 0.5-0 0-0 0-0 1Ohio State 2-6-8 0.5-1 0.5-1 0-0 0-0 0Season Totals 45-41-86 5-20 3-18 0-0 0-0 1
Demens’ Career BestsTackles: 13, vs. Wisconsin (Nov. 20, 2010)Solos: 8, vs. Notre Dame (Sept. 10, 2011)Asst: 8, twice (last at Iowa, Nov. 5, 2011)TFLs: 1, five times(last at Illinois, Nov. 12, 2011)Sacks: 1, twice (last at Illinois, Nov. 12, 2011)Int.: NoneFR: NonePBUs: 1, vs. Nebraska (Nov. 19, 2011)
dreW dileo *#26 • Wide Receiver5-10 • 172 • So.Greenwell Springs, La.Parkview Baptist HS
Sophomore (2011) ... appeared in all 12 games; played in 11 as a reserve wide receiver; played in all 12 games on special teams as the holder specialist and three games at punt returner ... OHIO STATE (Nov. 26) ... set career highs for receiving yards (32) and single reception yardage (28), while tying career high with two catches ... NEBRASKA (Nov. 19) ... rushed for four yards on fake field goal to earn first down on third quarter touchdown drive ... MICHIGAN STATE (Oct. 15). ... rushed for three yards to earn a first down on a fake field goal that led to a touchdown on the opening drive ... MINNESOTA (Oct. 1) ... hauled in two passes for 23 yards, includ-ing a 17-yard touchdown catch on a halfback pass
from Vincent Smith ... EASTERN MICHIGAN (Sept. 17) ... had one reception for 19 yards and first career touchdown.
Freshman (2010) ... earned first varsity letter ... appeared in seven games ... played five contests at holder, two at kick returner and one at slot receiver ... made collegiate debut as holder vs. Connecticut (Sept. 4) ... started as holder against Notre Dame (Sept. 11) ... did not see game action vs. Massachusetts (Sept. 18) ... saw first game action as a reserve at slot receiver vs. Bowling Green (Sept. 25), catching his first career pass for three yards ... returned one punt for 15 yards on special teams against Falcons ... saw first Big Ten action on punt return unit at Indiana (Oct. 2) ... did not play in the next five games against Michigan State (Oct. 9), Iowa (Oct. 16), Penn State (Oct. 30), Illinois (Nov. 6), Purdue (Nov. 13) ... returned to action as holder and kick returner vs. Wisconsin (Nov. 20), returning two kickoffs for 55 yards ... served as kickoff and punt return specialist at Ohio State (Nov. 27), returning six kickoffs for 118 yards ... appeared as holder vs. Mississippi State (Jan. 1) in the Gator Bowl.
Prep ... attended Parkview Baptist High School (2010) coached by Kenny Guillot ... National Beta Club ... National Society of High School Scholars ... helped team win state title as sophomore and finish as state runner-up as senior ... team reached state quarterfinals as a junior ... played running back, wide receiver and returned punts and kickoffs ... three-year varsity letterman ... ran 40-yard dash in 4.5 seconds ... Key Statistics ... only player in school history with 1,000 career receiving yards and 5,000 all-purpose yards ... set school records with 73 catches for 1,193 yards and 14 touchdowns in his career ... rushed 303 times for 2,023 yards and 23 TDs during career ... set program marks with 40 punts for 656 yards and three TDs, and 36 kickoff returns for 1,198 yards and four TDs ... rushed for 724 yards and had 571 receiving yards as a senior ... returned four kicks for touchdowns as a junior ... caught 21 passes for 315 yards and four TDs junior year ... gained 760 rushing yards on 102 carries and had nine scores as a junior ... had 10 kickoff returns for 422 yards as a junior and returned 21 kicks for 657 yards sophomore year ... rushed 87 times for 540 yards and four TDs as a sophomore ... caught 17 passes for 305 yards and three TDs sophomore year ... Honors and Rankings ... Prep Star All-American ... three-star prospect and No. 73 athlete nationally according to Rivals.com ... all-state and all-metro as a junior ... rated No. 24 player in Louisiana by Rivals.com and SuperPrep ... three-star recruit and No. 98 wide receiver nationally according to scout.com ... three-star and the nation’s No. 134 athlete accord-ing to Scouts, Inc. ... listed 46th on the NewOrleans.com Fabulous 50 as a senior ... Louisiana High School Coaches All-State team honoree as a return-er and running back senior year ... Most Valuable Offensive Player in the district as a senior ... all-district as a returner final three years ... all-district second team at running back junior year and first-team selection as a senior ... Baton Rouge All-Metro as a junior and senior ... Other Sports ... three-year varsity letterman in baseball ... two-year starter at second base on the school’s back-to-back state championship teams as a sophomore and junior ... was the winning pitcher in the state championship game as a junior ... honorable mention all-state at second base as a sophomore ... two-time all-district selection at second base.
Personal ... Andrew Michael Dileo was born April 27,
1992 ... enrolled in the School of Kinesiology, major-ing in movement science.
Drew Dileo’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 6/0 1 3 3.0 0.4 0 32011 12/0 9 121 13.4 10.1 2 28Career 18/0 10 124 12.4 6.9 2 28
Drew Dileo’s Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan 1 3 3.0 0 3Notre Dame 0 0 0.0 0 0Eastern Michigan 1 19 19.0 1 19San Diego State 1 17 17.0 0 17Minnesota 2 23 11.5 1 17at Northwestern 0 0 0.0 0 0at Michigan State 0 0 0.0 0 0Purdue 0 0 0.0 0 0at Iowa 1 12 12.0 0 12at Illinois 0 0 0.0 0 0Nebraska 1 15 0.0 0 15Ohio State 2 32 16.0 0 28Season Totals 9 121 13.4 2 28
Drew Dileo’s Career Kick Return StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 6/0 8 173 21.6 28.8 0 342011 12/0 0 0 0 0 0 0Career 18/0 8 173 21.6 10.8 0 34
Drew Dileo’s Career Punt Return StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 6/0 2 13 6.5 2.2 0 152011 12/0 1 0 0.0 0.0 0 0Career 18/0 3 13 4.3 0.8 0 15
Dileo’s Career Bests:ReceivingReceptions: 2, twice (last vs. Ohio State, Nov. 26, 2011)Yards: 32, vs. Ohio State (Nov. 26, 2011)Touchdowns: 1, twice (last vs. Minnesota, Oct. 1, 2011)Long: 28, vs. Ohio State (Nov. 26, 2011)
Kick ReturnsAttempts: 6, at Ohio State (Nov. 27, 2010)Yards: 118, at Ohio State (Nov. 27, 2010)Touchdowns: NoneLong: 34, vs. Wisconsin (Nov. 20, 2010)
Punt ReturnsAttempts: 1, three times (last vs. Eastern Michigan, Sept. 17, 2011)Yards: 15, vs. Bowling Green (Sept. 25, 2010)Touchdowns: NoneLong: 15, vs. Bowling Green (Sept. 25, 2010)
chris eddiNs#93 • Defensive End6-5 • 253 • So./Fr.Detroit, Mich.Detroit Country Day HS
Sophomore/Freshman (2011) ... did not see game action.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Detroit Country Day High School (2010) ... three-year varsity letterwinner ... two-time all-area and all-region selection by the Oakland Press... Detroit Free Press first-team All-State selection ...
Other Sports ... played two years of junior varsity basketball.
Personal ... Christopher Lee Eddins was born July 8, 1992 ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Dylan Esterline#42 • Tight End6-5 • 237 • So./Fr.Blissfield, Mich.Blissfield HS
Sophomore/Freshman (2011) ... did not see game action.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Blissfield High School (2010) ... dually enrolled in Siena Heights University dur-ing Fall 2009 and Adrian College in Winter 2010 ... Honors and Rankings ... two-time first team unani-mous all-league ... two-time all-county ... All-Toledo Blade selection as a junior ... played basketball for two years, was named second-team all-league and honorable mention all-county as a senior ... Honor Roll student all four years ... Lenawee County All-Academic selection in football, basketball and base-ball as junior and senior ... Other Sports ... played baseball as a senior, earning all-district and all-region distinctions ... member of National Honor Society.
Personal ... Dylan Craig Esterline was born April 8, 1992 ... son of Dennis and Renee Esterline ... both parents attended Penn Foster College ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Marell Evans **#51 • Linebacker6-3 • 237 • 5th-Sr.Richmond, Va.Varina HS
At Michigan ... two-year letterman ... appeared in 16 career games and started one contest at linebacker ... contributed four tackles and an assisted sack dur-ing his career ... switched from jersey #33 to #9 prior to 2008 fall camp ... switched from jersey #9 to #51 in spring 2011 ... special teams contributor.
Fifth-Year Senior (2011) ... did not see game action.
Senior (2010) ... attended Hampton University ... did not see game action.
Junior (2009) ... did not play football.
Sophomore (2008) ... earned second varsity let-ter ... played in 10 contests and made one start at linebacker ... saw action at linebacker in four games ... earned first career start at linebacker vs. Utah (Aug. 30), recording four tackles and half a sack ... contributed on special teams vs. Miami (Sept. 6) and at Notre Dame (Sept. 13) ... played special teams in Big Ten opener vs. Wisconsin (Sept. 27) ... contrib-uted on special teams vs. Illinois (Oct. 4) ... played at weakside linebacker and on special teams at Penn State (Oct. 18) ... contributed on special teams vs. Michigan State (Oct. 25) ... played at strong side linkebacker and on special teams at Purdue (Nov. 1)
... contributed on special teams at Minnesota (Nov. 8) ... did not see game action vs. Northwestern (Nov. 15) ... played weakside linebacker and on special teams at Ohio State (Nov. 22).
Freshman (2007) ... earned first varsity letter ... played special teams in six contests ... made road debut on special teams at Northwestern (Sept. 29) ... played special teams vs. Eastern Michigan (Oct. 6) ... saw action on punt return unit at Illinois (Oct. 20) and against Minnesota (Oct. 27) ... played special teams At Michigan State (Nov. 3) and Wisconsin (Nov. 10).
Prep ... attended Varina High School (2006) coached by Gary Chilcoat ... team won district and regional titles as a senior ... Key Statistics ... finished var-sity career with 142 tackles, 14 sacks, eight fumble recoveries and five interceptions, including one pick returned for a touchdown ... tallied 69 tack-les, eight sacks, five fumble recoveries and three interceptions during senior season ... recorded 66 tackles, seven tackles for loss and two interceptions as a junior ... Honors and Rankings ... three-star prospect and the No. 29 weak-side linebacker in the country according to Scout.com ... two-star recruit according to Rivals.com ... All-Region selection by PrepStar Magazine ... Richmond Times-Dispatch Defensive Player of the Year ... 2006 Central Region Co-Defensive Player of the Year by VirginiaPreps.com ... earned metro, region and district player of the year honors as a senior ... first-team all-metro, all-region, all-district and all-state as a senior ... first-team all-district as a junior ... Other Sports ... played guard and forward on the basketball team.
Personal ... Marell Valdezze Evans was born Jan. 9, 1989 ... high school teammate of former tail-back Brandon Minor ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
J.B. Fitzgerald ***#42 • Linebacker6-3 • 241 • Sr.Princeton Junction, N.J.West Windsor Plainsboro HS
At Michigan ... three-year letterman ... three-time Academic All-Big Ten ... appeared in 49 consecutive games and made three starts.
Senior (2011)... Academic All-Big Ten ... appeared in 12 games; played in eight games as a reserve line-backer and all 12 on special teams ... NEBRASKA (Nov. 19) ... recovered first career fumble on kickoff cover-age ... SAN DIEGO STATE (Sept. 24) ... tied season high with three tackles ... EASTERN MICHIGAN (Sept. 17) ... set season high with three tackles ... NOTRE DAME (Sept. 10) ... honorary senior game captain.
Junior (2010) ... earned third varsity letter ... Academic All-Big Ten ... appeared in all 13 games and made three starts ... 22 tackles, three tackles for loss and a sack ... played on special teams units vs. Connecticut (Sept. 4), assisting on a tackle ... saw special teams action at Notre Dame (Sept. 11) ... made his first appearance at outside linebacker and played on special teams vs. Massachusetts (Sept. 18), posting one solo tackle ... recorded one solo tackle as a reserve at outside line-backer and special teams vs. Bowling Green (Sept. 25) ... appeared at outside linebacker and special teams units in Big Ten opener at Indiana (Oct. 2) ... made one solo tackle as a reserve outside linebacker and on
special teams vs. Michigan State (Oct. 9) ... played as a reserve at outside linebacker and on special teams vs. Iowa (Oct. 16) ... recorded three assisted tackles as a reserve defensive end and on special teams at Penn State (Oct. 30) ... made one solo tackle in first career start at outside linebacker vs. Illinois (Nov. 6) ... four solo tackles, including one for loss, in start at outside linebacker against Purdue (Nov. 13) ... four stops as backup outside linebacker vs. Wisconsin (Nov. 20) ... appeared at outside linebacker and on special teams at Ohio State (Nov. 27) ... set career-high for tackles (six), tied career-high for tackles for loss (two), recorded first career sack in start at outside linebacker vs. Mississippi State (Jan. 1) in Gator Bowl.
Sophomore (2009) ... earned second varsity letter ... Academic All-Big Ten ... U-M Athletic Academic Achievement award ... played in all 12 games ... registered 16 tackles and four tackles for loss ... saw action at linebacker and on special teams vs. Western Michigan (Sept. 5), making one tackle ... contributed on special teams vs. Notre Dame (Sept. 12) ... assisted on one tackle at linebacker and played special teams vs. Eastern Michigan (Sept. 19) ... made one special teams tackle vs. Indiana (Sept. 26) ... played special teams At Michigan State (Oct. 3) ... assisted on a special teams stop against Iowa (Oct. 10) ... posted a team- and career-high five tackles and one TFL at linebacker and on special teams against Delaware State (Oct. 17) ... played linebacker and on special teams vs. Penn State (Oct. 24), assisting on a tackle ... contributed on special teams at Illinois (Oct. 31) ... matched career-high with five tackles at weakside linebacker vs. Purdue (Nov. 7) ... recorded career-high two TFLs against the Boilermakers ... played special teams at Wisconsin (Nov. 14) and vs. Ohio State (Nov. 21) ... made one TFL against the Buckeyes.
Freshman (2008) ... earned first varsity letter ... U-M Athletic Academic Achievement award ... appeared in all 12 games ... amassed eight tackles ... tallied six of his eight stops on special teams ... recorded two special teams tackles in his collegiate debut vs. Utah (Aug. 30) ... assisted on one special teams tackle vs. Miami (Sept. 6) ... assisted on one special teams stop at Notre Dame (Sept. 13) ... contributed on special teams vs. Wisconsin (Sept. 27) ... assisted on one special teams tackle vs. Illinois (Oct. 4) ... contributed on special teams vs. Toledo (Oct. 11) and at Penn State (Oct. 18) ... posted two special teams stops vs. Michigan State (Oct. 25) ... contributed on special teams at Purdue (Nov. 1) ... made defensive debut at middle linebacker at Minnesota (Nov. 8) ... contributed on special teams vs. Northwestern (Nov. 15) ... recorded one tackle playing middle linebacker at Ohio State (Nov. 22).
Prep ... attended West Windsor Plainsboro High School (2007) coached by Todd Smith ... carried 3.4 GPA ... Key Statistics ... posted 308 tackles, 11 sacks, four intercep-tions, 10 fumble recoveries, 10 forced fumbles in three varsity seasons ... amassed 125 tackles, two sacks, two interceptions and six fumble recoveries as a senior ... totaled 112 tackles, five sacks and two interceptions during his junior season ... hauled in 23 passes for 383 yards and two touchdowns during junior year ... recorded 71 tackles and four sacks as a sophomore ... caught 17 passes for 310 yards and scored two TDs sophomore year ... Honors and Rankings ... 2007 Gatorade Player of the Year for the state of New Jersey ... PrepStar Magazine All-American ... four-star prospect and the No. 10 linebacker by Scout.com ... four-star athlete and No. 18 player at his position by Rivals.com ... No. 2 prospect from New Jersey as selected by Rivals.com ... rated as the No. 141 overall player in the
country on the ESPN 150 rankings ...14th-best outside linebacker in the nation by ESPN.com ... listed as No. 9 player in the Northeast by G&W Recruiting Report ... picked by Tom Lemming as a top-300 player in the country ... all-conference, all-area and third-team All-South Jersey at linebacker as junior and senior.
Personal ... Joshua Brandon Fitzgerald was born Nov. 13, 1989 ... enrolled in the School of Kinesiology, majoring in sport management.
J.B. Fitzgerald’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2008 12/0 3-5-8 0-0 0-0 0-0 0-0 02009 12/0 10-6-16 4-8 0-0 0-0 0-0 02010 13/3 14-8-22 3-21 1-19 0-0 0-0 02011 12/0 4-6-10 0-0 0-0 0-0 1-0 0Career 49/3 31-25-56 7-29 1-19 0-0 1-0 0
J.B. Fitzgerald’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-2-2 0-0 0-0 0-0 0-0 0Notre Dame 1-0-1 0-0 0-0 0-0 0-0 0Eastern Michigan 2-1-3 0-0 0-0 0-0 0-0 0San Diego State 1-2-3 0-0 0-0 0-0 0-0 0Minnesota 0-0-0 0-0 0-0 0-0 0-0 0at Northwestern 0-0-0 0-0 0-0 0-0 0-0 0At Michigan State 0-0-0 0-0 0-0 0-0 0-0 0Purdue 0-0-0 0-0 0-0 0-0 0-0 0at Iowa 0-1-1 0-0 0-0 0-0 0-0 0at Illinois 0-0-0 0-0 0-0 0-0 0-0 0Nebraska 0-0-0 0-0 0-0 0-0 1-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 4-6-10 0-0 0-0 0-0 1-0 0
Fitzgerald’s Career Bests:Tackles: 6, vs. Mississippi State (Jan. 1, 2011)Solos: 4, twice (last at Purdue, Nov. 13, 2010)Asst: 3, twice (last vs. Mississippi State, Jan. 1, 2011)TFLs: 2, twice (last vs. Mississippi State, Jan. 1, 2011)Sacks: 1, vs. Mississippi State (Jan. 1, 2011)Int.: NoneFR: 1, vs. Nebraska (Nov. 19, 2011)PBUs: None
J.T. Floyd **#8 • Cornerback6-0 • 185 • Sr.-Jr.Greenville, S.C.J.L. Mann HS
At Michigan ... two-year varsity letterman ... posted 128 tackles, two TFLs, two forced fumbles, three interceptions and 13 pass breakups during his career ... surpassed 100 career tackles against Minnesota (Oct. 1, 2011) ... appeared in 30 contests and started 21 games at cornerback ... switched from #12 to #8 in between the 2010 and 2011 seasons.
Senior/Junior (2011) ... All-Big Ten honorable mention (coaches, media) ... appeared in all 12 games; 12 at cor-nerback, making 11 starts (Notre Dame, Eastern Michigan, San Diego State, Minnesota, Northwestern, Michigan State, Purdue, Iowa, Illinois, Nebraska, Ohio State), and 12 on special teams ... leads the team with eight PBUs and shares the team lead with two interceptions ... OHIO STATE (Nov. 26) ... tied season high with six tackles ... ILLINOIS (Nov. 12) ... posted four tackles, an interception and career-best-tying two PBUs ... returned third career interception for 43 yards, setting up a Michigan touchdown ... PURDUE (Oct. 29) ... tallied three tackles and matched career high with two PBUs ... MICHIGAN STATE (Oct. 15) ... made four tackles and notched second career forced fumble ... NOTRE DAME
(Sept. 10) ... registered season-high six tackles, second career interception and one pass break up in his first start of the season ... earned interception on the Michigan goal line to prevent a Fighting Irish scoring chance in the second quarter.
Junior/Sophomore (2010) ... earned second varsity letter ... started eight games at cornerback ... sixth in Big Ten in tackles per game with 66 stops (8.3 avg.) ... also registered two tackles for loss, one interception, five pass breakups and one forced fumble ... made start at cornerback vs. Connecticut (Sept. 4), recording career-high six stops and forced a fumble that thwarted a Huskies’ drive inside the Michigan five-yard line ... had five tackles and his first career interception in start at cornerback against Notre Dame (Sept. 11) ... made eight tackles in start at cornerback vs. Massachusetts (Sept. 18) ... tallied three solo tackles and broke up a pass in start vs. Bowling Green (Sept. 25) ... post-ed first double-digit tackle performance in start at Indiana (Oct. 2), recording 13 tackles, including his first career tackle for loss, and one PBU ... matched his career-high with 13 tackles, including one for a three-yard loss, in start vs. Michigan State (Oct. 9) ... had third consecutive double-digit tackle performance in start vs. Iowa (Oct. 16), making a team-high 11 stops ... finished the game at Penn State (Oct. 30) with seven tackles and a career-high two pass breakups as a starting cornerback ... suffered a season-ending ankle injury in practice prior to the Illinois (Nov. 6) contest.
Sophomore/Freshman (2009) ... earned first varsity letter ... played in nine games and made two starts at corner-back ... contributed 17 tackles and one pass breakup ... made career debut at cornerback and on special teams vs. Western Michigan (Sept. 5), making three solo tackles ... appeared at cornerback and on special teams vs. Notre Dame (Sept. 12) ... made the game-ending tackle to secure a victory against the Irish ... saw action at cornerback and on special teams vs. Eastern Michigan (Sept. 19) ... recorded a career-high four tackles at cornerback vs. Indiana (Sept. 26) ... made first career start At Michigan State (Oct. 3), tallying four solo stops and first career PBU ... saw action on special teams at Iowa (Oct. 10) ... did not see game action vs. Delaware State (Oct. 17) or Penn State (Oct. 24) ... appeared at cornerback against Illinois (Oct. 31) ... did not see game action vs. Purdue (Nov. 7) ... contributed two tack-les from cornerback spot at Wisconsin (Nov. 14) ... started at cornerback vs. Ohio State (Nov. 21), posting three stops.
Freshman (2008) ... did not see game action.
Prep ... attended J. L. Mann High School (2008) coached by Mickey Crocker ... four-year letterman ... carried a 3.75 grade point average ... received the football academic achieve-ment award as a freshman ... Key Statistics ... tallied 139 solo tackles and 13 interceptions, while making 127 catches for 2,208 yards and 16 touchdowns ... posted 63 stops, eight pass breakups and one interception as a senior ... caught 50 passes for 875 yards and nine touchdowns senior year ... made 50 tackles and five interceptions as a junior ... Honors and Rankings ... three-star prospect according to Rivals.com ... No. 20 player in the state of South Carolina by Rivals.com ... three-star prospect and the nation’s No. 75 safety according to Scout.com ... top-300 player in the country by Tom Lemming ... named all-state first team at wide receiver senior year and at defensive back junior year ... first-team all-county at both receiver and defensive back as a senior and at defensive back as a junior ... Peach Blossom Conference All-Region first team honoree as a senior.
Personal ... James Thomas Floyd III was born Dec. 8, 1989 ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
J.T. Floyd’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 9/2 14-3-17 0-0 0-0 0-0 0-0 12010 8/8 43-23-66 2-5 0-0 1-0 0-0 42011 12/11 30-15-45 0-0 0-0 2-59 0-0 8Career 29/21 87-41-128 2-5 0-0 3-59 0-0 13
J.T. Floyd’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 1-2-3 0-0 0-0 0-0 0-0 1Notre Dame 5-1-6 0-0 0-0 1-16 0-0 1Eastern Michigan 1-2-3 0-0 0-0 0-0 0-0 0San Diego State 2-1-3 0-0 0-0 0-0 0-0 1Minnesota 2-0-2 0-0 0-0 0-0 0-0 0at Northwestern 3-2-5 0-0 0-0 0-0 0-0 0at Michigan State 3-1-4 0-0 0-0 0-0 0-0 0Purdue 2-1-3 0-0 0-0 0-0 0-0 2at Iowa 4-0-4 0-0 0-0 0-0 0-0 0at Illinois 2-2-4 0-0 0-0 1-43 0-0 2Nebraska 2-0-2 0-0 0-0 0-0 0-0 1Ohio State 3-3-6 0-0 0-0 0-0 0-0 0Season Totals 30-15-45 0-0 0-0 2-59 0-0 8
Floyd’s Career Bests:Tackles: 13, twice (last vs. Michigan State, Oct. 9, 2010)Solos: 10, vs. Michigan State (Oct. 9, 2010)Asst: 6, at Indiana (Oct. 2, 2010)TFLs: 1, twice (last vs. Michigan State, Oct. 9, 2010)Sacks: NoneInt.: 1, three times (last at Ilinois, Nov. 12, 2011)FR: NonePBUs: 2, three times (last at Illinois, Nov. 12, 2011)
Josh FurmaN#14 • Safety6-2 • 208 • So.-Fr.Annapolis, Md.Old Mill Senior HS
Sophomore/Freshman (2011) ... appeared in all 12 games; two as a reserve safety and all 12 on special teams ... NEBRASKA (Nov. 19) ... posted two solo tackles and first career blocked punt ... EASTERN MICHIGAN (Sept. 17) ... made first collegiate tackle on special teams ... WESTERN MICHIGAN (Sept. 3) ... made collegiate debut on special teams.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Old Mill Senior High School (2010) coached by Damian Ferragamo ... led team to state cham-pionship as a senior ... team compiled a 30-7 record during his career ... played running back and defensive back ... timed at 4.36 seconds in the 40-yard dash ... has a 38.5-inch vertical jump ... Key Statistics ... posted 60 tackles, nine tackles for loss, three sacks, three forced fumbles, three interceptions and two fumble recoveries during senior year ... carried the ball 239 times for 2,285 yards and scored 31 touchdowns in 11 games as a senior ... rushed 42 times for 414 yards and six touchdowns in a 58-55 double-overtime victory against Arundel High School in the playoffs as a senior ... carried the ball 105 times for 796 yards and 14 TDs junior year ... recorded 87 tackles, 25 TFLs, eight sacks, six forced fumbles and two blocked punts as a junior ... Honors and Rankings ... four-star recruit and the No. 19 safety prospect nationally by Scout.com ... three-star pros-pect and the No. 38 athlete nationally according to Rivals.com ... rated 10th-best player in the state of Maryland by Rivals.com ... four-star and the seventh-best safety nation-ally according to scout.com ... SuperPrep All-American and rated as the No. 9 player in the Mid-Atlantic region ... three-star prospect and the nation’s No. 38 outside linebacker according to Scouts, Inc. ... consensus all-state first team as
a senior and a second-team honoree as a junior ... Capital-Gazette Communications’ Co-Football Players of the Year as a senior ... The Baltimore Sun Co-Offensive Player of the Year senior season ... Rhodes Trophy winner as the Anne Arundel County Player of the Year as a senior ... Pigskin Review County Defensive Player of the Year senior year ... selected to participate in the Maryland Crab Bowl All-Star Game but was unable to play due to injury ... first-team all-county as a junior and senior ... Other Sports ... ran track as sophomore and junior ... Personal-best times of 10.82 in the 100m and 22.84 in the 200m ... also competed on the 4x100 and 4x200 relay teams.
Personal ... Joshua Richard Furman was born Nov. 1, 1991 ... father, Tyrone, played football at Maryland ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Josh Furman’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2011 11/0 5-5-10 0-0 0-0 0-0 0-0 0Career 11/0 5-5-10 0-0 0-0 0-0 0-0 0
Josh Furman’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-0-0 0-0 0-0 0-0 0-0 0Notre Dame - - - - - -Eastern Michigan 1-0-1 0-0 0-0 0-0 0-0 0San Diego State 1-1-2 0-0 0-0 0-0 0-0 0Minnesota 1-2-3 0-0 0-0 0-0 0-0 0at Northwestern 0-1-1 0-0 0-0 0-0 0-0 0At Michigan State 0-0-0 0-0 0-0 0-0 0-0 0Purdue 0-0-0 0-0 0-0 0-0 0-0 0at Iowa 0-1-0 0-0 0-0 0-0 0-0 0at Illinois 0-0-0 0-0 0-0 0-0 0-0 0Nebraska 2-0-2 0-0 0-0 0-0 0-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 5-5-10 0-0 0-0 0-0 0-0 0
Jeremy galloN *#10 • Wide Receiver5-8 • 185 • Jr./So.Apopka, Fla.Apopka HS
Junior/Sophomore (2011) ... appeared in all 12 games; 12 at wide receiver, making one start (Minnesota); played in all 12 games on special teams, 12 at punt returner and 11 at kick returner ... team’s second leading receiver with 30 receptions for 499 yards ... NEBRASKA (Nov. 19) ... caught a team-high three passes for 34 yards and a touchdown ... fielded a career-high-matching four punts for 27 yards ... ILLINOIS (Nov. 12) ... set career highs for punt returns (4), punt return yards (62) and punt return long (32) ... PURDUE (Oct. 29) ... snagged a team-high three passes for a career-high 79 yards and added an 11-yard run on a reverse ... NORTHWESTERN (Oct. 8) ... set career high with five recep-tions for 73 yards and a touchdown... MINNESOTA (Oct. 1) ... caught four passes for 46 yards in first career start ... NOTRE DAME (Sept. 10) ... recorded two receptions for 78 yards, including one touchdown and a career-best 64-yard recep-tion to set up the game-winning touchdown.
Sophomore/Freshman (2010) ... earned first varsity letter ... started at punt returner in 10 games ... saw action at slot receiver in seven contests and kick returner in six contests ... caught four passes for 49 yards and a touchdown ... posted 10 punt returns for 43 yards and 27 kick returns for 589 yards ... made collegiate debut at punt returner vs. Connecticut (Sept. 4), returning one punt for seven yards ... saw game action at punt returner against Notre Dame (Sept. 11) ... had one punt return vs. Massachusetts (Sept. 18) ... played as a backup slot receiver against UMass ...
caught two passes for 25 yards as a reserve at slot receiver vs. Bowling Green (Sept. 25), scoring a touchdown on his first collegiate reception for 11 yards ... returned two punts for 22 yards in start at punt returner against the Falcons ... started at punt returner and appeared as reserve slot receiver in Big Ten opener at Indiana (Oct. 2) ... returned four kickoffs for 91 yards in start at kick and punt returner vs. Michigan State (Oct. 9) ... amassed 147 all-purpose yards -- 118 on six kick returns, 24 on two receptions and five on three punt returns -- in start as kick and punt returner vs. Iowa (Oct. 16) ... set new career-long with 20-yard reception in the second quarter against the Hawkeyes ... returned five kickoffs for 124 yards, including career-long 47-yard kick return, and finished the game with 136 all-purpose yards in start at Penn State (Oct. 30) ... had eight returns -- seven punt and one kickoff -- for 153 all-purpose yards in start vs. Illinois (Nov. 6) ... appeared as a reserve slot receiver against the Fighting Illini ... started at punt returner and kick returner at Purdue (Nov. 13), returning three kickoffs for 54 yards ... saw playing time as a reserve slot receiver against the Boilermakers ... started at kick returner vs. Wisconsin (Nov. 20), returning two kickoffs for 62 yards ... missed Ohio State (Nov. 27) game due to injury ... appeared as reserve slot receiver vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Apopka High School (2009) coached by Rick Darlington ... played quarterback, running back and safety ... led team to Class 6A state semifinals as a junior ... ran the 40-yard dash in 4.3 seconds ... three-year varsity let-terman ... Key Statistics ... gained 4,281 yards on 570 carries (7.5 avg.) and scored 53 touchdowns during his career ... completed 80-of-141 passes for 1,624 yards and 15 TDs in career ... rushed for 1,830 yards on 240 carries and scored 23 touchdowns as a senior ... completed 24-of-53 passes for 553 yards and seven TDs senior year ... carried the ball 219 times for 1,613 yards and scored 23 TDs as a junior ... completed 56-of-88 passes for 1,071 yards and eight touchdowns junior year ... rushed for 800 yards on 112 carries as a sophomore ... Honors and Rankings ... four-star prospect and the nation’s No. 11 wide receiver according to Rivals.com ... rated as 31st overall player in the state of Florida by Rivals.com ... selected as 151st overall prospect nationally according to Rivals.com ... graded as fifth-best athlete nationally in terms of ball skills by Rivals.com ... Prep Star All-American and named to the publication’s Top 250 ... three-star prospect and the nation’s 45th-best wide receiver according to scout.com ... listed as the 46th-best prospect in the state of Florida by SuperPrep ... U.S. Army All-American game participant ... Class 6A all-state first team as a junior and senior ... first-team All-Central Florida by the Orlando Sentinel as a junior and senior ... named Orlando Sentinel’s Offensive Player of the Year as a junior.
Personal ... Jeremy Jermaine Gallon was born February 9, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in sociology.
Jeremy Gallon’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 12/0 4 49 12.3 7.0 1 202011 12/1 30 450 15.0 37.5 3 64Career 24/1 34 499 14.7 20.8 4 64
Jeremy Gallon’s Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan 2 14 7.0 0 13Notre Dame 2 78 39.0 1 64Eastern Michigan 3 43 14.3 0 24San Diego State 1 8 8.0 0 8Minnesota 4 46 11.5 0 17at Northwestern 5 73 14.6 1 25at Michigan State 3 43 14.3 0 32Purdue 3 79 26.3 0 42
at Iowa 1 13 13.0 0 13at Illinois 1 8 8.0 0 8Nebraska 3 34 11.3 1 23Ohio State 2 11 5.5 0 8Season Totals 30 450 15.0 3 64
Jeremy Gallon’s Career Kick Return StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 12/0 27 589 21.8 98.2 0 472011 12/1 3 46 15.3 3.8 0 20 Career 24/1 30 635 21.2 26.5 0 47
Jeremy Gallon’s Career Punt Return StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 12/0 10 43 4.3 3.6 0 152011 12/1 19 192 10.1 17.5 0 32Career 24/1 29 235 8.1 10.2 0 32
Gallon’s Career Bests:ReceivingReceptions: 5, at Northwestern (Oct. 8, 2011)Yards: 79, vs. Purdue (Oct. 29, 2011)TDs: 1, four times (last vs. Nebraska, Nov. 19, 2011)Long: 64, vs. Notre Dame (Sept. 10, 2011)
Kick ReturnsAttempts: 7, vs. Illinois (Nov. 6, 2010)Yards: 139, vs. Illinois (Nov. 6, 2010)TDs: NoneLong: 47, at Penn State (Oct. 30, 2010)
Punt ReturnsAttempts: 4, twice (last vs. Nebraska, Nov. 19, 2011)Yards: 62, at Illinois (Nov. 12, 2011)TDs: NoneLong: 32, at Illinois (Nov. 12, 2011)
deviN gardNer #7 • Quarterback6-4 • 205 • So.Detroit, Mich.Inkster HS
Sophomore (2011) ... appeared in nine games at quarter-back ... ILLINOIS (Nov. 12) ... completed 2-of-5 passes for 47 yards and a touchdown, while rushing for nine yards ... connected with Martavious Odoms for 27-yard score in the fourth quarter ... NORTHWESTERN (Oct. 8) ... completed both of his passes for 25 yards and earned two carries for four yards and the go-ahead rushing touchdown in the third quarter ... MINNESOTA (Oct. 1) ... set career highs for rushing yards (39) and rushing long (15) on six carries.
Freshman (2010) ... appeared in three contests at quar-terback ... made collegiate debut vs. Connecticut (Sept. 4), taking two snaps at quarterback ... took one snap as a reserve quarterback at Notre Dame (Sept. 11) ... did not see game action vs. Massachusetts (Sept. 18) ... completed 7-of-10 passes for 85 yards and a touchdown as a reserve at quarterback vs. Bowling Green (Sept. 25), scoring his first career touchdown on an 11-yard pass to Jeremy Gallon in the first quarter ... had six carries for 25 yards and a touch-down against the Falcons, scoring on a seven-yard rush in the fourth quarter.
Prep ... attended Inkster High School (2009) coached by Greg Carter ... led team to the Division 2 final as a senior ... runner-up for Division 3 state championship as a junior ... Key Statistics ... passed for 1,930 yards and 15 touchdowns as a senior ... added 991 rushing yards and scored 12 TDs senior year ... completed 98-of-170 passes for 1,886 yards and 26 touchdowns as a junior ... rushed 115 times for 1,401 yards and 22 TDs junior year ... passed for 1,000 yards and
rushed for nearly 500 yards as a sophomore ... Honors and Rankings ... Parade Magazine All-American ... rated as the nation’s top dual-threat quarterback by Rivals.com ... top player in the state of Michigan and the No. 132 prospect in the country according to Rivals.com ... five-star prospect, the No. 2 player in the state of Michigan and the No. 5 quarterback nationally according to scout.com ... attended Elite 11 quarterback camp ... participated in Under Armour All-American game ... listed as the 128th prospect nation-ally on the ESPNU 150 ... two-time all-state first team (junior and senior years) ... No. 2 player on The Detroit News Blue Chip list ... listed as No. 3 player in the state of Michigan by the Detroit Free Press ... SuperPrep All-American and the No. 9 player in the Midwest ... four-star and the nation’s No. 5 quarterback according to Scouts, Inc. ... Prep Star Dream Team member and the 75th overall prospect in the country ... Other Sports ... averaged 12 points and 14 rebounds per game as a junior ... helped lead team to state semifinals and a 25-2 record junior year.
Personal ... Devin Gardner was born Dec. 14, 1991 ... high school teammate of U-M linebacker Cameron Gordon ... appeared in the Faces in the Crowd section of the Nov. 16, 2009 issue of Sports Illustrated ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Devin Gardner’s Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2010 3/0 7 21 3.0 7.0 1 92011 9/0 25 65 2.6 9.3 1 15Career 12/0 32 86 2.7 8.6 2 15
Devin Gardner’s Game-by-Game Rushing Statistics2011 Opponent Att. Yards Avg. TD LongWestern Michigan - - - - - Notre Dame - - - - - Eastern Michigan 1 7 7.0 0 7 San Diego State - - - - - Minnesota 6 39 6.5 0 15 at Northwestern 2 4 2.0 1 3 at Michigan State 6 -15 - 0 5Purdue 3 9 3.0 0 5at Iowa 5 12 2.4 0 5at Illinois 2 9 4.5 0 5Nebraska 0 0 0.0 0 0Ohio State 0 0 0.0 0 0Season Total 25 65 2.6 1 15
Devin Gardner’s Career Passing StatisticsYear GP/GS Comp. Att. Pct. Yards TD Int. Long2010 3/0 7 10 70.0 85 1 0 302011 9/0 11 23 47.8 176 1 1 32Career 12/0 18 33 54.5 261 2 1 32
Devin Gardner’s Game-by-Game Passing Statistics2011 Opponent Att. Comp. Pct. Yards TD Int. LongWestern Michigan - - - - - - -Notre Dame - - - - - - -Eastern Michigan 0 0 0.0 0 0 0 0San Diego State - - - - - - -Minnesota 5 2 40.0 31 0 0 17at Northwestern 2 2 100.0 25 0 0 19at Michigan State 7 3 42.9 45 0 0 32Purdue 2 1 50.0 26 0 1 26at Iowa 1 1 100.0 2 0 0 2at Illinois 5 2 40.0 47 1 0 27Nebraska 1 0 0.0 0 0 0 0Ohio State 0 0 0.0 0 0 0 0Season Totals 23 11 47.8 176 1 1 32
Gardner’s Career Bests:PassingAttempts: 10, vs. Bowling Green (Sept. 25, 2010)Completions: 7, vs. Bowling Green (Sept. 25, 2010)Yards: 85, vs. Bowling Green (Sept. 25, 2010)
TDs: 1, twice (last at Illinois, Nov. 12, 2011)Long: 32, at Michigan State (Oct. 15, 2011)
RushingAttempts: 6, 3x (last at Michigan State (Oct. 15, 2011)Yards: 39, vs. Minnesota (Oct. 1, 2011)TDs: 1, twice (last at Northwestern, Oct. 8, 2011)Long: 15, vs. Minnesota (Oct. 1, 2011)
BreNdaN giBBoNs *#34 • Placekicker6-1 • 241 • Jr.-So.West Palm Beach, Fla.Cardinal Newman HS
Junior/Sophomore (2011)... started all 12 games at place-kicker ... OHIO STATE (Nov. 26) ... reset career long with a 43-yard field goal with two minutes left in the fourth quarter to give U-M a six-point lead ... NEBRASKA (Nov. 19) ... drilled a career-best, 42-yard field goal into the wind in the first quarter ... ILLINOIS (Nov. 12) ... made a 27-yard field goal in the third quarter and converted all four PATs ... IOWA (Nov. 5) ... converted only field goal attempt from 32 yards out ... PURDUE (Oct. 29) ... made both of his field goal attempts (37, 22 yards) and all four of his PATs ... MINNESOTA (Oct. 1) ... set career highs for points (16), field goals attempted (3), field goals made (3), PATs (7) and field goal long (38) ... made all three field goal attempts from 25, 32 and 38 yards out ... EASTERN MICHIGAN (Sept. 17) ... made a 21-yard field goal in his only attempt.
Sophomore/Freshman (2010) ... earned first varsity letter ... appeared in seven games ... served as placekicker in five contests with four starts ... converted 1-of-5 field goals and 13-of-14 PATs ... served as kickoff specialist in four contests ... recorded three touchbacks ... made career debut as start-ing kicker and kickoff specialist vs. Connecticut (Sept. 4) ... hit a 24-yard field goal and converted 3-of-4 PATs against the Huskies ... converted three PATs at Notre Dame (Sept. 11) ... starting kickoff specialist vs. Massachusetts (Sept. 18) ... did not see game action against Bowling Green (Sept. 25) and Indiana (Oct. 2) ... had one kickoff vs. Michigan State (Oct. 9) ... did not see game action against Iowa (Oct. 16), Penn State (Oct. 30), Illinois (Nov. 6) and Purdue (Nov. 13) ... made all four of his PAT tries as a reserve placekicker vs. Wisconsin (Nov. 20) ... knocked through one PAT in start at Ohio State (Nov. 27) ... missed a 35-yard field goal attempt and made two PATs in start vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... U-M Athletic Academic Achievement award ... redshirted ... did not see game action.
Prep ... attended Cardinal Newman High School (2009) coached by Don Dicus ... left-footed kicker ... played defen-sive end, fullback and linebacker during his career ... two-year varsity letterman ... Key Statistics ... hit 16-of-21 career field goals ... notched touchbacks on 90 percent of his kick-offs in his two years ... converted 10 of his 12 field goals with a long of 52 yards as a senior, seven of which were from 40 yards or longer ... 93 percent of his kickoffs went for touch-backs senior year ... connected on six-of-10 field goals and 26-of-28 PATs as a junior ... Honors and Rankings ... shared the 2008 Lou Groza Award as the Palm Beach County High School Place-Kicker of the Year Award ... finalist for the Lou Groza Award as a junior ... named to the Special Teams Solutions Elite Class of 2009 ... recipient of the 2009 High School Maxwell Award for his excellence on the field and in the community ... rated as the No. 8 kicker in the nation by Rivals.com ... two-star prospect by Rivals.com ... three-star prospect and the No. 11 kicker nationally according to scout.com ... listed as 17th-best kicker in the country according to Scouts, Inc. ... Palm Beach Post Small Schools
All-Area first team as a senior ... All-Southeast region selec-tion by Prep Star ... hit a 35-yard field goal and three-of-four PATs in the U.S. Army All-American game ... first-team all-conference and all-county as a junior and senior ... first-team all-state following junior and senior years ... Other Sports ... three-year varsity letterman in soccer.
Personal ... Brendan Michael Gibbons was born August 15, 1991 ... father, Shawn, was a national champion in judo (1977, 1979) ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Brendan Gibbons’ Career Field Goal StatisticsYear GP FM-FA Pct. PATs Long Points2010 7 1-5 20.0 13-14 24 162011 12 10-14 71.4 52-53 43 82Career 19 11-19 57.9 65-67 43 98
Brendan Gibbons’ Game-by-Game Field Goal Statistics2011 Opponent 10-29 30-39 40-55 Total Long PAT PtsWestern Michgian 0-0 0-0 0-0 0-0 0 4-5 4Notre Dame 0-0 0-0 0-0 0-0 0 5-5 5Eastern Michigan 1-1 0-0 0-0 1-1 21 4-4 7San Diego State 0-0 0-0 0-1 0-1 0 4-4 4Minnesota 1-1 2-2 0-0 3-3 38 7-7 16at Northwestern 0-0 0-0 0-1 0-1 0 6-6 6At Michigan State 0-0 0-0 0-0 0-0 0 2-2 2Purdue 1-1 1-1 0-0 2-2 37 4-4 10at Iowa 0-0 1-1 0-0 1-1 32 1-1 4at Illinois 1-1 0-1 0-0 1-2 27 4-4 7Nebraska 0-0 0-0 1-2 1-2 42 6-6 9Ohio State 0-0 0-0 1-1 1-1 43 5-5 8Season Totals 4-4 4-5 2-5 10-14 43 52-53 82
Gibbons’ Career Bests:Points: 16, vs. Minnesota (Oct. 1, 2011)FG Att.: 3, vs. Minnesota (Oct. 1, 2011)FGs Made: 3, vs. Minnesota (Oct. 1, 2011)PATs: 7, vs. Minnesota (Oct. 1, 2011)Long FG: 43, vs. Ohio State (Nov. 26, 2011)
Jareth glaNda#54 • Long Snapper6-3 • 255 • Jr.-So.Rochester Hills, Mich.Brother Rice HS
Junior/Sophomore (2011)... Academic All-Big Ten ... has appeared in all 12 games as a short snapper on special teams.
Sophomore/Freshman (2010) ... made collegiate debut as a reserve at long snapper vs. Bowling Green (Sept. 25).
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Brother Rice High School (2009) coached by Al Fracassa ... National Honor Society member ... Honors and Rankings ... all-area, all-metro, all-county and All-Catholic League selection as a senior ... Other Sports ... participated in swimming, hockey and baseball ... earned all-state honors in hockey as a senior ... received most valu-able goalie in the state award senior year ... second-team all-state selection in hockey as a junior.
Personal ... Jareth William Glanda was born February 6, 1991 ... enrolled in the School of Kinesiology, majoring in movement science.Jareth Glanda’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 1/0 0-0-0 0-0 0-0 0-0 0-0 02011 12/0 0-0-0 0-0 0-0 0-0 0-0 0Career 13/0 0-0-0 0-0 0-0 0-0 0-0 0
cam gordoN * #4 • Linebacker6-3 • 222 • Jr.-So.Detroit, Mich.Inkster HS
At Michigan ... Two-time Academic All-Big Ten ... switched from wide receiver to safety prior to 2010 spring drills ... switched from safety to outside linebacker prior to 2011 spring drills.
Junior/Sophomore (2011) ... Academic All-Big Ten ... appeared in six games; played one game at strongside linebacker and six games on special teams ... MICHIGAN STATE (Oct. 15) ... made season debut on special teams, making one solo tackle, after missing the first five games with a back injury.
Sophomore/Freshman (2010) ... earned first varsity let-ter ... Academic All-Big Ten ... CollegeFootballNews.com Freshman All-America second team ... started all 13 games -- seven at free safety and six at hybrid linebacker ... regis-tered 77 tackles, 3.5 TFLs, three interceptions, four PBUs, two fumble recoveries, one blocked kick and a defensive touchdown ... tied for the team lead in interceptions, PBUs and fumble recoveries ... made collegiate debut as team’s starting free safety vs. Connecticut (Sept. 4), recording five tackles and one pass breakup ... stopped a UConn scoring chance by blocking a first quarter field goal attempt ... had seven tackles in start at free safety against Notre Dame (Sept. 11) ... made six tackles and returned his first career interception 16 yards in start at free safety vs. Massachusetts (Sept. 18) ... tallied six stops in start vs. Bowling Green (Sept. 25) ... amassed a career- and game-high 15 tackles, including one for a loss, an interception and a pass breakup in start at Indiana (Oct. 2) ... picked off a Hoosier pass in his own end zone and returned it 19 yards to prevent an IU scoring chance ... tallied seven tackles in start vs. Michigan State (Oct. 9) ... five tackles in start vs. Iowa (Oct. 16) ... three tackles and a PBU as the starting hybrid linebacker at Penn State (Oct. 30) ... nine tackles and a pass breakup in start at hybrid linebacker vs. Illinois (Nov. 6) ... recovered two fumbles, including one returned 58 yards for Michigan’s first touchdown, in start at hybrid linebacker against Purdue (Nov. 13) ... posted five tackles in start at hybrid linebacker vs. Wisconsin (Nov. 20) ... recorded five tackles, including one for a loss of two yards, in start at hybrid linebacker against Ohio State (Nov. 27) ... notched four tackles, a career-high 1.5 tackles for loss and an inter-ception vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Inkster High School (2009) coached by Greg Carter ... three-year starter on defense ... starter at linebacker for Melvindale High School as a sophomore and junior before transferring to Inkster during senior year ... helped lead Inkster to state championship game as a senior ... ran 40-yard dash in 4.6 seconds ... Key Statistics ... caught 106 passes for 1,703 yards and scored nine touch-downs during his career ... tallied 171 tackles, 6.5 sacks, six interceptions, six fumble recoveries and blocked two punts in his career ... registered 126 tackles, five sacks, five inter-ceptions and three fumble recoveries from strong safety position as a senior ... caught 49 passes for 863 yards and eight touchdowns senior year ... caught four passes for 58 yards and one TD in state championship game against East Grand Rapids, including a pair of two-point conversions and six tackles on defense ... caught 38 passes for 532 yards as a junior ... made 19 receptions for 308 yards and one TD sophomore year ... notched 45 tackles and 1.5 sacks as a sophomore ... Honors and Rankings ... four-star prospect by Rivals.com ... listed as No. 36 wide receiver in the country by Rivals.com ... rated sixth-best prospect in the state of
Michigan and 233rd overall player nationally by Rivals.com ... three-star prospect and nation’s No. 82 wide receiver by scout.com ... Prep Star All-American and named to the publication’s Top 250 ... listed as 50th-best prospect in the Midwest by SuperPrep ... selected to The Detroit News Blue Chip list ... received Division 3 first-team all-state accolades at defensive back as a senior ... All-West first team pick by the Detroit Free Press senior year ... second-team all-state as a junior ... rated as No. 60 athlete nationally by Scouts, Inc.
Personal ... Cameron Calvin Gordon was born June 5, 1991 ... high-school teammate with current Wolverine Devin Gardner ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Cam Gordon’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 13/13 40-37-77 3.5-6 0-0 3-35 2-58 42011 6/0 2-1-3 0-0 0-0 0-0 0-0 0Career 19/13 42-38-80 3.5-6 0-0 3-35 2-58 4
Cam Gordon’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan - - - - - -Notre Dame - - - - - - Eastern Michigan - - - - - -San Diego State - - - - - -Minnesota - - - - - -at Northwestern - - - - - -at Michigan State 1-0-1 0-0 0-0 0-0 0-0 0Purdue 0-1-1 0-0 0-0 0-0 0-0 0at Iowa 0-0-0 0-0 0 0-0 0-0 0at Illinois 0-0-0 0-0 0-0 0-0 0-0 0Nebraska 0-0-0 0-0 0-0 0-0 0-0 0Ohio State 1-0-1 0-0 0-0 0-0 0-0 0Season Totals 2-1-3 0-0 0-0 0-0 0-0 0
C. Gordon’s Career Bests:Tackles: 15, at Indiana (Oct. 2, 2010)Solos: 12, at Indiana (Oct. 2, 2010)Asst: 5, twice (last vs. Illinois, Nov. 6, 2010)TFLs: 1, twice (last at Ohio State, Nov. 27, 2010)Sacks: NoneInt.: 1, three times (last vs. Mississippi State, Jan. 1, 2011)FR: 2, at Purdue (Nov. 13, 2010)PBUs: 1, five times (last vs. Illinois, Nov. 6, 2010)
thomas gordoN * #30 • Safety5-11 • 208 • Jr.-So. Detroit, Mich.Cass Tech HS
Junior/Sophomore (2011)... appeared in all 12 games; played 11 games at free safety, starting nine games (Western Michigan, Notre Dame, Eastern Michigan, San Diego State, Minnesota, Northwestern, Michigan State, Purdue, Nebraska) and played all 12 on special teams ... team’s third leading tackler with 59 tackles ... recovered a Big Ten-best four fumbles ... ILLINOIS (Nov. 12) ... made two tackles, recovered a fumble and broke up second career pass ... recovered a Big Ten-best fourth fumble of the season ... MICHIGAN STATE (Oct. 15) ... led the team with eight tackles, including an assisted tackle-for-loss, and recorded a forced fumble for the second straight week ... NORTHWESTERN (Oct. 8) ... recorded six tackles, forced and recovered the same fumble ... SAN DIEGO STATE (Sept. 24) ... tied for the team lead in tackles with seven, recovered a fumble for the second straight week and broke up first career pass ... EASTERN MICHIGAN (Sept. 17) ... notched six tackles and earned first career fumble recovery and first career interception ... made the interception with one hand after the Eagles tried complete a trick pass play ... NOTRE
DAME (Sept. 10) ... set career best with nine tackles.
Sophomore/Freshman (2010) ... earned first varsity let-ter ... started four games and appeared in nine contests at hybrid linebacker ... tallied 23 tackles, four TFLs and two sacks ... made collegiate debut as a reserve hybrid linebacker and on special teams vs. Connecticut (Sept. 4), recording two assisted tackles ... made first career start at hybrid linebacker against Notre Dame (Sept. 11), posting a career-high five tackles, two TFLs and Michigan’s first sack of the season for an 11-yard loss ... had three tackles, includ-ing one for a loss of two yards, in start vs. Massachusetts (Sept. 18) ... registered one tackle in start vs. Bowling Green (Sept. 25) ... accumulated two stops as a reserve strongside linebacker in Big Ten opener at Indiana (Oct. 2) ... recorded five tackles in start vs. Michigan State (Oct. 9) ... assisted on a tackle as a reserve at strongside linebacker vs. Iowa (Oct. 16) ... posted three tackles, inlcuding a sack for a 10-yard loss, as a reserve hybrid linebacker at Penn State (Oct. 30) ... made one solo tackle as a backup hybrid linebacker vs. Illinois (Nov. 6) ... did not see game action at Purdue (Nov. 13), vs. Wisconsin (Nov. 20) and at Ohio State (Nov. 27) ... did not play vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Cass Technical School (2009) coached by Thomas Wilcher ... National Honor Society member ... three-year starter at quarterback ... also played safety during career ... three-year varsity letterman ... ran 40-yard dash in 4.45 seconds ... Key Statistics ... made 30 consecutive starts at quarterback during his final three seasons ... threw for 2,917 yards and ran for 2,051 yards during his three-year career ... registered 89 tackles and five interceptions during his career ... passed for 1,347 yards and 12 touchdowns senior year ... rushed for 1,128 yards and 11 TDs as a senior ... recorded 57 tackles and three interceptions senior year ... threw for 850 yards and nine TDs and rushed for 550 yards as a junior ... passed for 720 yards and ran for 373 yards during his sophomore campaign ... Honors and Rankings ... PrepStar All-American ... three-star prospect and the No. 24 overall prospect in the state of Michigan by Rivals.com ... The Detroit News Blue Chip list ... selected as No. 42 over-all prospect in the Midwest by SuperPrep ... All-Midwest region by Prep Star ... two-star performer according to scout.com ... rated 115th-best safety in the country by scout.com ... all-city, all-metro and all-state as a senior ... second-team all-city junior year ... Other Sports ... played basketball and ran track ... averaged seven points and two assists per game as a sophomore ... all-city and all-state in the 4x100 relay and 110m hurdles as a junior.
Personal ... Thomas Lee Gordon was born March 20, 1991 ... father, Jessie, played basketball at Long Beach State (1980-82) ... high school teammate of current Wolverines William Campbell and Delonte Hollowell ...enrolled in the School of Kinesiology, majoring in movement science.
Thomas Gordon’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 9/4 13-10-23 4-24 2-21 0-0 0-0 02011 12/9 37-22-59 1.5-2 0-0 1-0 4-0 2Career 21/13 50-32-82 5.5-26 2-21 1-0 4-0 2
Thomas Gordon’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 5-3-8 1-2 0-0 0-0 0-0 0Notre Dame 4-5-9 0-0 0-0 0-0 0-0 0Eastern Michigan 2-4-6 0-0 0-0 1-0 1-0 0San Diego State 6-1-7 0-0 0-0 0-0 1-0 1Minnesota 1-0-1 0-0 0-0 0-0 0-0 0at Northwestern 5-1-6 0-0 0-0 0-0 1-0 0At Michigan State 5-3-8 0.5-0 0-0 0-0 0-0 0Purdue 4-3-7 0-0 0-0 0-0 0-0 0at Iowa 0-0-0 0-0 0-0 0-0 0-0 0
at Illinois 2-0-2 0-0 0-0 0-0 1-0 1Nebraska 0-1-1 0-0 0-0 0-0 0-0 0Ohio State 3-1-4 0-0 0-0 0-0 0-0 0Season Totals 37-22-59 1.5-2 0-0 1-0 4-0 2
T. Gordon’s Career Bests:Tackles: 9, vs. Notre Dame (Sept. 10, 2011)Solos: 6, vs. San Diego State (Sept. 24, 2010)Asst: 5, vs. Notre Dame (Sept. 10, 2011)TFLs: 2, at Notre Dame (Sept. 11, 2010)Sacks: 1, twice (last at Penn State, Oct. 30, 2010)Int.: 1, vs. Eastern Michigan (Sept. 17, 2011)FR: 1, four times (last at Ilinois, Nov. 12, 2011)PBUs: 1, twice (last at Ilinois, Nov. 12, 2011)
kelviN grady ** #19 • Wide Receiver5-10 • 177 • 5th-Sr.Grand Rapids, Mich.East Grand Rapids HS
At Michigan ... two-year varsity letterman in football ... received first varsity football letter in 2009 ... appeared in 34 games and started four contests at wide receiver ... caught 31 passes for 377 yards and one touchdown ... had five rushes for 28 yards ... member of the men’s basketball team during the 2007-08 and 2008-09 seasons ... played in the 2009 NCAA basketball tournament.
Fifth-Year Senior (2011) ... appeared in all 12 games; played all 12 games at wide receiver, including three starts (Western Michigan, Notre Dame, Illinois); also contrib-uted as a kick returner in season opener ... IOWA (Nov. 5) ... made season-high two catches for 22 yards ... WESTERN MICHIGAN (Sept. 3) ... made first career appearance as a kick returner, returning three times for 57 yards.
Senior/Junior (2010) ... earned second varsity letter ... appeared in all 13 games and started one contest at slot receiver ... caught 17 passes for 211 yards ... had four carries for 17 yards ... matched career-high with three receptions for 23 yards vs. Connecticut (Sept. 4) ... had seven-yard reception at Notre Dame (Sept. 11) ... grabbed two passes for a career-high 49 yards as a reserve slot receiver vs. Massachusetts (Sept. 18) ... had career-long 43-yard recep-tion in the first quarter to set up U-M’s first touchdown against UMass ... recorded career-long 15-yard rush on an end around vs. the Minutemen ... posted two receptions for 26 yards vs. Bowling Green (Sept. 25) ... appeared as a reserve slot receiver in Big Ten opener at Indiana (Oct. 2) ... grabbed two passes for 28 yards as a reserve slot receiver vs. Michigan State (Oct. 9), including a 17-yard reception on fourth down that set up a U-M touchdown ... caught one pass for eight yards as a backup slot receiver vs. Iowa (Oct. 16) ... made two receptions for 36 yards as a reserve slot receiver at Penn State (Oct. 30) ... appeared as a backup slot receiver vs. Illinois (Nov. 6) ... made first collegiate start at slot receiver against Purdue, carrying the ball one time on an end around for 13 yards ... had a career-tying three receptions for 23 yards as a reserve slot receiver vs. Wisconsin (Nov. 20) ... caught one pass for 11 yards as a reserve slot receiver at Ohio State (Nov. 27) ... one rush as a reserve slot receiver vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... earned first varsity letter ... appeared in nine games at slot receiver ... caught 10 passes for 102 yards (10.2 avg.), scored one touchdown ... had an 11-yard run ... made career debut vs. Western Michigan (Sept. 5) with two catches for 13 yards and an 11-yard reverse ... lined up at slot receiver and kick returner vs. Notre Dame (Sept. 12), tallying one reception for three yards ... caught two balls for 14 yards vs. Eastern
Michigan (Sept. 19) ... played slot receiver and kick returner vs. Indiana (Sept. 26) with career-best three passes for 24 yards ... played slot receiver and kick returner At Michigan State (Oct. 3) and Iowa (Oct. 10) ... recorded two receptions for career-high 48 yards and scored first career touchdown vs. Delaware State (Oct. 17) ... scored on 38-yard pass from Denard Robinson on first play of a first quarter drive against the Hornets ... appeared at slot receiver vs. Penn State (Oct. 24) and at Illinois (Oct. 31) ... did not see game action vs. Purdue (Nov. 7), Wisconsin (Nov. 14) or Ohio State (Nov. 21).
Personal ... Kelvin Grady was born April 21, 1989 ... brother, Kevin, was a tailback at U-M ... earned Bachelor’s degree from the College of Literature, Science and the Arts, major-ing in general studies ... enrolled in the Master of Social Work program, concentrating in community organization and children and youth in families and societies.
Kelvin Grady’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2009 9/0 10 102 10.2 20.4 1 382010 13/1 17 211 12.4 23.4 0 432011 12/3 4 64 16.0 5.8 0 27Career 34/4 31 377 12.2 11.4 1 43
Kelvin Grady’s Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan 1 15 15.0 0 15Notre Dame 1 27 27.0 0 27Eastern Michigan 0 0 0.0 0 0San Diego State 0 0 0.0 0 0Minnesota 0 0 0.0 0 0at Northwestern 0 0 0.0 0 0At Michigan State 0 0 0.0 0 0Purdue 0 0 0.0 0 0 at Iowa 2 22 11.0 0 13at Illinois 0 0 0.0 0 0Nebraska 0 0 0.0 0 0Ohio State 0 0 0.0 0 0Season Totals 4 64 16.0 0 27
Kelvin Grady’s Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2009 9/0 1 11 11.0 11.0 0 112010 13/1 4 17 4.3 4.3 0 152011 12/3 0 0 0.0 0.0 0 0Career 34/4 5 28 5.6 0.9 0 15
Kelvin Grady’s Career Kick Return StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2011 12/3 3 57 19.0 5.2 0 25Career 12/3 3 57 19.0 5.2 0 25
Grady’s Career Bests:ReceivingReceptions: 3, three times (last vs. Wisconsin, Nov. 20, 2010)Yards: 49, vs. Massachusetts (Sept. 18, 2010)Touchdowns: 1, vs. Delaware State (Oct. 17, 2009)Long: 43, vs. Massachusetts (Sept. 18, 2010)
RushingAttempts: 1, twice (last at Purdue, Nov. 13, 2010)Yards: 13, at Purdue (Nov. 13, 2010)Touchdowns: NoneLong: 13, at Purdue (Nov. 13, 2010)
Kick ReturnsReturns: 3, vs. Western Michigan (Sept. 3, 2011)Yards: 57, vs. Western Michigan (Sept. 3, 2011)Touchdowns: NoneLong: 25, vs. Western Michigan (Sept. 3, 2011)
curt gramaN#94 • Long Snapper6-5 • 200 • Jr.-So.Cincinnati, OhioElder HS
Junior/Sophomore (2011) ... did not see game action.
Sophomore/Freshman (2010) ... did not see game action.
Freshman (2009) ... did not see game action ... redshirted.
Prep ... attended Elder High School (2009) coached by Doug Ramsey ... honor roll student ... two-year varsity let-terman in football ... member of state runner-up team as a senior ... Honors and Rankings ... rated 29th-best long snap-per by Chris Sailer’s kicking ... Other Sports ... varsity letter-man in volleyball as senior and junior ... state runner-up as a senior after claiming state title as a junior ... team went 26-3 senior year after posting a perfect 29-0 record junior year.
Personal ... Curtis Bernard Graman was born June 15, 1990 ... mom, Judy, played volleyball at Eastern Kentucky University (1980-81) ... father, Keith, played baseball at Arizona Western (1980) ... sister, Chelsea, played volleyball at Villanova ... enrolled in the College of Literature, Science and the Arts, majoring in sociology.
erik guNdersoN #69 • Offensive Lineman6-8 • 312 • Jr.-So.Milan, Mich.Milan HS
Junior/Sophomore (2011) ... has played in four games, all four as a reserve right tackle ... EASTERN MICHIGAN (Sept. 17) ... made collegiate debut, substituting in at right tackle.
Sophomore/Freshman (2010) ... did not see game action.
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Milan High School (2009) coached by Steve Robb ... National Honor Society member ... Honor Roll student ... two-year varsity performer ... Honors and Rankings ... All-Huron League, all-region, All-Heritage and Monroe County All-Star team as a senior ... earned second-team All-Heritage junior year ... Other Sports ... participated in basketball and swimming.
Personal ... Erik Richard Gunderson was born March 29, 1991 ... sister, Katelyn, played softball at Ball State ... enrolled in the College of Literature, Science and the Arts, majoring in sociology.
paul gyarmati * # 99 • Linebacker6-1 • 216 • Sr.-Jr.Birmingham, Mich.Brother Rice HS
Senior/Junior (2011)... played in 12 games; appeared as a reserve fullback in one game and on special teams in all 12 games.
Junior/Sophomore (2010) ... earned first varsity letter ... appeared in 11 contests with three tackles ... did not see game action vs. Connecticut (Sept. 4) ... made travel squad to Notre Dame (Sept. 11) ... made season debut on kickoff coverage unit vs. Massachusetts (Sept. 18), recording one
solo tackle ... assisted on a tackle on special teams vs. Bowling Green (Sept. 25) ... contributed to special teams units in Big Ten opener at Indiana (Oct. 2) ... appeared on special teams units vs. Michigan State (Oct. 9), vs. Iowa (Oct. 16) and at Penn State (Oct. 30) ... contributed on special teams against Illinois (Nov. 6), Purdue (Nov. 13) and Wisconsin (Nov. 20) ... made one solo tackle on special teams at Ohio State (Nov. 27) ... appeared on special teams vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore/Freshman (2009) ... saw first career game action at outside linebacker and on special teams vs. Delaware State (Oct. 17) ... recorded one solo tackle against the Hornets.
Freshman (2008) ... did not see game action.
Prep ... attended Brother Rice High School (2008) coached by Al Fracassa ... three-year letterman ... member of state championship team as sophomore ... Honors and Rankings ... team captain as senior ... first-team all-area and all-league as junior and senior ... all-state first team senior year and second-team all-state as junior ... Other Sports ... two-year letterman in lacrosse ... played on the state championship lacrosse team as a sophomore.
Personal ... Paul Philip Gyarmati was born July 22, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in history.
Paul Gyarmati’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 1/0 1-0-1 0-0 0-0 0-0 0-0 02010 11/0 2-1-3 0-0 0-0 0-0 0-0 02011 12/0 0-0-0 0-0 0-0 0-0 0-0 0Career 24/0 3-1-4 0-0 0-0 0-0 0-0 0
Will hagerup * #43 • Punter 6-4 • 225 • So.Milwaukee, Wis.Whitefish Bay HS
Sophomore (2011) ... appeared in eight games at punter (Minnesota, Northwestern, Michigan State, Purdue, Iowa, Illinois, Nebraska, Ohio State) ... NEBRASKA (Nov. 19) ... season-best punt of 50 yards ... MICHIGAN STATE (Oct. 15) ... set career high by dropping four of seven punts inside the Spartans’ 20-yard line ... MINNESOTA (Oct. 1) ... made season debut after serving a four-game suspension, averaging 37.5 yards on two punts with a long of 47.
Freshman (2010) ... earned first varsity letter ... starting punter in 10 contests ... 33 punts for 1,440 yards ... second in school history with a single season average of 43.64 yards per punt (minimum 30 punts) ... 11 punts inside the oppo-nent’s 20-yard line and 10 punts 50-plus yards ... recorded two touchbacks in five appearances as kickoff specialist ... made career debut as starting punter vs. Connecticut (Sept. 4), had 51-yard punt against the Huskies ... punted nine times for a 38.3-yard average at Notre Dame (Sept. 11), knocked two punts inside the Irish’s 20-yard line ... recorded one punt for 33 yards that landed inside the opponent’s 20-yard line vs. Massachusetts (Sept. 18) ... did not see game action vs. Bowling Green (Sept. 25) as U-M did not punt in the contest ... averaged 48 yards on four punts in start at Indiana (Oct. 2), booming two over 50 yards, including a 58-yarder, and dropping one inside the 20-yard line ... punted four times for an average of 47 yards in start vs. Michigan State (Oct. 2), placing two inside the MSU 20-yard line ... kicked two punts 50-plus yards, including a 62-yarder, against Spartans ... had three punts for an aver-age of 50.3 yards in start vs. Iowa (Oct. 16), dropping two
inside the 20-yard line ... reset career-long for the third con-secutive week with a 63-yarder against Hawkeyes ... punted twice for an average of 45 yards in start at Penn State (Oct. 30) ... took over as the kickoff specialist, recording five kick-offs for an average of 65 yards, with one touchback against the Nittany Lions ... averaged 41.5 yards on two punts, including one that dropped inside the 20-yard line, and had eight kickoffs in start vs. Illinois (Nov. 6) ... made first career tackle against the Fighting Illini ... punted four times for an average of 47.0 yards and recorded one touchback in start as punter and kickoff specialist at Purdue (Nov. 13) ... had career-long 72-yard punt downed at the Boilermakers’ three-yard line in the fourth quarter ... tallied 39.7-yard average on three punts in start vs. Wisconsin (Nov. 20), dropping one punt inside the Badgers’ 20-yard line ... did not see game action at Ohio State (Nov. 27) ... served as kickoff specialist and did not record a punt vs. Mississippi State (Jan. 1) in the Gator Bowl.
Prep ... attended Whitefish Bay High School (2010) coached by Jim Tietjen ... two-year starter at punter, kicker and tight end ... ran 40-yard dash in 4.8 seconds ... Key Statistics ... averaged 42.9 yards on 22 punts and allowed just three yards per return as a senior ... hang time of 4.38 seconds senior year and pooched seven punts inside the opposi-tion’s 20-yard line ... converted all four field goals and 18 PATs as a senior ... made 15 catches for 187 yards and one TD senior year ... averaged 41 yards per punt and connected on four field goals as a junior ... 39-yard punting average and 58-yard kickoff average during sophomore year ... Honors and Rankings ... Sporting News All-American ... PrepStar All-American Dream Team member ... participated in U.S. Army All-American Game ... listed as the nation’s top-ranked kickder according to Sailer Kicking, Kohls Kicking, One-on-One Kicking and The Kicking Coach ... three-star and the No. 4 punter nationally according to scout.com ... three-star prospect and the nation’s third-best kicker according to Rivals.com ... 10th-best player in the state of Wisconsin by Rivals.com ... SuperPrep All-American and No. 17 player in the Midwest ... four-star prospect and the nation’s No. 3 kicker according to Scouts, Inc. ... MaxPreps Small School All-American second team as a senior ... first-team all-state at punter as a senior ... all-region, all-area and all-suburban at punter senior year ... all-conference first-team at punter and honorable mention at kicker and tight end as a senior ... second-team all-conference kicker junior year ... named to Milwaukee Journal Sentinel’s Terrific 25 senior year ... selected to play in Wisconsin North-South All-Star game.
Personal ... William Hagerup was born Dec. 7, 1991 ... brother of Indiana punter Chris Hagerup ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Will Hagerup’s Career Punting StatisticsYear GP No. Yards Avg. Long 50+ I202010 11 33 1440 43.6 72 10 112011 8 27 993 36.8 50 1 5Career 19 60 2433 40.6 72 11 16
Will Hagerup’s Game-by-Game Punting Statistics2011 No. Yards Avg. Lg 50+ 20-10-5 YLWestern Michigan - - - - - - -Notre Dame - - - - - - -Eastern Michigan - - - - - - -San Diego State - - - - - - -Minnesota 2 75 37.5 47 0 0-0-0 -at Northwestern 1 38 38.0 38 0 0-0-0 -at Michigan State 7 223 31.9 42 0 4-3-2 5Purdue 2 81 40.5 49 0 0-0-0 -at Iowa 5 197 39.4 49 0 0-0-0 -at Illinois 4 137 34.2 44 0 1-0-0 15Nebraska 4 147 36.8 50 1 0-0-0 -Ohio State 2 95 47.5 48 0 0-0-0 -Season Totals 27 993 36.8 50 1 5-3-2 5
Hagerup’s Career Bests:Punts: 9, at Notre Dame (Sept. 11, 2010)Yards: 345, at Notr e Dame (Sept. 11, 2010)Average: 51.0, vs. Connecticut (Sept. 4, 2010)50+: 2, three times (last vs. Michigan State, Oct. 9, 2010)I20: 4, at Michigan State (Oct. 15, 2011)Long: 72, at Purdue (Nov. 13, 2010)
BraNdiN haWthorNe * #7 • Linebacker6-0 • 214 • Jr.Pahokee, Fla.Pahokee HS
Junior (2011) ... appeared in 11 games; nine at linebacker, making five starts (Eastern Michigan, San Diego State, Minnesota, Northwestern, Michigan State), and 11 on spe-cial teams ... PURDUE (Oct. 29) ... tallied two solo tackles and earned first career sack ... NORTHWESTERN (Oct. 8) ... made nine tackles and intercepted first career pass ... EASTERN MICHIGAN (Sept. 17) ... made first career start, recorded career-high 10 total tackles (7 solo, 3 assisted), including one for a loss ... NOTRE DAME (Sept. 10) ... tackle-for-loss and pass break-up were each first of his career.
Sophomore (2010) ... earned first varsity letter ... appeared in nine contests ... played on special teams units vs. Connecticut (Sept. 4), Notre Dame (Sept. 11) and Massachusetts (Sept. 18) ... saw first game action at strongside linebacker and played on special teams vs. Bowling Green (Sept. 25), recording first collegiate tackle ... contributed to special teams in Big Ten opener at Indiana (Oct. 2) ... appeared on special teams units vs. Michigan State (Oct. 9) and Iowa (Oct. 16) ... did not see game action in next four contests against Penn State (Oct. 30), Illinois (Nov. 6), Purdue (Nov. 13) and Wisconsin (Nov. 20) ... returned to action on special teams at Ohio State (Nov. 27) ... contributed on special teams vs. Mississippi State (Jan. 1) in Gator Bowl.
Freshman (2009) ... made career debut on special teams vs. Western Michigan (Sept. 5) ... contributed on special teams vs. Notre Dame (Sept. 12), Eastern Michigan (Sept. 19) and Indiana (Sept. 26).
Prep ... attended Pahokee High School (Dec. 2008) coached by Blaze Thompson ... played linebacker, defensive end and tight end ... helped lead his team to three straight class 2B state championships ... ran 40-yard dash in 4.6 seconds ... Key Statistics ... posted 200 tackles, including 76 tackles for loss, 42 sacks, six forced fumbles and five fumble recoveries during his career ... registered 113 tackles, 48 TFLs, 27 sacks, six forced fumbles and five fumble recoveries as a senior ... finished his junior season with 87 tackles, 28 TFLs and 15 sacks ... Honors and Rankings ... Palm Beach Post small schools Defensive Player of the Year as senior ... Palm Beach Post small schools All-Area first team senior year ... three-star prospect by Rivals.com and scout.com ... All-Southeast region selection by Prep Star ... listed as 82nd overall prospect in the state of Florida by SuperPrep ... selected as No. 33 weakside linebacker by scout.com ... rated as No. 35 outside linebacker nationally according to Rivals.com ... 73rd-best prospect in the state of Florida according to Rivals.com ... first-team all-state as a senior and honorable mention junior year.
Personal ... Brandin William Hawthorne was born November 10, 1990 ... from the same high school as defensive tackle Richard Ash, wide receiver Martavious Odoms and running back Vincent Smith ... enrolled in the College of Literature, Science and the Arts, majoring in Afro-American and African studies.
Brandin Hawthorne’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 4/0 0-0-0 0-0 0-0 0-0 0-0 02010 9/0 1-0-1 0-0 0-0 0-0 0-0 02011 11/5 25-18-43 3-6 1-1 1-0 0-0 1Career 24/5 26-18-44 3-6 1-1 1-0 0-0 1
Hawthorne’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan - - - - - -Notre Dame 4-2-6 1-3 0-0 0-0 0-0 1Eastern Michigan 7-3-10 1-2 0-0 0-0 0-0 0San Diego State 2-3-5 0-0 0-0 0-0 0-0 0Minnesota 1-2-3 0-0 0-0 0-0 0-0 0at Northwestern 4-5-9 0-0 0-0 1-0 0-0 0At Michigan State 1-2-3 0-0 0-0 0-0 0-0 0Purdue 2-0-2 1-1 1-1 0-0 0-0 0at Iowa 1-1-2 0-0 0-0 0-0 0-0 0at Illinois 0-0-0 0-0 0-0 0-0 0-0 0Nebraska 2-0-2 0-0 0-0 0-0 0-0 0Ohio State 1-0-1 0-0 0-0 0-0 0-0 0Season Totals 25-18-43 3-6 1-1 1-0 0-0 1
Hawthorne’s Career Bests:Tackles: 10, vs. Eastern Michigan (Sept.. 17, 2011)Solos: 7, vs. Eastern Michigan (Sept. 17, 2011)Asst: 5, at Northwestern (Oct. 8, 2011)TFLs: 1, three times (last vs. Purdue, Oct. 29, 2011)Sacks: 1, vs. Purdue (Oct. 29, 2011)Int.: 1, at Northwestern (Oct. 8, 2011)FR: NonePBUs: 1, vs. Notre Dame (Sept. 10, 2011)
Justice hayes #5 • Running Back5-10 • 176 • Fr.Grand Blanc, Mich.Grand Blanc HS
Freshman (2011) ... did not see game action.
Prep ... attended Grand Blanc High School (2011) coached by Joe Delaney ... ran 40-yard dash in 4.45 seconds ... Key Statistics ... ran 380 times for 2,624 yards and 21 touchdowns during his career ... caught 53 passes for 549 yards and five touchdowns in his career ... rushed for 230 yards and two touchdowns, along with over 100 receiving yards and one touch-down before dislocating his wrist in the third game of his senior season ... rushed 175 times for 1,295 yards and scored 12 touchdowns during his junior season ... caught 19 passes for 208 yards as a junior...gained over 1,122 yards on 163 carries and scored 10 TDs as a sophomore ... caught 22 passes for 229 yards sophomore season ... Honors and Rankings ... earned a four-star rating from Rivals.com, Scout.com and ESPN.com ... rated as the nation’s No. 3 all-purpose back and the No. 84 overall player nation-ally by service ... listed as the fourth-best prospect in the state of Michigan by Rivals.com ... listed as the 14th-best running back nationally by Scout.com ... listed as the No. 22 running back according to ESPN.com ... rated as the third-best player on The Detroit News Blue Chip list ... listed as the sixth-best player in Michigan according to the Detroit Free Press ... in-vited to 2011 U.S. Army All-American game prior to suffering wrist injury ... all-state honorable mention his junior season.
Personal ... Justice Hayes was born November 24, 1992 ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Will heiNiNger ***Defensive End6-6 • 295 • 5th-Sr.Ann Arbor, Mich.Pioneer HS
At Michigan ... three-year letterman ... 2008 and ‘09 Big Ten Distinguished Scholar ... three-time Academic All-Big Ten Conference (2008-10) ... appeared in 32 career games and made 12 starts at defensive tackle.
Fifth-Year Senior (2011)... Capital One College Sports Information Directors of America (CoSIDA) Academic All-District V team ... Academic All-Big Ten ... played in 12 games; started all 12 games on defensive line and con-tributed to special teams each game ... OHIO STATE (Nov. 26) ... matched career high with four tackles, setting new career best with three assisted stops ... IOWA (Nov. 5) ... recorded two tackles, a TFL and first career unassisted sack ... MICHIGAN STATE (Oct. 15). ... set career highs for tackles (4) and TFLs (2) ... MINNESOTA (Oct. 1) ... honorary senior game captain ... set career high with three solo tackles ... EASTERN MICHIGAN (Sept. 17) ... first career tackle for loss ... WESTERN MICHIGAN (Sept. 3) ... made first career start, second career pass breakups (1).
Senior/Junior (2010) ... earned third varsity letter ... Academic All-Big Ten ... missed the first 10 games of the season due to injury ... appeared in three games ... made season debut at defensive end vs. Wisconsin (Nov. 20), making one solo stop ... tallied one solo tackle as a backup defensive end against Ohio State (Nov. 27) ... notched one solo tackle as a reserve defensive end vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... earned second varsity letter ... Big Ten Distinguished Scholar Award ... Academic All-Big Ten ... U-M Athletic Academic Achievement award ... played defensive end in all 12 games ... saw action on PAT/field goal protection unit in every game ... registered 10 tackles, one assisted sack and one pass breakup ... appeared at defensive end vs. Western Michigan (Sept. 5) ... recorded his first career tackle from defensive end spot vs. Notre Dame (Sept. 12) ... posted two tackles and first collegiate sack vs. Eastern Michigan (Sept. 19) ... contributed at defensive end vs. Indiana (Sept. 26) ... assisted on one tackle from defen-sive end spot At Michigan State (Oct. 3) ... played defensive end at Iowa (Oct. 10) ... recorded first career pass breakup against Delaware State (Oct. 17) ... earned a career-high three tackles vs. Penn State (Oct. 24) ... made two assisted tackles at Illinois (Oct. 31) ... contributed at defensive end vs. Purdue (Nov. 7) ... made one solo stop at Wisconsin (Nov. 14) ... played defensive end vs. Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... earned first varsity letter ... Big Ten Distinguished Scholar Award ... Academic All-Big Ten ... U-M Athletic Academic Achievement ... made career debut vs. Michigan State (Oct. 25), playing on kick return team ... contributed on special teams at Purdue (Nov. 1) and Minnesota (Nov. 8) ... played on kick return unit vs. Northwestern (Nov. 15) ... contributed on special teams at Ohio State (Nov. 22).
Freshman (2007) ... did not see game action.
Prep ... attended Pioneer High School (2007) coached by Chuck White ... two-year letterman in football ... team captain senior year ... National Honor society ... member of the Honor Roll all four years ... Honors and Rankings... all-conference senior year ... earned Academic All-State honors as a senior ... Academic All-Conference junior year ... Other Sports... varsity letterman in baseball as a sophomore, junior and senior ... received all-district and all-conference honors in baseball junior and senior years ... team captain
as a senior ... Academic All-Region senior year.
Personal ... William Joseph Stevens Heininger was born December 1, 1988 ... enrolled in the School of Kinesiology, majoring in sport management with minor in economics.
Will Heininger’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2008 5/0 0-0-0 0-0 0-0 0-0 0-0 02009 12/0 2-8-10 0.5-3 0.5-3 0-0 0-0 12010 3/0 3-0-3 0-0 0-0 0-0 0-0 02011 12/12 10-13-23 4-16 1-8 0-0 0-0 1Career 32/12 15-21-36 4.5-19 1.5-11 0-0 0-0 2
Will Heininger’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-2-2 0-0 0-0 0-0 0-0 1Notre Dame 0-0-0 0-0 0-0 0-0 0-0 0Eastern Michigan 2-1-3 1-3 0-0 0-0 0-0 0San Diego State 0-1-1 0-0 0-0 0-0 0-0 0Minnesota 3-0-3 0-0 0-0 0-0 0-0 0at Northwestern 0-1-1 0-0 0-0 0-0 0-0 0At Michigan State 2-2-4 2-5 0-0 0-0 0-0 0Purdue 0-0-0 0-0 0-0 0-0 0-0 0at Iowa 1-1-2 1-8 1-8 0-0 0-0 0at Illinois 1-0-1 0-0 0-0 0-0 0-0 0Nebraska 0-2-2 0-0 0-0 0-0 0-0 0Ohio State 1-3-4 0-0 0-0 0-0 0-0 0Season Totals 10-13-23 4-16 1-8 0-0 0-0 1
Heininger’s Career Bests:Tackles: 4, twice (last vs. Ohio State, Nov. 26, 2011)Solos: 3, vs. Minnesota (Oct. 1, 2011)Asst: 3, vs. Ohio State (Nov. 26, 2011)TFLs: 2, at Michigan State (Oct. 15, 2011)Sacks: 1, at Iowa (Nov. 5, 2011)Int.: NoneFR: NonePBUs: 1, twice (last vs. Western Michigan, Sept. 3, 2011)
keith heitzmaN #92 • Defensive End6-3 • 251 • Fr.Hilliard, OhioHilliard Davidson HS
Freshman (2011) ... did not see game action.
Prep ... attended Hilliard Davidson High School (2011) coached by Brian White ... started 41 straight games on varsity ... led team to 13-1 mark senior sea-son and only allowed 7.1 points per game ... helped team to a 13-1 record and the Ohio Division I state title as a junior ... Key Statistics ... recorded 13 sacks as a senior ... tallied over 60 tackles and 13 sacks while playing defensive end and linebacker as a ju-nior ... Honors and Rankings ... three-star prospect according to Rivals.com ... three-star prospect and rated as the No. 63 tight end nationally by Scout.com ... received a three-star rating and listed as the No. 157 defensive end prospect nationally by ESPN.com ... named to the Division I All-State first team as a senior ... earned all-Ohio Capitol Central Division honors as a junior and senior ... two-time all-district selection ... consensus choice for Central District Division I Defensive Player of the Year as a senior ... Defensive Player of the Year on the Columbus Dis-patch’s All-Metro team.
Personal ... Keith Heitzman was born September 1, 1992 ... enrolled in the College of Literature, Science and the Arts, major undeclared.
JuNior hemiNgWay ***Wide Receiver6-1 • 222 • 5th-Sr.Conway, S.C.Conway HS
At Michigan ... three-year letterman ... appeared in 47 games; started started 30 contests at wide receiver ... 1,575 career receiving yards rank 17th in school history ... six career 100-yard games are tied for ninth at U-M ... eclipsed 1,000 career receiving yards against Notre Dame (Sept. 10, 2011).
Fifth-Year Senior (2011) ... All-Big Ten honorable mention (coaches) ... Phil Steele’s Midseason All-Big Ten third team selection ... appeared in all 12 games; started 11 games at wide receiver (Western Michigan, Notre Dame, Eastern Michigan, San Diego State, Minnesota, Northwestern, Michigan State, Purdue, Iowa, Illinois, Ohio State) and played all 12 games on special teams ... team’s leading receiver with 32 catches for 636 yards ... OHIO STATE (Nov. 26) ... caught two passes for a team-high 45 yards and a touchdown ... hauled in a 26-yard touchdown pass in the first quarter for his second receiving score of the season ... ILLINOIS (Nov. 12) ... led team with three catches for 43 yards ... IOWA (Nov. 5) ... led the team with five receptions for 64 yards ... NORTHWESTERN (Oct. 8) ... tied season with with five receptions for a game-high 124 yards ... eclipsed 100 receiving yards for the second time this season ... MINNESOTA (Oct. 1) ... snagged a team-high five passes for 56 yards ... NOTRE DAME (Sept. 10) ... hauled in three passes for a career-best 165 yards and a touchdown, including a career-best 77-yard reception ... scored on a 43-yard catch ... became the 28th player in school history to surpass 1,000 career receiving yards.
Senior/Junior (2010) ... earned third varsity letter ... appeared in 10 games and started eight contests at wide receiver ... made two starts at punt returner ... 32 receptions for 593 yards and four touchdowns ... missed Connecticut (Sept. 4) and Notre Dame (Sept. 11) games due to ham-string injury ... made season debut at wide receiver vs. Massachusetts (Sept. 18), caught one pass for 36 yards ... had two receptions for 25 yards at wide receiver vs. Bowling Green (Sept. 25) ... grabbed three passes for career-high 129 yards and a touchdown in start at Indiana (Oct. 2) ... set career-long with a 70-yard score on the second play of the second half ... hauled in 42-yard toss at the IU four-yard line with 21 seconds remaining, setting up U-M’s game-winning touchdown on the next play ... caught two passes for 42 yards in start vs. Michigan State (Oct. 9), appeared as punt returner against the Spartans ... set career-highs in reccep-tions (nine) and receiving yards (134) and scored on 45-yard catch in start vs. Iowa (Oct. 16) ... hauled in 31-yard pass near the Hawkeyes’ goal line to set up U-M’s final touchdown ... caught one pass for 21 yards in start at Penn State (Oct. 30) ... six receptions for 104 yards and two touchdowns in start vs. Illinois (Nov. 6), scored on 45-yard catch, nine-yard tipped grab and caught the game-winning two-point con-version pass in triple overtime ... snagged three passes for 50 yards in start at Purdue (Nov. 13) ... started at wideout and punt returner vs. Wisconsin (Nov. 20), catching one pass for three yards ... missed Ohio State (Nov. 27) contest due to injury ... caught four passes for 49 yards and returned one punt for career-tying 34 yards in start at wideout and punt returner vs. Mississippi State (Jan. 1) in Gator Bowl.
Junior/Sophomore (2009) ... earned second varsity letter ... started nine of 11 games played ... team’s fourth-leading receiver with 16 catches for 268 yards and two touchdowns ... returned 10 punts for 86 yards ... finished third in the Big Ten in punt return average (8.6 avg.) ... made third career start at wide receiver vs. Western Michigan (Sept. 5), setting career-highs for receptions (5), yards (103) and touchdowns
(2) ... recorded 28-yard touchdown reception on U-M’s season-opening drive and added a 44-yard score in the sec-ond quarter against the Broncos ... did not appear vs. Notre Dame (Sept. 12) due to injury ... caught one pass for seven yards vs. Eastern Michigan (Sept. 19) ... started at wide receiver vs. Indiana (Sept. 26), recording one catch for one yard ... caught three passes for 28 yards in start At Michigan State (Oct. 3) ... started at wide receiver at Iowa (Oct. 10), grabbed one pass for seven yards ... saw first career action at punt returner against the Hawkeyes, returning three punts for 20 yards ... started at wide receiver vs. Delaware State (Oct. 17) ... started at wide receiver and punt returner vs. Penn State (Oct. 24), returning one punt for career-long 19 yards in the second quarter ... caught two passes for 87 yards in start at Illinois (Oct. 31) ... had a 66-yard career long reception against the Illini in the fourth quarter ... returned two punts for 13 yards against Illinois ... started at wide receiver and punt returner vs. Purdue (Nov. 7), returning two punts for 34 yards ... set career high with a 33-yard punt return late in the fourth quarter against the Boilermakers ... earned five receiving yards on a lateral at the end of the contest against the Boilermakers ... caught two passes for 25 yards in start at Wisconsin (Nov. 14) ... had a five-yard reception and returned two punts vs. Ohio State (Nov. 21).
Sophomore (2008) ... received medical redshirt ... played in four games and made one start at wide receiver ... caught two passes for 42 yards vs. Utah (Aug. 30), includ-ing a 33-yard touchdown for his first career score ... earned second career start at wide receiver vs. Miami (Sept. 6) ... played wide receiver at Notre Dame (Sept. 13) and against Wisconsin (Sept. 27) ... missed the Illinois (Oct. 4) through Ohio State (Nov. 15) games due to mononucleosis.
Freshman (2007) ... earned first varsity letter ... U-M Athletic Academic Achievement award ... played in 10 games and started one contest at wide receiver ... caught four passes for 37 yards (9.2 avg.) ... made career debut vs. Appalachian State (Sept. 1), playing wide receiver and special teams ... saw action at wide receiver and on special teams against Oregon (Sept. 8) ... missed the Notre Dame (Sept. 15) game due to injury ... made first career start at wide receiver and carried the ball once from quarterback position vs. Penn State (Sept. 22) ... played wide receiver at Northwestern (Sept. 29) ... made first career receptions in the Eastern Michigan (Oct. 6) game, catching three passes for 33 yards ... grabbed a 23-yard pass to convert a third down against the Eagles, his first collegiate reception ... played wide receiver and special teams vs. Purdue (Oct. 13) ... played wide receiver and returned two kickoffs for 20 yards at Illinois (Oct. 20) ... played wide receiver vs. Minnesota (Oct. 27) ... rushed three times for six yards against the Gophers ... did not see game action At Michigan State (Nov. 3) ... played wide receiver at Wisconsin (Nov. 10) ... did not see game action vs. Ohio State (Nov. 17) ... made a four-yard catch vs. Florida in the Capital One Bowl (Jan. 1).
Prep ... attended Conway High School (2006) coached by Chuck Jordan ... National Honor Society member ... record-ed 12 catches in the 2006 state championship game victory .. Key Statistics ... caught 136 passes for 1,950 yards and 23 touchdowns during Prep career ... completed 57-of-112 passes for 612 yards and nine touchdowns during career ... returned three of his 14 career punts for touchdowns ... posted eight pass breakups and four interceptions, includ-ing one for a touchdown, during Prep career ... hauled in 83 catches for 1,135 yards and 13 TDs as a senior ... returned eight punts for 219 yards and two scores during senior year ... caught 52 passes for 842 yards and 10 TDs as a junior ... completed 57-of-112 passes for 612 yards and nine TDs as a sophomore ... Honors and Rankings ... listed as No. 19 player in the nation on The ESPN 150 ... four-star recruit and the No. 27 receiver in the nation by Scout.com ... three-star prospect, No. 38 wide receiver nationally and the No. 12 player in the state of South Carolina by Rivals.
com ... rated No. 29 receiver in the nation in the Velocity-PrepStar Top 250 and a member of the PrepStar-Velocity 100 Dream Team ... first-team all-region and all-state as a senior ... played in 2006 Shrine Bowl, a North and South Carolina all-star game.
Personal ... Kenneth Earl Hemingway Jr. was born Dec. 27, 1988, in Conway S.C. ... attended the Michigan Summer Football Camp ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Junior Hemingway’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2007 10/1 4 37 9.3 3.7 0 232008 4/1 2 41 20.5 10.3 1 332009 11/9 16 268 16.8 24.4 2 662010 10/8 32 593 18.5 59.3 4 702011 12/11 32 636 19.9 53.0 2 77Career 47/30 86 1575 18.3 33.5 9 77
Junior Hemingway’s Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan 1 37 37.0 0 37Notre Dame 3 165 55.0 1 75Eastern Michigan 0 0 0.0 0 0San Diego State 1 9 9.0 0 9Minnesota 5 56 11.2 0 16at Northwestern 5 124 24.8 1 48At Michigan State 3 43 14.3 0 29Purdue 2 16 8 0 10 at Iowa 5 64 12.8 0 19at Illinois 3 43 14.3 0 20Nebraska 2 34 17.0 0 26Ohio State 2 45 22.5 1 26Season Totals 32 636 19.9 2 77
Hemingway’s Career Bests:ReceivingReceptions: 9, vs. Iowa (Oct. 16, 2010)Yards: 165, vs. Notre Dame (Sept. 10, 2011)Touchdowns: 2, twice (last vs. Illinois, Nov. 6, 2010)Long: 77 vs. Notre Dame (Sept. 10, 2011)
RushingAttempts: 3, vs. Minnesota (Oct. 27, 2007)Yards: 7, twice (last vs. Minnesota, Oct. 27, 2007)Touchdowns: NoneLong: 7, vs. Eastern Michigan (Oct. 6, 2007)
Punt ReturnsAttempts: 3, at Iowa (Oct. 10, 2009)Yards: 34, vs. Purdue (Nov. 7, 2009)Touchdowns: NoneLong: 33, vs. Purdue (Nov. 7, 2009)
BraNdoN herroN *** Linebacker6-2 • 221 • 5th-Sr.Stafford, TexasDulles HS
At Michigan ... three-year letterman ... appeared in 36 contests and made one start ... became the first player in program history to score two touchdowns on defensive returns against Western Michigan (Sept. 3, 2011) ... set the longest interception return for a touchdown in Michigan history with a 94-yarder against Western Michigan (Sept. 3, 2011) ... won numerous national defensive player of the week awards for performance against Western Michigan (Sept. 3, 2011).
Fifth-Year Senior (2011)... played in five games; started at linebacker (Western Michigan) and contributed on special
teams in five games ... WESTERN MICHIGAN (Sept. 3) ... Made first career start ... Walter Camp National Defensive Player of the Week, National Defensive Performer of Week 1, National Linebacker Performer of the Week by College Football Performance Awards (CFPA), Big Ten Defensive Player of the Week, College Sports Madness Big Ten Defensive Player of the Week ... became the first player in Wolverine history to register two defensive returns for touchdowns, returning the interception a program-best 94 yards and the fumble 29 yards ... made career-high eight tackles.
Senior/Junior (2010) ... earned third varsity letter ... appeared in seven contests ... had seven tackles and one PBU ... played special teams and outside linebacker vs. Connecticut (Sept. 4), posting four tackles ... posted two special teams tackles against the Huskies ... assisted on two tackles and one pass breakup at Notre Dame (Sept. 11), playing linebacker and special teams ... missed next four games against Massachusetts (Sept. 18), Bowling Green (Sept. 25), Indiana (Oct. 2) and Michigan State (Oct. 9) due to ankle injury ... returned to action on special teams vs. Iowa (Oct. 16) ... recorded one stop on special teams at Penn State (Oct. 30) ... appeared on special teams units vs. Illinois (Nov. 6) and at Purdue (Nov. 13) ... did not see game action vs. Wisconsin (Nov. 20) and at Ohio State (Nov. 27) ... appeared as reserve outside linebacker vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... earned second varsity letter ... played in all 12 games ... contributed 20 tackles, one TFL, one fumble recovery ... saw game action at linebacker and on special teams vs. Western Michigan (Sept. 5), posted career-high five tackles, one for a loss, and recovered first career fumble ... played outside linebacker vs. Notre Dame (Sept. 12) ... collected four tackles at linebacker vs. Eastern Michigan (Sept. 19) ... posted two tackles from outside line-backer position vs. Indiana (Sept. 26) and At Michigan State (Oct. 3) ... assisted on a tackle at outside linebacker against Iowa (Oct. 10) ... contributed at linebacker and on special teams vs. Delaware State (Oct. 17), making one solo tackle ... assisted on a TFL from outside linebacker vs. Penn State (Oct. 24) ... recorded two assisted stops at linebacker against Illinois (Oct. 31) ... had assisted tackle at outside linebacker vs. Purdue (Nov. 7) ... played linebacker at Wisconsin (Nov. 14) ... assisted on one tackle vs. Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... earned first varsity letter ... played on special teams in all 12 games ... amassed seven special teams tackles ... made two special teams tackles in collegiate debut vs. Utah (Aug. 30) ... contributed on special teams vs. Miami (Sept. 6) ... made road debut on special teams at Notre Dame (Sept. 13) ... contributed on special teams in Big Ten opener vs. Wisconsin (Sept. 27) ... participated on special teams vs. Illinois (Oct. 4) and Toledo (Oct. 11) ... recorded one special teams tackle at Penn State (Oct. 18) ... tallied on special teams stop vs. Michigan State (Oct. 25) ... accounted for two special teams stops at Purdue (Nov. 1) ... registered one tackle on kickoff coverage at Minnesota (Nov. 8) ... contributed on special teams vs. Northwestern (Nov. 15) and at Ohio State (Nov. 22).
Freshman (2007) ... did not see game action.
Prep ... attended Dulles High School (2006) coached by Jim Creech ... Key Statistics ... finished Prep career with 152 tackles and 11 sacks ... produced 77 tackles, including nine tackles for loss and six sacks as a senior ... Honors and Rankings ... three-star recruit according to Rivals.com ... ranked as the No. 17 linebacker in the country and a four-star prospect from Scout.com ... listed as All Region by PrepStar Magazine ... earned all-conference honors follow-ing senior season... named first-team all-district as a junior.
Personal ... Brandon Charles Herron was born Aug. 2, 1988,
in Sugar Land, Texas ... attended high school with defensive back Troy Woolfolk and wide receiver Daryl Stonum ... enrolled in the School of College of Literature, Science and the Arts, majoring in general studies.
Brandon Herron’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2008 12/0 4-3-7 0-0 0-0 0-0 0-0 02009 12/0 7-13-20 1-2 0-0 0-0 1-0 02010 7/0 4-3-7 0-0 0-0 0-0 0-0 12011 4/1 1-7-8 0-0 0-0 1-94 1-29 0Career 35/1 16-26-42 1-2 0-0 1-94 2-29 1
Brandon Herron’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 1-7-8 0-0 0-0 1-94 1-29 0Notre Dame - - - - - -Eastern Michigan - - - - - -San Diego State - - - - - -Minnesota 0-0-0 0-0 0-0 0-0 0-0 0at Northwestern - - - - - -At Michigan State - - - - - -Purdue - - - - - -at Iowa - - - - - -at Illinois - - - - - -Nebraska 0-0-0 0-0 0-0 0-0 0-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 1-7-8 0-0 0-0 1-94 1-29 0
Herron’s Career Bests:Tackles: 8, vs. Western Michigan (Sept. 3, 2011)Solos: 3, twice (last vs. Connecticut, Sept. 4, 2010)Asst: 7, vs. Western Michigan (Sept. 3, 2011)TFLs: 0.5, twice (last vs. Penn State, Oct. 24, 2009)Sacks: NoneInt.: 1, vs. Western Michigan (Sept. 3, 2011)FR: 1, twice (last vs. Western Michigan, Sept. 3, 2011)PBUs: 1, at Notre Dame (Sept. 11, 2010)
deloNte holloWell #24 • Defensive Back5-9 • 164 • Fr.Detroit, Mich.Cass Tech HS
Freshman (2011) ... played four games; one as a reserve cornerback and four on special teams ... NE-BRASKA (Nov. 19) ... made career-high three tackles and saw first action at cornerback ... IOWA (Nov. 5) ... made collegiate debut on special teams, assisting on first career tackle.
Prep ... attended Cass Tech High School (2011) coached by Thomas Wilcher ... played cornerback and wide receiver ... helped team to a 12-1 record and ap-pearance in the state semifinals as a senior ... Key Sta-tistics ... registered 18 interceptions during his career ... recorded 47 tackles, two sacks and 13 pass break-ups as a senior ... intercepted seven passes during his junior season ... Honors and Rankings ... earned a four-star rating and listed as the No. 15 cornerback nationally by ESPN.com ... three-star prospect and the No. 25 cornerback nationally according to Rivals.com ... listed as the seventh-best prospect in the state of Michigan by Rivals.com ... three-star prospect and the 40th-best cornerback nationally according to Scout.com ... earned AP first-team all-state honors at defen-sive back senior year ... earned first-team all-state and all-Detroit Metro honors as a senior ... rated as the No. 11 player on The Detroit News Blue Chip list.
Personal ... Delonte Hollowell was born May 7, 1993 ... enrolled in the College of Literature, Science and
the Arts, major undeclared ... from the same high school as current Wolverines William Campbell and Thomas Gordon.
stepheN hopkiNs * #33 • Running Back6-0 • 228 • So.Double Oak, TexasMarcus HS
Sophomore (2011)... appeared in 10 games; played eight contests at fullback, starting twice (San Diego State, Purdue) and played three games as a reserve running back; played same 10 games on special teams ... MINNESOTA (Oct. 1) ... first career reception went for 28 yards ... SAN DIEGO STATE (Sept. 24) ... made first career start at fullback ... NOTRE DAME (Sept. 10) ... season-high five carries for 10 yards.
Freshman (2010) ... earned first varsity letter ... appeared in 11 contests, recorded 37 carries for 151 yards and four touchdowns ... did not see game action against Connecticut (Sept. 4) ... made career debut on goal line package at Notre Dame (Sept. 11) ... scored on first career carry, a one-yard run over the right side of the formation against the Irish ... did not play vs. Massachusetts (Sept. 18) ... recorded six carries for 32 yards as a reserve at superback vs. Bowling Green (Sept. 25) ... appeared as a reserve superback in Big Ten opener at Indiana (Oct. 2) ... carried the ball twice for 13 yards as a reserve superback vs. Michigan State (Oct. 9) ... registerd career-highs in carries (eight) and rushing yards (38) and a two-yard rushing touchdown as a reserve superback vs. Iowa (Oct. 16) ... five carries for 14 yards as a reserve superback at Penn State (Oct. 30) ... rushed for career-high 45 yards and a touchdown on five carries as backup superback vs. Illinois (Nov. 6) ... scored on four-yard rush in the second quarter and set a new career long with 32-yard rush against Fighting Illini ... gained five yards on eight carries and sealed the victory with a three-yard touchdown run late in the fourth quarter as a reserve superback against Purdue (Nov. 13) ... two rushes for three yards as backup superback vs. Wisconsin (Nov. 20) ... appeared as reserve superback against Ohio State (Nov. 27) ... did not earn any touches as backup superback vs. Mississippi State (Jan. 1) in the Gator Bowl.
Prep ... attended Marcus High School (2009) coached by Brian Erwin ... three-year starter at running back ... ran 40-yard dash in 4.52 seconds ... Key Statistics ... carried the ball 847 times for 5,010 yards and scored 61 touchdowns in his final three seasons ... rushed 231 times for 1,332 yards and scored 19 touchdowns as senior ... gained 1,689 rushing yards on 273 carries and scored 22 TDs junior year ... caught 11 passes for 81 yards as junior ... carried the ball 343 times for 1,663 yards and 16 touchdowns sophomore year ... added eight receptions for 105 yards and one TD as sophomore ... Honors and Rankings ... Prep Star All-American ... rated as No. 98 player in Texas by SuperPrep ... three-star and the nation’s No. 50 running back by Scouts, Inc. ... listed as nation’s 52nd-best running back by scout.com ... three-star prospect by Rivals.com and scout.com ... honorable mention all-state as a junior and senior ... all-district junior and senior seasons ... district MVP as a junior.
Personal ... Stephen Hopkins was born Sept. 5, 1991 ... enrolled in the School of Kinesiology, majoring in sport management.
Stephen Hopkins’ Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2010 11/0 37 151 4.1 13.7 4 322011 10/2 11 43 3.9 4.3 0 12Career 21/2 46 179 3.9 8.5 4 32
Stephen Hopkins’ Game-by-Game Rushing Statistics2011 Opponent Att. Yards Avg. TD LongWestern Michigan - - - - - Notre Dame 5 10 2.0 0 3 Eastern Michigan - - - - - San Diego State 1 8 8.0 0 8 Minnesota 1 6 6.0 0 6 at Northwestern 0 0 0.0 0 0 At Michigan State 0 0 0.0 0 0Purdue 1 1 1.0 0 1at Iowa 0 0 0.0 0 0at Illinois 0 0 0.0 0 0Nebraska 2 15 7.5 0 12Ohio State 1 3 3.0 0 3Season Total 11 43 3.9 0 12
Stephen Hopkins’ Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 11/0 0 0 0.0 0.0 0 02011 9/2 1 28 28.0 4.0 0 28Career 20/2 1 28 28.0 1.6 0 28
mark huyge *** #72 • Offensive Lineman6-6 • 302 • 5th-Sr.Wyoming, Mich.Catholic Central HS
At Michigan ... three-year letterman ... returning starter along the offensive line ... appeared in 37 contests and started in 28 games played ... can play both guard and tackle.
Fifth-Year Senior (2011)... has played in all 12 games; started 12 games at right tackle and contributed in 11 games on special teams.
Senior/Junior (2010) ... earned third varsity letter ... appeared in all 13 games and started seven contests along the offensive line ... started at left tackle against Connecticut (Sept. 4), Notre Dame (Sept. 11) and Massachusetts (Sept. 18) ... played as a reserve at right tackle vs. Bowling Green (Sept. 25) ... contributed on special teams units in Big Ten opener at Indiana (Oct. 2) ... appeared on special teams units vs. Michigan State (Oct. 9) ... substituted in at left tackle and contributed on special teams vs. Iowa (Oct. 16) ... returned to the starting lineup at right tackle at Penn State (Oct. 30) ... made the start at right tackle vs. Illinois (Nov. 6) and at Purdue (Nov. 13) ... opened the contest at right tackle vs. Wisconsin (Nov. 20) ... contributed on special teams at Ohio State (Nov. 27) ... substituted in at left tackle and appeared on special teams vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... earned second varsity letter ... started in nine of 12 games ... started four contests at tackle and five at guard ... started in career debut at right tackle vs. Western Michigan (Sept. 5) ... started at right tackle and played right guard vs. Notre Dame (Sept. 12) ... made start at right tackle and contributed on special teams vs. Eastern Michigan (Sept. 19) ... started at right guard and contributed on special teams vs. Indiana (Sept. 26) ... made start at right guard against Michigan State (Oct. 3) and Iowa (Oct. 10) ... started at right guard vs. Delaware State (Oct. 17) ... played right guard against Penn State (Oct. 24) ... made start at right guard against Illinois (Oct. 31) ... lined up at right tackle vs. Illini ... earned starting assignment at right tackle vs. Purdue (Nov. 7) ... played on field goal/PAT protection unit at Wisconsin (Nov. 14) and against Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... earned first varsity letter ... did not see game action.
Freshman (2007) ... did not see game action.
Prep ... attended Catholic Central High School (2006) coached by Tom Passinault ... National Honor Society member ... 2007 Detroit Free Press Scholar-Athlete ... started three years at offensive tackle and defensive end ... helped lead squad to the Michigan Division-Four state champion-ship game ... Key Statistics ... tallied 21 tackles as a senior ... helped team average more than 250 rushing yards per game as a senior ... Honors and Rankings ... three-star pros-pect, the No. 19 player in Michigan and the No. 2 offensive lineman in Michigan by Rivals.com ... No. 33 offensive line prospect by Scout.com ... two-star recruit by Scout.com ... rated as No. 89 player in the Midwest by SuperPrep ... No. 21 player in the state of Michigan by The Detroit News on its Blue Chips list ... tabbed as No. 21 recruit in the state of Michigan by the Detroit Free Press ... listed as All-Region by PrepStar Magazine ... named to Grand Rapids Press Dream Team as defensive lineman ... Grand Rapids Press All-City and All-Area team as junior and senior ... 2006 Associated Press All-State special mention as senior ... 2005 Detroit Free Press all-state first team as junior ... Other Sports ... played hockey and basketball ... averaged eight points and six points per game as center as junior and senior.
Personal ... Mark Christopher Huyge was born Oct. 18, 1988 in Grand Rapids, Mich. ... last name is pronounced “Hugh-gee” ... high school teammate of former U-M linebacker Obi Ezeh ... attended the 2006 Michigan Summer Football Camp ... enrolled in the College of Engineering, majoring in naval architecture and marine engineering.
Jeremy JacksoN * #17 • Wide Receiver6-3 • 198 • So.Ann Arbor, Mich.Huron HS
Sophomore (2011) ... appeared in all 12 games; played in 10 as a reserve wide receiver and all 12 on special teams.
Freshman (2010) ... earned first varsity letter ... appeared in nine contests at wideout ... made his collegiate debut at wide receiver vs. Connecticut (Sept. 4) ... saw first game action on the road as backup wide receiver at Notre Dame (Sept. 11) ... played as reserve wide receiver vs. Massachusetts (Sept. 18) and Bowling Green (Sept. 25) ... did not see game action at Indiana (Oct. 2) and vs. Michigan State (Oct. 9) ... appeared as backup wideout vs. Iowa (Oct. 16) ... did not see game action at Penn State (Oct. 30) ... substituted into lineup as backup wideout vs. Illinois (Nov. 6) ... did not see game action at Purdue (Nov. 13) ... caught first two career passes for 24 yards as reserve wide receiver vs. Wisconsin (Nov. 20) ... grabbed two passes for 31 yards as backup wideout at Ohio State (Nov. 27) ... appeared as reserve wide receiver vs. Mississippi State (Jan. 1) in Gator Bowl.
Prep ... attended Huron High School (2009) coached by Cory Gildersleeve ... ran 40-yard dash in 4.6 second and had a 32-inch vertical leap ... Key Statistics ... led Washtenaw County with 47 receptions as senior, totaling 691 yards and seven touchdowns ... posted 42 tackles and two intercep-tions senior year ... made 42 catches for 620 yards and seven TDs junior year ... hauled in 41 passes for 535 yards and three touchdowns as a sophomore ... Honors and Rankings ... No. 8 player on The Detroit News Blue Chip list ... listed as No. 17 player in the state of Michigan by the Detroit Free Press ... three-star prospect by scout.com and Rivals.com ... rated as No. 77 wide receiver nationally by scout.com ... ranked as No. 16 prospect in the state of Michigan by scout.com and Rivals.com ... No. 89 wide receiver nationally according to Rivals.com ... SuperPrep All-American and the
No. 26 player in the Midwest ... four-star and the nation’s No. 39 wide receiver by Scouts, Inc. ... played in the Hawaii/Polynesia-Mainland Bowl ... all-area selection as a senior.
Personal ... Jeremy Jackson was born July 18, 1992 ... son of Michigan running backs coach Fred Jackson ... enrolled in the School of Kinesiology, majoring in sport management.
Jeremy Jackson’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 9/0 4 55 13.8 6.1 0 222011 12/0 4 49 12.3 4.9 0 19Career 21/0 8 104 13.0 5.5 0 22
Jeremy Jackson’s Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan 0 0 0.0 0 0Notre Dame 0 0 0.0 0 0Eastern Michigan 1 12 12.0 0 12San Diego State 0 0 0.0 0 0Minnesota 0 0 0.0 0 0at Northwestern 1 19 19.0 0 19At Michigan State 0 0 0.0 0 0Purdue 1 5 5.0 0 5 at Iowa 1 13 13.0 0 13at Illinois 0 0 0.0 0 0Nebraska 0 0 0.0 0 0Ohio State 0 0 0.0 0 0Season Totals 4 49 12.3 0 19
Jackson’s Career Bests:ReceivingReceptions: 2, twice (last vs. Ohio State, Nov. 27, 2010)Yards: 31 vs. Ohio State (Nov. 27, 2010)Touchdowns: NoneLong: 22 vs. Ohio State (Nov. 27, 2010)
zac JohNsoN ***#36 • Safety6-2 • 205 • 5th-Sr.Morenci, Mich.Morenci HS
At Michigan ... three-year letterman ... two-time Academic All-Big Ten ... appeared in 39 career games ... contributed 17 tackles on special teams ... switched his jersey number from #19 to #36 prior to 2010 opener.
Fifth-Year Senior (2011) ... Academic All-Big Ten ... appeared in 10 games; played 10 on special teams ... MICHIGAN STATE (Oct. 15) ... served as honorary senior game captain.
Senior/Junior (2010) ... earned third varsity letter ... switched from jersey #19 to #36 prior to the opener ... appeared in 10 games ... recorded four special teams tack-les ... played on special teams units vs. Connecticut (Sept. 4) ... made two special teams stops at Notre Dame (Sept. 11) ... assisted on a tackle on the kickoff coverage unit vs. Massachusetts (Sept. 18) ... posted one solo tackle on spe-cial teams vs. Bowling Green (Sept. 25) ... did not see game action against Indiana (Oct. 2), Michigan State (Oct. 9), and Iowa (Oct. 16) ... contributed on special teams at Penn State (Oct. 30), vs. Illinois (Nov. 6) and at Purdue (Nov. 13) ... appeared on special teams units vs. Wisconsin (Nov. 20) and at Ohio State (Nov. 27) ... saw game action on special teams units vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... earned second varsity letter ... Academic All-Big Ten ... appeared in seven games ... con-tributed five special teams tackles ... saw game action on special teams vs. Western Michigan (Sept. 5) ... contributed on special teams vs. Notre Dame (Sept. 12) ... recorded two
tackles on special teams vs. Eastern Michigan (Sept. 19) ... played on special teams vs. Indiana (Sept. 26) ... missed five straight contests from Michigan State (Oct. 3) through Illinois (Oct. 31) due to injury ... returned to game action on special teams vs. Purdue (Nov. 7), making two tackles ... assisted on one special teams stop at Wisconsin (Nov. 14) ... played on special teams units vs. Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... earned first varsity let-ter ... U-M Athletic Academic Achievement ... played in all 12 games ... registered eight special teams tackles ... contributed on special teams vs. Utah (Aug. 30), his first collegiate action ... played special teams vs. Miami (Sept. 6) and at Notre Dame (Sept. 13) ... assisted on a special teams stop vs. Wisconsin (Sept. 27) ... collected one special teams tackle vs. Illinois (Oct. 4) ... recorded one special teams stop vs. Toledo (Oct. 11) ... contributed on special teams at Penn State (Oct. 18) ... tallied one special teams stop vs. Michigan State (Oct. 25) ... contributed two special teams tackles at Purdue (Nov. 1) ... participated on special teams at Minnesota (Nov. 8) ... saw special teams action vs. Northwestern (Nov. 15) ... made two special teams tackles at Ohio State (Nov. 22).
Freshman (2007) ... U-M Athletic Academic Achievement ... did not see game action.
Prep ... attended Morenci High School (2007) ... four-year letterman in football ... MVP ... team captain ... Hall of Fame Scholar Athlete ... National Honor Society member and vice president ... earned academic all-conference honors all four years ... received Scholar-Athlete Award all four years ... Honors and Rankings ... All-Tri County Conference sophomore, junior and senior years ... received All-County accolades as a junior ... Other Sports ... four-year letterman in wrestling ... league champion all four years ... county runner-up and regional runner-up as a sophomore, junior and senior ... won district championship senior year ... team captain junior and senior years ... four-year letterman in track ... earned track MVP honors as a sophomore and junior ... 100-meter dash state qualifier as a senior ... 4x-400 relay state qualifier ... 200-meter dash regional champion junior year.
Personal ... Zachary Eric Johnson was born July 23, 1988 ... father, Eric, wrestled at Ferris State University ... earned a Bachelor’s degree from in the College of Literature, Science and the Arts, majoring in sociology with minor in Afro-American and African studies ... enrolled in the Rackham School of Graduate Studies, concentrating in kinesiology.
Zac Johnson’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2008 12/0 6-2-8 0-0 0-0 0-0 0-0 02009 7/0 3-2-5 0-0 0-0 0-0 0-0 02010 11/0 2-2-4 0-0 0-0 0-0 0-0 02011 11/0 0-0-0 0-0 0-0 0-0 0-0 0Career 40/0 11-6-17 0-0 0-0 0-0 0-0 0
mike JoNes *#27 • Linebacker6-2 • 224 • Jr.-So.Orlando, Fla.Edgewater HS
Junior/Sophomore (2011) ... appeared in eight games; played in six games as a reserve linebacker and five games on special teams ... PURDUE (Oct. 29) ... matched career high for total tackles and solo tackles with two solo stops.
Sophomore (2010) ... redshirted ... appeared in two games ... played linebacker and special teams vs. Connecticut (Sept. 4) ... assisted on one special teams tackle at Notre
Dame (Sept. 11) ... suffered a season-ending leg injury.
Freshman (2009) ... earned first varsity letter ... played in seven games ... made collegiate debut on special teams vs. Indiana (Sept. 26), making two solo tackles ... played special teams At Michigan State (Oct. 3) and Iowa (Oct. 10) ... earned playing time on special teams vs. Delaware State (Oct. 17) and Penn State (Oct. 24) ... recorded an assisted tackle on special teams at Illinois (Oct. 31) ... contributed on special teams vs. Purdue (Nov. 7).
Prep ... attended the Edgewater High School (Dec. 2008) coached by Bill Gierke ... played safety, linebacker and run-ning back ... ran 40-yard dash in 4.5 seconds and recorded a 36-inch vertical leap ... Key Statistics ... posted 116 tackles and 12 sacks during his career ... made 60 tackles, four sacks and blocked two kicks as senior ... registered 56 tackles, eight sacks and four caused fumbles despite playing just five games as a junior ... Honors and Rankings ... three-star prospect and the nation’s No. 25 safety according to Rivals.com ... rated as No. 70 overall player in the state of Florida by Rivals.com ... All-Southeast region by Prep Star ... three-star prospect and the nation’s No. 49 safety according to scout.com ... listed as 96th overall prospect in the state of Florida by SuperPrep ... Other Sports ... long jumped 22 feet ... ran 200m in 22.0 seconds.
Personal ... Michael Pierre Jones was born July 31, 1990 ... father, Aaron Jones Sr., played in the NFL with the New England Patriots, Miami Dolphins and Pittsburgh Steelers as a defensive end and linebacker ... father was No. 18 overall pick of the 1988 NFL Draft out of Eastern Kentucky ... brother, Aaron, played football at Florida State (2004-06) and Eastern Kentucky (2007-08) ... sister, Ciara, is a senior on the Marquette volleyball team ... from same high school as former U-M wide receiver Greg Mathews ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Mike Jones’ Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 7/0 2-1-3 0-0 0-0 0-0 0-0 02010 2/0 0-1-1 0-0 0-0 0-0 0-0 02011 9/0 3-1-4 0-0 0-0 0-0 0-0 0Career 18/0 5-3-8 0-0 0-0 0-0 0-0 0
JoNathaN keizer
#27 • Wide Receiver6-5 • 205 • FrPortage, MIPrtage Northern HS
Freshman (2011) ... did not see game action.
Personal ... enrolled in the College of Engineering, major undeclared.
Jack keNNedy #14 • Quarterback5-11 • 185 • Sr.-Jr.Walled Lake, Mich.Walled Lake Central HS
Senior/Junior (2011) ... did not see game action.
Junior/Sophomore (2010) ... did not see game action.
Sophomore/Freshman (2009) ... made collegiate debut at quarterback vs. Delaware State (Oct. 17), rushing once for six yards.
Prep ... attended Walled Lake Central High School (2008) coached by Bob Meyer ... National Honor Society member ... three-year letterman in football ... elected team captain as a senior ... Other Sports ... four-year varsity letterman in ice hockey ... team captain as a senior ... All-Oakland County in hockey as junior and senior ... varsity letterman in baseball as a junior and senior.
Personal ... Jack Daniel Kennedy was born Oct. 4, 1989 ... enrolled in the School of Literature, Science and the Arts, majoring in physics and mathematics.
Joe kerridge
#36 • Fullback6-0 • 231 • Fr.Traverse City, Mich.St. Francis HS
Freshman (2011) ... did not see game action.
Prep ... attended St. Francis High School (2011) ... Honors and Rankings ... three-year letterwinner in football (2008-10) ... two-time Division VII State Champion (2008-09) ... rushed for 2,153 career yards with 34 touchdowns ... team captain in 2010, saw limited action due to injury ... Kornblue No. 18 Fab Fifty Punter nationally and top junior (2009) ... AP all-state honorable mention at running back and punter (2009) ... Detroit News honorable mention at running back and linebacker (2009) ... all-region dream team running back (2009) ... all-Lake Michigan Conference first team running back (2009) ... AP all-state punter in 2008 ... Detroit Free Press all-state first team punter (2008) ... two-time all-Lake Michigan Conference athletic and academic excel-lence (2008-09) ... also lettered in basketball.
Personal ... Joseph Kerridge was born September 17, 1992 ... enrolled in the School of Kinesiology, major undeclared.
rocko khoury **#63 • Offensive Lineman6-4 • 287 • Sr.-Jr.Traverse City, Mich.Traverse City West HS
Senior/Junior (2011) ... appeared in four games; played four games as reserve center.
Junior/Sophomore (2010) ... earned second varsity let-ter ... appeared in three contests ... saw game action as a reserve at center vs. Connecticut (Sept. 4) ... did not play against Notre Dame (Sept. 11) and Massachusetts (Sept. 18) ... played as a reserve at center vs. Bowling Green (Sept. 25) ... saw first extensive action at center after entering the Iowa (Oct. 16) game early in the first quarter.
Sophomore/Freshman (2009) ... earned first varsity letter ... appeared in three games ... made career debut at center vs. Western Michigan (Sept. 5) ... saw action at center vs. Eastern Michigan (Sept. 19) ... played at right guard against Delaware State (Oct. 17).
Freshman (2008) ... did not see game action.
Prep ... attended Traverse City West High School (2008) coached by Matt Prisk ... transferred from Traverse City Central to Traverse City West following his junior season ... carried a 3.5 grade point average ... four-time All-Academic Award recipient ... Great 8 Award recipient from the Mid-Michigan Touchdown Club, a chapter of the National Football Foundation ... four-year starter along the offensive
line ... Key Statistics ... helped team set a school record with 1,500 passing yards during senior campaign ... recorded 197 tackles, 26 tackles for loss, 17 sacks, nine forced fumbles and three fumble recoveries during his career ... Honors and Rankings ... three-star prospect and the nation’s No. 41 offensive tackle according to Rivals.com ... rated as the 11th-best player in the state of Michigan by Rivals.com ... three-star prospect and No. 65 offensive tackle nationally by Scout.com ... earned first-team all-state honors as well as the Great 8 Michigan Top Offensive Lineman Award as a senior ... PrepStar Magazine All-Midwest Region team ... Detroit Free Press All-State Dream Team and Academic Award, all-conference first-team offense and defense, Detroit News Dream Team and Record Eagle All-Region Dream Team senior year ... Associated Press All-State first team as a senior ... participated in the 2006 Columbus NIKE Training Camp ... attended both the West Lafayette NIKE Training Camp and the Chicago NIKE Combine in 2007 ... Other Sports ... received varsity letters in baseball and track and field ... won conference championship in the shotput event as a freshman.
Personal ... Ryan Jordan Rocko Khoury was born Jan. 13, 1990 ... attended the Michigan Summer Football Camp ... enrolled in the College of Literature, Science and the Arts, majoring in political science.
Kevin Koger *** #86 • Tight End 6-4 • 258 • Sr.Toledo, OhioWhitmer HS
At Michigan ... 2011 season captain ... three-year letterman and starter at tight end ... played in 46 career contests and made 30 starts.
Senior (2011)... All-Big Ten honorable mention (coaches and media) ... voted a 2011 season captain by teammates during fall camp ... named to the Mackey Award preseason watch list ... appeared in all 12 games; started 11 games at tight end (Western Michigan, Notre Dame, Eastern Michigan, San Diego State, Minnesota, Northwestern, Michigan State, Purdue, Iowa, Nebraska, Ohio State) and contributed each game on special teams ... team’s third leading receiver with 21 receptions for 235 yards ... led the team with four receiving touchdowns ... OHIO STATE (Nov. 26) ... grabbed a career-matching four receptions for 40 yards and a touchdown in the fourth quarter ... ILLINOIS (Nov. 12) ... snagged two passes for a season-high 42 yards ... IOWA (Nov. 5) ... caught three passes for 18 yards and posted third touchdown of the season in the fourth quarter ... MINNESOTA (Oct. 1) ... set season-high three catches for 35 yards and a touchdown ... EASTERN MICHIGAN (Sept. 17) ... two catches for 21 yards and a touchdown.
Junior (2010) ... earned third varsity letter ... John Mackey Award watch list ... started in eight games and appeared in all 13 contests at tight end ... caught 14 passes for 199 yards and two touchdowns ... started at tight end vs. Connecticut (Sept. 4), grabbing three passes for 30 yards ... made start at tight end against Notre Dame (Sept. 11) ... played at tight end vs. Massachusetts (Sept. 18) and Bowling Green (Sept. 25) ... caught one pass for a three-yard touchdown in start at Indiana (Oct. 2) ... made one reception for six yards in start vs. Michigan State (Oct. 9) ... posted three catches for 26 yards in start vs. Iowa (Oct. 16) ... his one reception in start at Penn State (Oct. 30) was a career-long, 60-yard touchdown ... started at tight end vs. Illinois (Nov. 6) ... caught two passes for 29 yards as a reserve tight end at Purdue (Nov. 13) ... played as a reserve tight end and on special teams vs. Wisconsin (Nov. 20) ... grabbed one pass for three yards in start at Ohio State (Nov. 27) ... had two
passes for 42 yards as a reserve tight end vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore (2009) ... earned second varsity letter ... start-ed eight of 12 games at tight end ... caught 16 passes for 220 yards (13.8 avg.) and scored two touchdowns ... made fourth career start at tight end and contributed on special teams vs. Western Michigan (Sept. 5), catching three passes for 32 yards including a seven-yard touchdown reception ... started at tight end and contributed on special teams vs. Notre Dame (Sept. 12), tallying career-high four receptions for 38 yards ... caught a three-yard touchdown pass in the third quarter against the Irish ... made start at tight end and helped on special teams vs. Eastern Michigan (Sept. 19), tallying one assisted tackle ... had 36-yard reception in start vs. Indiana (Sept. 26) ... made one tackle on special teams against the Hoosiers ... 41-yard career long reception At Michigan State (Oct. 3) ... started at tight end against Iowa (Oct. 10), catching three passes for 27 yards ... saw action at tight end and on special teams vs. Delaware State (Oct. 17) ... started at tight end vs. Penn State (Oct. 24) ... caught three passes for 37 yards in start at Illinois (Oct. 31) ... had nine-yard reception vs. Purdue (Nov. 7) ... played tight end at Wisconsin (Nov. 14) and vs. Ohio State (Nov. 21).
Freshman (2008) ... earned first varsity letter ... U-M Athletic Academic Achievement award ... appeared in nine games at tight end and made three starts ... made collegiate debut at tight end vs. Wisconsin (Sept. 27) ... first career catch was 26-yard touchdown in the third quarter against the Badgers ... team’s only tight end to see action vs. Illinois (Oct. 4) ... had five-yard touchdown pass called back due to a penalty against the Fighting Illini ... played at tight end vs. Toledo (Oct. 11) ... made first career start in the Penn State (Oct. 18) game, collecting a career-best three recep-tions and 26 yards ... caught two passes for 41 yards in start vs. Michigan State (Oct. 25) ... hauled in a 35-yard career long reception that set up a second quarter touchdown against the Spartans ... played tight end and on special teams at Purdue (Nov. 1) and Minnesota (Nov. 8) ... started third career contest at tight end vs. Northwestern (Nov. 15) ... played tight end at Ohio State (Nov. 22).
Prep ... attended Whitmer High School (2008) coached by Joe Palka ... Key Statistics ... holds school record with 1,190 career receiving yards on 75 receptions ... finished career with 16 offensive touchdowns ... recorded 151 tackles, 28 tackles for loss, 16 sacks, two forced fumbles, three fumble recoveries, two interceptions and one interception return for a touchdown during his career ... made 31 receptions for 361 yards and scored five TDs as a senior ... contributed 48 tackles and seven sacks senior year ... caught 23 passes for 351 yards (16.1 avg.) and five touchdowns as a junior ... recorded 65 tackles, five TFLs, three sacks and two intercep-tions during junior year ... Honors and Rankings ... PrepStar Magazine All-American ... four-star prospect, the nation’s fourth-best tight end and No. 10 player in the state of Ohio according to Rivals.com ... four-star prospect and sixth-best tight end nationally by Scout.com ... rated No. 5 on the Detroit Free Press Best of the Midwest rankings ... 107th-best defensive end nationally by ESPN.com ... All-Ohio first team at defensive end as senior ... all-city as a tight end and defensive end as a junior.
Personal ... Kevin Jamaal Koger was born Dec. 12, 1989 ... sister, LaShawnda Thorne, played volleyball At Michigan and earned a varsity letter in 1991 ... enrolled in the School of Kinesiology, majoring in sport management.Kevin Koger’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2008 9/3 6 93 15.5 10.3 1 352009 12/8 16 220 13.8 18.3 2 412010 13/8 14 199 14.2 15.3 2 602011 12/11 21 235 11.2 19.6 4 40Career 46/30 55 705 12.8 15.7 9 60
Kevin Koger’s Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan 2 16 8.0 0 11Notre Dame 1 11 11.0 0 11Eastern Michigan 2 21 10.5 1 12San Diego State 0 0 0.0 0 0Minnesota 3 35 11.7 1 18at Northwestern 2 36 18.0 0 19At Michigan State 2 16 8.0 0 12Purdue 0 0 0.0 0 0at Iowa 3 18 6.0 1 9at Illinois 2 42 21 0 40Nebraska 0 0 0.0 0 0Ohio State 4 40 10.0 1 26Season Totals 21 235 11.2 4 40
Koger’s Career Bests:ReceivingReceptions: 4, twice (last vs. Ohio State, Nov. 26, 2011)Yards: 60, at Penn State (Oct. 30, 2010)Touchdowns: 1, nine times (last vs. Ohio State, Nov. 26, 2011)Long: 60, at Penn State (Oct. 30, 2010)
JordaN kovacs **#32 • Safety6-0 • 197 • Sr.-Jr.Curtice, OhioClay HS
At Michigan ... two-year varsity letterman ... appeared in 36 contests ... started 32 games at safety ... registered his 200th career tackle vs. Western Michigan (Sept. 3, 2011) ... recorded his 100th career tackle vs. Massachusetts (Sept. 18, 2010).
Senior/Junior (2011)... Academic All-Big Ten ... All-Big Ten honorable mention (media) ... Phil Steele’s Midseason All-Big Ten second team selection ... named to the Lott IMPACT Trophy preseason watch list ... appeared in 11 games; started 11 at strong safety (Western Michigan, Notre Dame, Eastern Michigan, San Diego State, Minnesota, Northwestern, Michigan State, Iowa, Illinois, Nebraska, Ohio State) and played 11 on special teams ... team’s second leading tackler with 64 stops ... tied for second on team in TFLs (8) and sacks (4) ... OHIO STATE (Nov. 26) ... recorded four tackles, including two for a loss, and a sack ... NEBRASKA (Nov. 19) ... led the team with seven tackles and a TFL ... ILLINOIS (Nov. 12) ... tallied five tackles, a TFL and a fifth career forced fumble ... MICHIGAN STATE (Oct. 15) ... posted six solo tackles and second career fumble recovery ... NORTHWESTERN (Oct. 8) ... notched seven tackles, two TFLs and a fourth-down sack in the fourth quarter to force a turnover on downs ... NOTRE DAME (Sept. 10) ... posted eight tackles and fourth career interception ... WESTERN MICHIGAN (Sept. 3) ... led the team with 10 tackles, includ-ing two for a loss, a career-best two sacks, a forced fumble and a pass breakup ... his sack and forced fumble was returned for a touchdown by Brandon Herron ... named Lott IMPACT Player of the Week for performance against the Broncos.
Junior/Sophomore (2010) ... earned second varsity letter ... All-Big Ten honorable mention (media) ... Burlsworth Trophy nominee, honoring an outstanding player who began collegiate career as a walk-on ... started all 13 con-tests at strong safety ... second in Big Ten with 116 tackles (8.9 avg.) ... recorded 8.5 TFLs, one sack, two intercep-tions, one forced fumble, one fumble recovery and one pass breakup ... posted six tackles and an assisted TFL vs. Connecticut (Sept. 4) ... posted 10 tackles and one inter-ception at Notre Dame (Sept. 11) ... tallied game-high 11 tackles, one TFL, one forced fumble, one fumble recovery in start at strong safety vs. Massachusetts (Sept. 18) ... his
forced fumble and recovery allowed U-M to score its sec-ond touchdown in a span of 45 seconds late in the second quarter ... registered team-high eight tackles, including one for a loss of two yards, in start vs. Bowling Green (Sept. 25) ... posted third double-digit tackle performance of the season in start at Indiana (Oct. 2), making 11 stops and one TFL ... accumulated seven tackles and assisted on a tackle for loss in start vs. Michigan State (Oct. 9) ... tallied eight tackles, including a career-tying 2.5 tackles for loss, and a pass breakup in start vs. Iowa (Oct. 16) ... recorded 11 tackles as a starting strong safety at Penn State (Oct. 30) ... registered nine tackles in start vs. Illinois (Nov. 6) ... had two solo tackles in start at Purdue (Nov. 13) ... notched 12 tack-les and a sack for a loss of eight yards in start vs. Wisconsin (Nov. 20) ... matched career-high with 17 tackles, including one for a loss, and returned an interception 41 yards in start against Ohio State (Nov. 27) ... notched four tackles in start vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore/Freshman (2009) ... earned first varsity let-ter ... Rudy Award (candidate) ... CollegeFootballNews.com Freshman All-America second team ... Sporting News Freshman All-Big Ten ... played in 12 games and made eight starts at safety ... second on the team with 75 tackles, including 4.5 tackles for loss, two forced fumbles, one interception ... recorded three double-digit tackle efforts ... made career debut on special teams vs. Western Michigan (Sept. 5), recording one assisted tackle ... played safety and on special teams vs. Notre Dame (Sept. 12), record-ing three tackles ... accumulated six tackles and assisted on one TFL vs. Eastern Michigan (Sept. 19), playing safety and special teams ... made first collegiate start at safety vs. Indiana (Sept. 26), posting four tackles and one TFL ... led team with 17 tackles, 2.5 TFLs and one forced fumble At Michigan State (Oct. 3) ... his 17 stops against the Spartans were the most by any conference defender during season ... started at strong safety against Iowa (Oct. 10), recording team-best 11 tackles and 0.5 TFLs ... totaled three stops in start at safety vs. Delaware State (Oct. 17) ... registered five stops in start against Penn State (Oct. 24) ... made two solo tackles in start at safety against Illinois (Oct. 31) ... posted four tackles in start at safety vs. Purdue (Nov. 7) ... recorded 10 tackles, one forced fumble and first career interception at Wiscconsin (Nov. 14) ... contributed nine stops vs. Ohio State (Nov. 21).
Prep ... attended Clay High School (2008) coached by Mike Donnelly ... four-year honor roll member ... Fellowship of Christian Athletes ... All-Ohio academic honors ... three-year varsity letterman in football ... Honors and Rankings ... received special mention All-Ohio as a senior ... first-team all-district at receiver senior year ... first-team all-district at defensive back as a junior ... first-team All-Toledo City League as a defensive back junior and senior years ... first-team all-city at wide receiver senior year ... honor-able mention all-city as a sophomore ... Other Sports ... four-year letterman in track ... first-team all-city senior year and second-team all-city selection as a junior ... state meet qualifier in 4x400 relay final two years ... honorable mention all-city sophomore year ... varsity letterman in basketball as a sophomore and junior.
Personal ... Jordan David Kovacs was born June 12, 1990 ... father, Louis, was a defensive back on the U-M football team in the early 1980s (lettered in 1982) ... enrolled in the School of Kinesiology, majoring in movement science.
Jordan Kovacs’ Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 12/8 39-36-75 4..5-10 0-0 1-0 0-0 12010 13/13 61-55-116 8.5-24 1-8 2-51 1-0 12011 11/11 45-19-64 8-48 4-36 1-2 1-0 1Career 36/32 145-110-255 21-82 5-44 4-53 2-0 3
Jordan Kovacs’ Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 7-3-10 2-16 2-16 0-0 0-0 1Notre Dame 5-3-8 0-0 0-0 1-2 0-0 0Eastern Michigan 4-4-8 0-0 0-0 0-0 0-0 0San Diego State 1-1-2 0-0 0-0 0-0 0-0 0Minnesota 0-1-1 0-0 0-0 0-0 0-0 0at Northwestern 5-2-7 2-11 1-10 0-0 0-0 0At Michigan State 6-0-6 0-0 0-0 0-0 1-0 0Purdue - - - - - -at Iowa 4-2-6 0-0 0-0 0-0 0-0 0at Illinois 3-2-5 1-4 0-0 0-0 0-0 0Nebraska 7-0-7 1-5 0-0 0-0 0-0 0Ohio State 3-1-4 2-12 1-10 0-0 0-0 0Season Totals 45-19-64 8-48 4-36 1-2 1-0 1
Kovacs’ Career Bests:Tackles: 17, twice (last at Ohio State, Nov. 27, 2010)Solos: 9, at Ohio State (Nov. 27, 2010)Asst: 10, At Michigan State (Oct. 3, 2009)TFLs: 2.5, twice (last vs. Iowa, Oct. 16, 2010)Sacks: 2, vs. Western Michigan (Sept. 3, 2011)Int.: 1, four times (last vs. Notre Dame, Sept. 10, 2011)FR: 1, twice (last At Michigan State, Oct. 15, 2011)PBUs: 1, 3 times (last vs. Western Michigan, Sept. 3, 2011)
mike kWiatkoWski#81 • Tight End6-5 • 257 • Sr.-Jr.Macomb, Mich,Dakota HS
Senior/Junior (2011) ... appeared in two games as a reserve tight end, once on special teams ... MINNESOTA (Oct. 1)i ... made collegiate debut as a reserve tight end and on special teams.
Prep … attended Dakota High School (2008)… National Honor Society member … honor roll student … played var-sity football as a senior, helping school to the state champi-onship … recorded 26 receptions for 351 yards and seven touchdowns … also played two years or varsity basketball.
Personal ... Michael Gerald Kwiatkowski was born February 9, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in brain, behavior and cognitive science.
taylor leWaN *#77 • Offensive Lineman6-8 • 302 • Jr.-So.Scottsdale, Ariz.Chaparral HS
Junior/Sophomore (2011)... All-Big Ten second team (coaches), honorable mention (media) ... Phil Steele’s Midseason All-Big Ten second team selection ... played in all 12 games as starter at left tackle.
Sophomore/Freshman (2010) ... earned first varsity let-ter ... named to CollegeFootballNews.com Freshman All-America second team ... appeared in 11 games and started nine contests at left tackle ... did not see game action in opener vs. Connecticut (Sept. 4) ... made collegiate debut as a reserve left tackle in the goal line package at Notre Dame (Sept. 11) ... played as backup left tackle vs. Massachusetts (Sept. 18) ... made first career start at left tackle vs. Bowling Green (Sept. 25) ... opened up the game at left tackle against Indiana (Oct. 2), Michigan State (Oct. 9) and Iowa (Oct. 16) ... started at left tackle against Penn State (Oct. 30) and Illinois (Nov. 6) ... picked up a Michigan fumble and advanced it 11 yards in start at left tackle against Purdue (Nov. 13) ... missed the Wisconsin (Nov. 20) game due to
a head injury ... returned to game action in start at left tackle against Ohio State (Nov. 27) ... started at left tackle vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Chaparral High School (2009) coached by Charlie Ragle ... transferred to Chaparral for his senior year after playing at Cave Creek Cactus Shadows in 2007 ... played offensive line for the first time as a senior ... played defensive end prior to his senior year ... helped lead team to Class 4A-I state championship game during senior year ... ran 40-yard dash in 4.72 seconds ... recorded a 335-pound maximum on bench press and 450-pound maximum squat ... Key Statistics ... started every game on the offensive line during his senior season ... totaled 96 tackles and seven sacks in two seasons on the defensive line ... posted 46 tackles and two sacks junior year ... Honors and Rankings ... four-star prospect by Rivals.com and scout.com ... selected fifth-best player in the state of Arizona and the 194th player nationally by Rivals.com ... listed as No. 3 most athletic offensive lineman and the fifth-most agile offensive line-man according to Rivals.com ... rated as nation’s 16th-best offensive tackle by Rivals.com ... SuperPrep All-American and the nation’s No. 10 overall offensive line prospect ... rated as third-best prospect in the state of Arizona according to SuperPrep ... listed as the No. 20 offensive tackle nationally by scout.com ... ranked as the 12th-best offensive tackle prospect and the No. 148 overall prospect according to Scouts, Inc. ... selected as the 274th overall player by scout.com ... Prep Star All-American and named to the publication’s Top 250 ... Under Armour All-American game participant ... recipient of 2008 Frank Kush Award as the state of Arizona’s top interior offensive lineman ... Arizona Republic and East Valley Tribune all-state first team as a senior ... Desert Sky first-team All-Region senior year ... all-city first team as a senior.
Personal ... Taylor Curtis Lewan was born July 21, 1991 ... father, Dave, was an offensive lineman at Minnesota ... high school teammate of defensive end Craig Roh ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
mike martiN ***#68 • Defensive Tackle6-2 • 304 • Sr.Redford, Mich.Catholic Central HS
At Michigan ... 2011 season captain ... three-year letterman ... 2011 All-Big Ten second team (coaches and media) ... 2010 All-Big Ten (second team coaches, honorable mention media) ... played in 48 games ... started 36 contests at nose tackle, 15 consecutively ... notched his 100th career tackle vs. Wisconsin (Nov. 20, 2010).
Senior (2011)... All-Big Ten second team (coaches and media) ... Phil Steele’s Midseason All-Big Ten second team selection ... voted a 2011 season captain by teammates during fall camp ... named to the Bednarik Award and Rotary Lombardi Award preseason watch lists ... played in all 12 games; started each game at nose tackle and con-tributed on special teams in nine games ... team’s fourth leading tackler with 54 stops ... ILLINOIS (Nov. 12) ... posted a season-high nine tackles, matching a career best with six assisted stops, and an assisted sack ... IOWA (Nov. 5) ... recorded six tackles and a team-high 1.5 TFLs ... PURDUE (Oct. 29) ... tallied seven tackles, two TFLs and career-high two sacks ... first sack resulted in a safety, U-M’s first since 2003 ... NORTHWESTERN (Oct. 8) ... seven tackles and recorded a half sack for three yards ... NOTRE DAME (Sept. 10) ... recorded one tackle for loss, three total tackles.
Junior (2010) ... earned third varsity letter ... All-Big Ten second team (coaches) and honorable mention All-Big Ten (media) ... U-M’s Richard Katcher Award (top defensive lineman) ... Phil Steele’s Midseason All-Big Ten second team ... started 12 contests at nose tackle ... registered 37 tackles, six TFLs and 2.5 sacks ... contributed two tackles and an assisted TFL vs. Connecticut (Sept. 4) ... made one solo tackle at Notre Dame (Sept. 11) ... recorded six tackles, including two for loss, and a sack for a loss of 12 yards in start vs. Massachusetts (Sept. 18) ... posted one solo tackle in start vs. Bowling Green (Sept. 25) ... tallied seven tackles, including a game-high two for loss, and a sack in start at Indiana (Oct. 2) ... accumulated six tackles, including one for a loss, and assisted on a sack in start vs. Michigan State (Oct. 9) ... started at nose tackle vs. Iowa (Oct. 16) and at Penn State (Oct. 30) ... registered three tackles in start vs. Illinois (Nov. 6) ... missed the Purdue (Nov. 13) contest due to an ankle injury ... returned to game action in start vs. Wisconsin (Nov. 20), made four tackles, including an assisted tackle for loss ... notched six tackles in start at Ohio State (Nov. 27) ... assisted on a tackle in start vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore (2009) ... earned second varsity letter ... U-M’s Richard Katcher Award (top defensive lineman) ... started all 12 games at nose tackle ... contributed career-best 51 tackles, including 8.5 tackles for loss, two sacks, forced one fumble ... finished second on the team in TFLs ... made first career start at nose tackle and contributed on special teams vs. Western Michigan (Sept. 5), tallying three tackles, one TFL and one sack ... posted three stops vs. Notre Dame (Sept. 12) ... recorded four tackles and assisted on one TFL vs. Eastern Michigan (Sept. 19) ... had three tackles vs. Indiana (Sept. 26) ... had one TFL and two assisted stops At Michigan State (Oct. 3) ... made five tackles, including an assisted TFL, at Iowa (Oct. 10) ... posted one stop vs. Delaware State (Oct. 17) ... career-high eight tackles and an assisted TFL vs. Penn State (Oct. 24) ... five tackles and one TFL at Illinois (Oct. 31) ... earned two tackles and forced first career fumble vs. Purdue (Nov. 7) ... set career-highs with 10 tackles and three TFLs at Wisconsin (Nov. 14) ... contributed five tackles and one sack vs. Ohio State (Nov. 21).
Freshman (2008) ... earned first varsity letter ... Sporting News All-Freshman second team ... Phil Steele’s All-Freshman third team ... played in all 12 games at defensive tackle ... led all U-M freshmen with 20 tackles ... also con-tributed 4.5 tackles for loss and two sacks ... made career debut vs. Utah (Aug. 30), playing defensive tackle and special teams ... assisted on a tackle for loss against the Utes ... earned first career sack and posted two tackles vs. Miami (Sept. 6) ... assisted on a tackle at Notre Dame (Sept. 13) ... posted two tackles and one TFL vs. Wisconsin (Sept. 27) ... registered two tackles and one TFL vs. Illinois (Oct. 4) ... earned one solo stop vs. Toledo (Oct. 11) ... assisted on two tackles at Penn State (Oct. 18) ... tallied one sack and three solo stops vs. Michigan State (Oct. 25) ... played defensive tackle at Purdue (Nov. 1) and Minnesota (Nov. 8) ... assisted on three tackles vs. Northwestern (Nov. 15) ... equaled career high with three tackles at Ohio State (Nov. 22).
Prep ... attended Detroit Catholic Central High School (2008) coached by Tom Mach ... three-year starter at defen-sive tackle ... registered a 420-pound bench and a 520-pound squat ... Key Statistics ... finished varsity career with 206.5 tackles, 14.5 sacks and four fumble recoveries in three seasons ... recorded 96 tackles, 36 tackles for loss and six sacks senior year ... posted 75 tackles and eight sacks as a junior ... Honors and Rankings ... 2007 Gatorade Player of the Year for the state of Michigan ... PrepStar Magazine All-American ... four-star prospect and the 12th-best defensive tackle nationally according to Scout.com ... four-star pros-pect and the nation’s 16th-best defensive tackle by Rivals.com ... listed as second-strongest defensive tackle nation-ally by Rivals.com ... rated seventh-best player in the state of
Michigan by Rivals.com ... selected as nation’s eighth-best defensive tackle recruit by Scouts, Inc. ... ranked as top-300 prospect in the country by Tom Lemming ... rated No. 14 on the Detroit Free Press Best of the Midwest rankings ... Detroit Free Press All-State Dream Team ... Associated Press All-State first team as a senior ... participated in the Penn State NIKE Camp in 2007 ... Other Sports ... won state D1 wrestling title as a junior in first year competing ... record-setting shot-putter and discus thrower in track and field.
Personal ... Michael Brendan Martin was born September 1, 1990, in Detroit ... attended 2006 and ‘07 Michigan Summer Football Camp ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Mike Martin’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2008 12/0 9-11-20 4.5-19 2-15 0-0 0-0 02009 12/12 20-31-51 8.5-26 2-8 0-0 0-0 02010 12/12 21-16-37 6-39 2.5-32 0-0 0-0 02011 12/12 16-38-54 5.5-24 3-18 0-0 0-0 0Career 48/36 66-96-161 24.5-108 9.5-73 0-0 0-0 0
Mike Martin’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-1-1 0-0 0-0 0-0 0-0 0Notre Dame 1-2-3 1-2 0-0 0-0 0-0 0Eastern Michigan 0-2-2 0-0 0-0 0-0 0-0 0San Diego State 1-1-2 0-0 0-0 0-0 0-0 0Minnesota 0-1-1 0-0 0-0 0-0 0-0 0at Northwestern 2-5-7 0.5-3 0.5-3 0-0 0-0 0At Michigan State 2-3-5 0-0 0-0 0-0 0-0 0Purdue 2-5-7 2-7 2-7 0-0 0-0 0at Iowa 1-5-6 1.5-4 0-0 0-0 0-0 0at Illinois 3-6-9 0.5-8 0.5-8 0-0 0-0 0Nebraska 1-4-5 0-0 0-0 0-0 0-0 0Ohio State 3-3-6 0-0 0-0 0-0 0-0 0Season Totals 16-38-54 5.5-24 3-18 0-0 0-0 0
Martin’s Career Bests:Tackles: 10, at Wisconsin (Nov. 14, 2009)Solos: 9, at Wisconsin (Nov. 14, 2009)Asst: 6, twice (last at Illinois, Nov. 12, 2011)TFLs: 3, at Wisconsin (Nov. 14, 2009)Sacks: 2, vs. Purdue (Oct. 29, 2011)Int.: NoneFR: NonePBUs: None
kristiaN mateus#70 • Offensive Lineman6-7 • 285 • So.-Fr.Ada, Mich.Forest Hills Central HS
Sophomore/Freshman (2011) ... did not see game action.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... Graduated from Forest Hills Central High School (2010) ... two-year varsity letterwinner ... nominated for all-conference on offense and defense as a senior, earning the honor on offense.
Personal... Kristian Reid Mateus born September 27, 1992... son of Karlis and Geri Mateus... brother, Erik, plays football for Northwood University... enrolled in College of Literature, Science and the Arts, major undeclared.
JohN mccolgaN **#49 • Fullback6-1 • 240 • 5th-Sr.Saginaw, Mich.Nouvel Catholic HS
Fifth-Year Senior (2011)... Academic All-Big Ten ... appeared in 11 games; started once at fullback (Eastern Michigan) and played five other games as offensive reserve; contributed in 11 games on special teams ... ILLINOIS (Nov. 12) ... recovered first career fumble on special teams in third quarter when Fighting Illini muffed a punt ... NOTRE DAME (Sept. 10) ... second career reception went for career-best 15 yards.
Senior/Junior (2010) ... earned second varsity letter ... Academic All-Big Ten Conference ... started two games and appeared in all 13 contests ... played 10 games at fullback ... made first career start at fullback and contributed on spe-cial teams vs. Connecticut (Sept. 4) ... saw game action at fullback and on special teams at Notre Dame (Sept. 11) and vs. Massachusetts (Sept. 18) ... caught first career pass for two yards and a touchdown at fullback vs. Bowling Green (Sept. 25) ... appeared at fullback and special teams in Big Ten opener at Indiana (Oct. 2), notching two tackles ... con-tributed on special teams units vs. Michigan State (Oct. 9) ... played fullback and on special teams units vs. Iowa (Oct. 16) ... made appearnce on special teams at Penn State (Oct. 30) ... assisted on a tackle on special teams vs. Illinois (Nov. 6) ... appeared at fullback and on special teams against Purdue (Nov. 13) ... started at fullback and contributed on special teams vs. Wisconsin (Nov. 20) ... saw game action as a reserve fullback and on special teams at Ohio State (Nov. 27) ... appeared as a reserve fullback and on special teams vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... U-M Athletic Academic Achievement award ... earned first varsity letter ... appeared in 10 games ... made career debut at fullback vs. Western Michigan (Sept. 5) ... did not see action vs. Notre Dame (Sept. 12) ... saw action at fullback and on special teams vs. Eastern Michigan (Sept. 19) ... contributed on special teams vs. Indiana (Sept. 26) ... switched to jersey #49 from #43 prior to the Michigan State (Oct. 3) game ... played special teams in road games against MSU and Iowa (Oct. 10) ... appeared at fullback and on special teams against Delaware State (Oct. 17) ... participated on special teams vs. Penn State (Oct. 24), Illinois (Oct. 31), Purdue (Nov. 7) and Wisconsin (Nov. 14) ... did not see game action vs. Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... did not see game action.
Freshman (2007) ... did not see game action ... walked onto team prior to the season.
Prep ... attended Nouvel Catholic Central High School (2007) ... Bishop honor roll ... member of the International Club and Spanish Club ... Honors and Rankings ... earned all-area second team as a senior.
Personal ... John Arthur McColgan was born September 5, 1988 ... mother, Susie, graduated from the U-M School of Art and Design ... earned a Bachelor’s degree from the College of Literature, Science and the Arts, majoring in economics ... enrolled in the Master of Accounting program at the Stephen M. Ross School of Business.
elliott mealer **#57 • Offensive Lineman6-5 • 310 • Sr.-Jr.Wauseon, OhioWauseon HS
Senior/Junior (2011)... played in all 12 games; appeared as a reserve offensive lineman in seven games, contributed to special teams in all 12 games.
Junior/Sophomore (2010) ... earned second varsity letter ... appeared in all 13 games on special teams ... saw game action on the field goal/PAT protection unit vs. Connecticut (Sept. 4) and at Notre Dame (Sept. 11) ... played on the field goal/PAT protection unit vs. Massachusetts (Sept. 18) and Bowling Green (Sept. 25) ... contributed on the field goal/PAT protection units in Big Ten opener at Indiana (Oct. 2) ... saw game action on the field goal/PAT protection units vs. Michigan State (Oct. 9), vs. Iowa (Oct. 16) and at Penn State (Oct. 30) ... appeared on the field goal/PAT protection units against Illinois (Nov. 6), Purdue (Nov. 13) and Wisconsin (Nov. 20) ... contributed on field goal/PAT protection units at Ohio State (Nov. 27) ... appeared on special teams units vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore/Freshman (2009) ... earned first varsity letter ... played in 11 games ... made career debut at left guard vs. Western Michigan (Sept. 5) ... did not see game action vs. Notre Dame (Sept. 12) ... played left guard and on special teams vs. Eastern Michigan (Sept. 19) ... saw action on special teams vs. Indiana (Sept. 26) ... played on field goal protection unit At Michigan State (Oct. 3) ... contributed on special teams at Iowa (Oct. 10) ... played left guard and on special teams vs. Delaware State (Oct. 17) ... saw game action on field goal/PAT protection units against Penn State (Oct. 24), Illinois (Oct. 31), Purdue (Nov. 7), Wisconsin (Nov. 14) and Ohio State (Nov. 21).
Freshman (2008) ... did not see game action ... redshirted.
Prep ... attended Wauseon High School (2008) coached by Mark Emans ... helped team earn a share of the NWOAL title in 2007 ... three-year varsity starter ... bench pressed 305 pounds and squatted 465 pounds ... Key Statistics ... caught 21 career passes for 246 yards as a tight end ... tallied a career 46 tackles, six sacks, a pair of pass breakups and one fumble recovery ... played tight end and defensive end for the Indians as a senior, helping squad establish a school record with 3,230 rushing yards ... made four receptions for 55 yards and added 23 tackles and four sacks during senior year ... Honors and Rankings ... PrepStar Magazine All-American ... four-star prospect, the No. 213 prospect in the nation and the No. 24 offensive tackle in the country by Rivals.com ... 14th-best player in the state of Ohio according to Rivals.com ... four-star prospect and the nation’s 28th-best offensive tackle prospect by Scout.com ... Northwest Ohio Division IV Offensive Lineman of the Year as a senior ... listed as a top-300 prospect by Tom Lemming.
Personal ... Elliott Wade Mealer was born June 30, 1989 ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Jack miller#60 • Offensive Lineman6-4 • 263 • Fr.Perrysburg, OhioSt. Johns Jesuit HS
Freshman (2011) ... did not see game action.
Prep ... attended St. Johns Jesuit High School (2011) coached by Doug Pearson ... played defensive end and offensive tackle ... ran 40-yard dash in 4.78 sec-onds ... bench pressed 315 pounds and squatted 475 pounds ... had a 30-inch vertical jump ... Key Statis-tics ... posted 70 tackles and 15.5 sacks at defensive end senior year ... recorded 56 pancake blocks at offensive line as a senior ... registered 14 sacks as a junior ... Honors and Rankings ... listed as a three-star prospect and the No. 53 overall player in the state of Ohio by Rivals.com ... three-star and the No. 16 center prospect nationally according to Scout.com ... listed as three-star prospect and the No. 53 defen-sive tackle nationally by ESPN.com ... named to the Division I All-State first team as a senior ... awarded Lineman of the Year in his district as a senior.
Personal ... Jack Miller was born June 23, 1993 ... en-rolled in the College of Literature, Science and the Arts, major undeclared.
ricardo miller#80 • Tight End6-4 • 234 • So.-Fr.Orlando, Fla.Dr. Phillips (Fla.)/Pioneer (Mich.) HS
Sophomore/Freshman (2011)... Academic All-Big Ten ... appeared in eight games; played in two game as reserve tight end and contributed in eight games on special teams.
Freshman (2010) ... redshirted ... made his collegiate debut on special teams vs. Massachusetts (Sept. 18).
Prep ... attended Pioneer High School (2009) coached by Jeremy Gold ... led team to second round of the state playoffs as a senior ... attended Dr. Phillips High School in Orlando, Fla. (2006-08) ... National Honor Society member ... 2008 Student Athlete of the Year at his school ... invited to National Young Leaders Conference ... Key Statistics ... caught 35 passes for 669 yards and scored 10 touchdowns as a senior ... grabbed 34 receptions for 615 yards and eight TDs junior year ... made five catches for 75 yards and one TD and rushed nine times for 125 yards as a sophomore ... Honors and Rankings ... three-star recruit and the 12th-best player in the state of Michigan according to Rivals.com ... rated the No. 66 wide receiver nationally by Rivals.com ... four-star prospect and the nation’s No. 27 wide receiver according to scout.com ... seventh-best prospect in the state of Michigan by scout.com ... all-state honors senior year ... No. 4 player on The Detroit News Blue Chip list ... listed as No. 23 player in the state of Michigan by Detroit Free Press ... SuperPrep All-American and the No. 22 player in the Midwest ... four-star and the nation’s No. 27 wide receiver by Scouts, Inc. ... Prep Star All-American ... Orlando Sentinel All-County as a junior.
Personal ... James Ricardo Miller was born April 2, 1992 ... mother, Anne Reagor-Miller, graduated from the University of Michigan ... enrolled in the College of Literature, Science and the Arts, major undeclared.
david molk ***#50 • Offensive Lineman6-2 • 286 • 5th-Sr.Lemont, Ill.Lemont Township HS
At Michigan ... 2011 season captain ... three-year letterman and starter at center ... 2011 Rimington Trophy recipient ... 2011 Football Writers Association of America All-America first team ... 2011 Walter Camp All-America first team ... 2011 Big Ten Rimington-Pace Offensive Lineman of the Year ... 2011 All-Big Ten first team by coaches and second team by media ... 2010 All-Big Ten first team by coaches and second team by media ... started 41 career games at center.
Fifth-Year Senior (2011)... Rimington Trophy recipient ... Football Writers Association of America All-America first team ... Walter Camp All-America first team ... Big Ten Rimington-Pace Offensive Lineman of the Year ... All-Big Ten first team by coaches and second team by media ... Finalist for Rimington Trophy ... Phil Steele’s Midseason All-America and All-Big Ten first team selection ... voted a 2011 season captain by teammates during fall camp ... named to Rotary Lombardi Award preseason watch list ... started all 12 games at center.
Senior/Junior (2010) ... earned third varsity letter ... Rimington Trophy finalist ... All-Big Ten first team (coaches) and All-Big Ten second team (media) ... co-recipient of U-M’s Hugh R. Rader Memorial Award (top offensive line-man) ... Rotary Lombardi Award watch list ... Phil Steele’s Midseason All-Big Ten first team ... started all 13 contests at center ... made the start at center against Connecticut (Sept. 4) and Notre Dame (Sept. 11) ... opened the game at center vs. Massachusetts (Sept. 18) and Bowling Green (Sept. 25) ... started at center in Big Ten opener at Indiana (Oct. 2) ... made start at center vs. Michigan State (Oct. 9), Iowa (Oct. 16) and at Penn State (Oct. 30) ... opened the game at center against Illinois (Nov. 6), Purdue (Nov. 13) and Wisconsin (Nov. 20) ... started at center in regular-season finale against Ohio State (Nov. 27) ... made start at center vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... earned second varsity letter ... Lombardi Award candidate ... Rimington Trophy can-didate ... started four games at center ... started at center and contributed on special teams vs. Western Michigan (Sept. 5) and vs. Notre Dame (Sept. 12) ... made start at center vs. Eastern Michigan (Sept. 19) ... had started 15 consecutive games before injuring his foot against EMU ... missed four straight games from Indiana (Sept. 26) through Delaware State (Oct. 17) due to a foot injury ... returned to game action with start at center vs. Penn State (Oct. 24) ... injured on the first series against Penn State ... missed the rest of the season due to a knee injury suffered against the Nittany Lions.
Sophomore/Freshman (2008) ... earned first varsity let-ter ... recipient of the Iron Wolverine Award as the best all-around conditioned player from the linemen group ... started all 12 games at center ... played every snap at center during his first year as a starter ... made career debut and started at center vs. Utah (Aug. 30) ... earned start at center vs. Miami (Sept. 6) ... started at center in road game at Notre Dame (Sept. 13) ... started vs. Wisconsin (Sept. 27) ... earned start at center vs. Illinois (Oct. 4) ... opened game at center vs. Toledo (Oct. 11) ... starting center at Penn State (Oct. 18), against Michigan State (Oct. 25), at Purdue (Nov. 1), at Minnesota (Nov. 8), vs. Northwestern (Nov. 15) and at Ohio State (Nov. 22).
Freshman (2007) ... did not see game action.
Prep ... attended Lemont Township High School (2006) coached by Eric Michaelsen ... led team to a 31-12 record as a four-year starter at Lemont ... selected as team captain as a senior ... Honors and Rankings ... No. 1 center prospect nationally according to Max Emfinger ... ranked as the No. 3 center in the nation and a four-star recruit by Scout.com ... three-star prospect, the No. 5 center nationally and the No. 7 player in the state of Illinois according to Rivals.com ... listed as All-Region by PrepStar Magazine ... Chiefs Tribune All-State first team as a senior ... Champaign News Gazette All-State as a senior ... all-area selection by Daily Southtown and NCSA ... all-area by South Chicagoland area coaches following junior and senior seasons ... two-time All-Suburban Prairie Conference ... played in the East-West All-American game in Orland, Fla.
Personal ... David Michael Molk was born Dec. 15, 1988, in Palos Hills, Ill. ... attended the Michigan Summer Football Camp ... enrolled in the School of Kinesiology, majoring in sport management.
BraNdoN moore#89 • Tight End6-5 • 255 • Sr.-Jr.Trotwood, OhioTrotwood-Madison HS
Senior/Junior (2011)... appeared in 11 games; played as a reserve tight end in all 11 and contributed on special teams in three games ... PURDUE (Oct. 29) ... recorded second career catch for nine yards.
Junior/Sophomore (2010) ... made season debut on spe-cial teams vs. Massachusetts (Sept. 18) ... appeared as a reserve at tight end vs. Bowling Green (Sept. 25).
Sophomore/Freshman (2009) ... appeared in three games ... made career debut at tight end vs. Western Michigan (Sept. 5) ... saw action at tight end vs. Eastern Michigan (Sept. 19) ... earned first collegiate reception for 19 yards at tight end vs. Delaware State (Oct. 17).
Freshman (2008) ... did not see game action.
Prep ... attended Trotwood-Madison High School (2008) coached by Maurice Douglass ... carried a 4.25 grade point average ... Key Statistics ... 51 career receptions for 866 yards and 11 touchdowns ... scored four touchdowns and gained 518 receiving yards as a senior ... collected 25 receptions for 350 yards and five touchdowns junior year ... caught 13 passes and scored three TDs as a sophomore ... Honors and Rankings ... PrepStar Magazine All-American ... four-star prospect, the No. 8 tight end nationally and the 13th-best player in the state of Ohio by Rivals.com ... rated fifth-best athlete among tight ends by Rivals.com ... three-star pros-pect and the 43rd-best tight end nationally by Scout.com ... rated No. 15 player on Detroit Free Press Best of the Midwest rankings ... listed as the 114th-best overall player nationally on the ESPN 150 rankings ... listed as the No. 17 player in the Mid-west by G&W Recruiting Report ... ranked as the No. 91 prospect in the country by Tom Lemming ... participated in the Under Armour All-American game.
Personal ... Brandon Moore was born March 29, 1990, in Dayton, Ohio ... from the same high school as wide receiver Roy Roundtree and running back Michael Shaw ... enrolled in the College of Literature, Science and the Arts, majoring in brain, behavior and cognitive science.
george morales#66 • Long Snapper6-0 • 236 • Sr.-Jr.North Las Vegas, Nev.Mojave HS
Senior/Junior (2011) ... did not see game action.
Junior/Sophomore (2010) ... did not see game action.
Sophomore/Freshman (2009) ... did not see game action.
Freshman (2008) ... redshirted ... did not see game action.
Prep ... attended Mojave High School (2008) ... National Honor Society treasurer ... four-time Academic Achievement Award recipient ... two-time National Hispanic Academic Achievement Award winner ... Honors and Rankings ... school’s Special Teams MVP as a senior ... first-team all-region and all-conference at center senior year ... honorable mention all-conference as a sophomore and junior ... Other Sports ... lettered in track and wrestling.
Personal ... George Morales was born July 20, 1990 ... en-rolled in the College of Literature, Science and the Arts, ma-joring in psychology and American culture.
desmoNd morgaN#44 • Linebacker6-1 • 220 • Fr.Holland, Mich.West Ottawa HS
Freshman (2011)... appeared in 11 games; played 11 games as an outside linebacker, started six times at linebacker (Notre Dame, Purdue, Iowa, Illinois, Ne-braska, Ohio State), played in 11 games on special teams ... OHIO STATE (Nov. 26) ... set career highs for tackles (10), assisted stops (7), TFLs (1.5) and notched first career sack ... led the team with first double-digit-tackle performance of career ... ILLINOIS (Nov. 12) ... led U-M linebackers with eight tackles, match-ing career high with four solo stops ... IOWA (Nov. 5) ... posted six tackles and first career PBU ... PURDUE (Oct. 29) ... led the team with a career-high nine tackles in second career start ... MICHIGAN STATE (Oct. 15) ... recorded four tackles ... tallied first career tackle-for-loss and fumble recovery ... NOTRE DAME (Sept. 10) ... made career debut as a starter vs. Notre Dame, assisted on one tackle.
Prep ... attended West Ottawa High School (2011) coached by Jim Caserta ... played quarterback and linebacker ... Key Statistics ... made 72 tackles and forced four fumbles despite missing time as a senior due to injury ... passed for 519 yards and five touch-downs and ran for 802 yards and 11 more touch-downs senior year ... recorded 120 tackles during his junior season ... Honors and Rankings ... three-star prospect and the No. 25 overall player in the state of Michigan by Rivals.com ... three-star and the nation’s No. 42 inside linebacker according to Scout.com... listed as a three-star recruit and the nation’s No. 24 inside linebacker by ESPN.com ... earned AP all-state honorable mention at linebacker senior season ... rated as the No. 17 player on The Detroit News Blue Chip list ... named to Grand Rapids Press All-Area team as a senior ... selected The Holland Sentinel 2010 Defensive Player of the Year and earned all-area honors as a senior.
Personal ... Desmond Morgan was born September 9, 1992
... enrolled in the College of Literature, Science and the Arts, major undeclared.
Desmond Morgan’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2011 11/6 20-33-53 2-3 1-1 0-0 1-0 1Career 11/6 20-33-53 2-3 1-1 0-0 1-0 1
Desmond Morgan’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan - - - - - -Notre Dame 0-1-1 0-0 0-0 0-0 0-0 0Eastern Michigan 0-1-1 0-0 0-0 0-0 0-0 0San Diego State 1-1-2 0-0 0-0 0-0 0-0 0Minnesota 1-1-2 0-0 0-0 0-0 0-0 0at Northwestern 3-2-5 0-0 0-0 0-0 0-0 0At Michigan State 1-3-4 0.5-0 0-0 0-0 1-0 0Purdue 4-5-9 0-0 0-0 0-0 0-0 0at Iowa 2-4-6 0-0 0-0 0-0 0-0 1at Illinois 4-4-8 0-0 0-0 0-0 0-0 0Nebraska 1-4-5 0-0 0-0 0-0 0-0 0Ohio State 3-7-10 1.5-3 1-1 0-0 0-0 0Season Totals 20-33-53 2-3 1-1 0-0 1-0 1
Morgan’s Career Bests:Tackles: 10, vs. Ohio State (Nov. 26, 2011)Solos: 4, twice (last at Illinois, Nov. 12, 2011)Asst: 7, vs. Ohio State (Nov. 26, 2011)TFLs: 1.5, vs. Ohio State (Nov. 26, 2011)Sacks: 1, vs. Ohio State (Nov. 26, 2011)Int.: NoneFR: 1, At Michigan State (Oct. 15, 2011)PBUs: 1, at Iowa (Nov. 5, 2011)
martavious odoms ***#9 • Wide Receiver5-8 • 173 • Sr.Pahokee, Fla.Pahokee HS
At Michigan ... three-year letterman ... started 25 of 38 career games played ... caught 94 passes for 1,087 yards (28th all-time at U-M for receiving yards) and five touch-downs ... surpassed 1,000 career receiving yards against Illinois (Nov. 12, 2011) ... returned 17 punts for 194 yards and one TD ... had 51 kickoff returns for 1,123 yards.
Senior (2011) ... appeared in 11 games; 11 games as a wide receiver, making three starts (Illinois, Nebraska, Ohio State); nine on special teams, starting eight at kick returner ... OHIO STATE (Nov. 26) ... started third consecutive con-test, catching two passes for 25 yards and a touchdown ... scored on a 20-yard touchdown reception in the third quarter for final go-ahead score ... NEBRASKA (Nov. 19) ... started second straight game, hauling in two passes for team-best 47 yards and a touchdown ... scored on a 38-yard post route in the third quarter ... ILLINOIS (Nov. 12) ... hauled in two passes for 46 yards and a touchdown in first start of season ... scored on a 27-yard pass from Devin Gardner in the fourth quarter ... eclipsed 1,000 career receiving yards against the Fighting Illini.
Junior (2010) ... earned third varsity letter ... started three games and played in seven contests at wide receiver ... needs 44 receiving yards to eclipse 1,000 in his career ... recorded 16 receptions for 241 yards and a touchdown ... posted eight kick returns for 181 yards and one punt return for 14 yards ... caught two passes for 23 yards and had an 18-yard kick return vs. Connecticut (Sept. 4) ... made seven receptions for 91 yards in start at Notre Dame (Sept. 11) ... caught one pass for 16 yards in start vs. Massachusetts (Sept. 18) ... two receptions for 16 yards in start vs. Bowling Green (Sept. 25) ... two receptions for 19 yards in Big Ten
opener at Indiana (Oct. 2) ... hauled in a 49-yard pass as a backup wideout vs. Michigan State (Oct. 9) ... one punt return for 14 yards as starting punt and kick returner against the Spartans ... suffered foot injury against MSU that sidelined him for the rest of the regular season ... returned to action as a reserve slot receiver vs. Mississippi State (Jan. 1) in the Gator Bowl, taking his only catch for 27 yards and a touchdown ... starting kick return specialist against the Bulldogs, matching his career high with seven returns for 163 yards including a long of 41 yards.
Sophomore (2009) ... earned second varsity letter ... start-ed first eight games of the season at slot receiver and played in nine contests ... missed the Illinois (Oct. 31), Purdue (Nov. 7) and Wisconsin (Nov. 21) games due to injury ... team’s third-leading receiver with 22 receptions for 272 yards and one touchdown ... had 13-yard reverse for a touchdown ... returned six punts for 54 yards ... made a six-yard reception and had a 21-yard kickoff return vs. Western Michigan (Sept. 5) ... caught three passes for 18 yards and returned six kickoffs for 108 yards vs. Notre Dame (Sept. 12) ... his six kickoff returns against the Irish rank tied for the third-most in a game by a Wolverine ... caught two passes for 33 yards and scored his first-career offensive touchdown on 13-yard rush vs. Eastern Michigan (Sept. 19), the score came on second-and-goal midway through the third quarter against the Eagles ... team-leading three receptions for 40 yards and scored his first career receiving touchdown vs. Indiana (Sept. 26) ... scored on 26-yard post route on third down with just over two minutes remaining in the contest for the game-winning touchdown against the Hoosiers ... caught five passes for 40 yards At Michigan State (Oct. 3) ... grabbed four passes for 76 yards at Iowa (Oct. 10) ... had a 35-yard season-long reception at Iowa ... had a 25-yard reception and four punt returns for 48 yards vs. Delaware State (Oct. 17) ... three receptions for 34 yards in start vs. Penn State (Oct. 24) ... injured against the Nittany Lions and missed the next three games before returning to the lineup in the season finale ... returned two punts for six yards and played slot receiver vs. Ohio State (Nov. 21).
Freshman (2008) ... earned first varsity letter ... started 11 games at slot receiver ... led team in receptions (49) and receiving yards (443) ... holds U-M program record for receptions as a freshman ... led all Big Ten freshmen in receptions (49) and all-purpose yards (1,040) ... caught at least one pass in all 11 games played ... returned 20 kickoffs for 461 yards (23.1 avg.) and 10 punts for 126 yards (12.6 avg) ... had a 73-yard punt return for a touchdown at Purdue (Nov. 1) ... second in the Big Ten in punt return average during conference play ... made collegiate debut and earned starting nod at slot receiver vs. Utah (Aug. 30) ... led team with five receptions for seven yards against the Utes ... caught a team-high three passes for 57 yards vs. Miami (Sept. 6) ... recorded the season’s longest play, a 50-yard catch and run, on the first offensive play against the RedHawks ... led team with 56 yards on six receptions at Notre Dame (Sept. 13) ... caught two passes for four yards, added a three-yard run and returned three kicks for 61 yards vs. Wisconsin (Sept. 27) ... totaled a conference-leading 315 all-purpose yards vs. Illinois (Oct. 4), tied for the sixth-best mark in school history ... recorded first career 100-yard receiving game against the Illini ... grabbed career-best seven passes for 129 yards, more than doubling his incoming total career output ... returned seven kicks for 183 yards, including career-best 36-yard run back ... his 183 kick return yards were the third most in a single game for a Wolverine all-time ... 10 of his 15 plays were for better than 20 yards ... dressed but did not see action vs. Toledo (Oct. 11) due to injury ... grabbed three passes for 34 yards at Penn State (Oct. 18) ... returned two kicks for 36 yards against the Nittany Lions ... caught team-best six passes for 42 yards vs. Michigan State (Oct. 25) ... returned one punt for six yards against the Spartans ... gained 168 all-purpose yards at Purdue (Nov. 1) ... snagged team-high four passes
for 26 yards against the Boilermakers and returned three punts for 82 yards and first career touchdown, scored on 73-yard punt return in the first quarter, returned three kick-offs for 60 yards, inlcuding a 45-yarder career long against the Boilermakers ... tied a career-best with seven receptions for 43 yards at Minnesota (Nov. 8) ... returned three punts for 20 yards against the Gophers ... returned three kickoffs for 78 yards and two punts for 15 yards vs. Northwestern (Nov. 15), grabbed one pass for eight yards ... caught a team-high five passes for 37 yards at Ohio State (Nov. 22), returned two kickoffs for 43 yards and one punt for three yards against the Buckeyes.
Prep ... attended Pahokee High School (2008) coached by Blaze Thompson ... team compiled 49-3 four-year record during his career ... helped team to Class 2B state title in three of his four seasons ... finished as state runner-up as a sophomore in 2005 ... Key Statistics ... tallied 191 career receptions for 3,617 yards and 53 touchdowns ... made 41 catches for 936 yards and 10 touchdowns senior year ... caught 42 passes for 923 yards and scored 17 receiving touchdowns as a junior ... made 69 catches for 1,150 yards and tallied 18 TDs sophomore year ... his 188 receiving yards in the Class 2B championship set a state record as a sophomore ... grabbed 39 passes for 608 yards and scored eight touchdowns as a freshman ... Honors and Rankings ... four-star prospect and No. 49 wide receiver nationally according to Scout.com ... three-star prospect and the nation’s No. 71 wide receiver according to Rivals.com ... rated the No. 77 recruit in the state of Florida by Rivals.com ... named the No. 56 wide receiver in the nation by ESPN.com ... two-time South Florida Sun-Sentinel Super 11 player ... named Palm Beach Post small schools Offensive Player of the Year as a junior ... Class 2B first-team all-state junior and senior years ... Class 2B second-team all-state as a sophomore ... named South team MVP in the 2007 Florida Athletic Coaches Association State North-South All-Star Game in Florida.
Personal ... Martavious Rashhud Odoms was born January 21, 1989 ... high school teammates with current Wolverines Vincent Smith, Brandin Hawthorne and Richard Ash ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Martavious Odoms’ Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2008 11/11 49 443 9.0 40.3 0 502009 9/8 22 272 12.4 30.2 1 352010 7/3 16 241 15.1 34.4 1 492011 11/3 7 131 18.7 11.9 3 38Career 38/25 94 1087 11.6 28.6 5 50
Martavious Odoms’ Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan - - - - -Notre Dame 0 0 0.0 0 0Eastern Michigan 0 0 0.0 0 0San Diego State 0 0 0.0 0 0Minnesota 0 0 0.0 0 0at Northwestern 0 0 0.0 0 0At Michigan State 0 0 0.0 0 0Purdue 0 0 0.0 0 0at Iowa 1 13 13.0 0 13at Illinois 2 46 23.0 1 27Nebraska 2 47 23.5 1 38Ohio State 2 25 12.5 1 20Season Totals 7 131 18.7 3 38
Martavious Odoms’ Career Punt Return StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2008 5/5 10 126 12.6 25.2 1 732009 2/1 6 54 9.0 27.0 0 262010 1/1 1 14 14.0 14.0 0 14Career 8/7 17 194 11.4 24.3 1 73
Martavious Odoms’ Career Kick Return StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2008 6/4 20 461 23.1 77.2 0 452009 3/0 7 129 18.4 43.0 0 252010 6/5 8 181 22.1 30.2 0 412011 8/8 16 352 22.0 44.0 0 33Career 23/17 51 1123 22.0 48.8 0 45
Odoms’ Career BestsReceivingReceptions: 7, twice (last at Notre Dame, Sept. 11, 2010)Yards: 129 vs. Illinois (Oct. 4, 2008)Touchdowns: 1, five times (last vs. Ohio State, Nov. 26, 2011)Long: 50 vs. Miami (Ohio) (Sept. 6, 2008)
RushingAttempts: 1, nine times (last vs. Nebraska, Nov. 19, 2011)Yards: 13 vs. Eastern Michigan (Oct. 19, 2009)Touchdowns: 1 vs. Eastern Michigan (Oct. 19, 2009)Long: 13 vs. Eastern Michigan (Oct. 19, 2009)
Kick ReturnsAttempts: 7, twice (last vs. Mississippi State, Jan. 1, 2011)Yards: 183, vs. Illinois (Oct. 4, 2008)Touchdowns: NoneLong: 45, at Purdue (Nov. 1, 2008)
Punt ReturnsAttempts: 4, vs. Delaware State (Oct. 17, 2009)Yards: 82, at Purdue (Nov. 1, 2008)Touchdowns: 1, at Purdue (Nov. 1, 2008)Long: 73, at Purdue (Nov. 1, 2008)
patrick omameh ** #65 • Offensive Lineman6-4 • 299 • Sr.-Jr.Columbus, OhioSt. Francis DeSales HS
At Michigan ... two-year varsity letterman ... two-time Academic All-Big Ten ... returning starter at right guard ... appeared in 32 games and started 28 consecutive contests at right guard.
Senior/Junior (2011)... Academic All-Big Ten ... Phil Steele’s Midseason All-Big Ten second team selection ... played in all 12 games; started each game at right guard.
Junior/Sophomore (2010) ... earned second varsity letter ... Academic All-Big Ten ... started in all 13 contests at right guard ... made start at right guard against Connecticut (Sept. 4) and Notre Dame (Sept. 11) ... opened the game at right guard vs. Massachusetts (Sept. 18) and Bowling Green (Sept. 25) ... started at right guard in Big Ten opener at Indiana (Oct. 2) ... made start at right guard vs. Michigan State (Oct. 9), Iowa (Oct. 16) and at Penn State (Oct. 30) ... opened the game at right guard vs. Illinois (Nov. 6), at Purdue (Nov. 13) and vs. Wisconsin (Nov. 20) ... started at right guard against Ohio State (Nov. 27) ... made start at right guard vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore/Freshman (2009) ... earned first varsity let-ter ... played in seven contests and started the final three games of the season at right guard ... made career debut at right tackle vs. Western Michigan (Sept. 5) ... played left tackle vs. Eastern Michigan (Sept. 19) ... saw game action at right tackle vs. Delaware State (Oct. 17) ... appeared at right tackle against Illinois (Oct. 31) ... made first collegiate start at right guard vs. Purdue (Nov. 7) ... started first career road game at Wisconsin (Nov. 14) ... earned starting nod at right guard against Ohio State (Nov. 21).
Freshman (2008) ... did not see game action.
Prep ... attended St. Francis De Sales High School (2008) coached by Ryan Wiggins ... thee-year letterman ... carried 4.0 grade point average ... ran 40-yard dash in 4.85 seconds ... bench pressed 285 pounds and squatted 425 pounds ... Key Statistics ... key part of offensive unit that average 283 rushing yards per game ... Honors and Rankings ... three-star prospect and No. 87 offensive tackle recruit according to Scout.com ... two-star prospect by Rivals.com ... rated the 113th-best offensive lineman recruit by Scouts, Inc. ... Division II first-team all-state as a senior ... Associated Press All-Central District first team senior year ... named to The Columbus Dispatch All-Metro team as a senior ... all-district first team senior year and honorable mention junior year ... Other Sports ... earned three varsity letters in track and field and one in basketball ... received Captains Award and Scholar-Athlete Award in basketball as a senior ... regional finalist senior year and district finalist twice in track and field.
Personal ... Patrick Chuba Omameh was born December 29, 1989 ... enrolled in the College of Literature, Science and the Arts, majoring in communication and sociology.
JordaN paskorz#94 • Linebacker6-3 • 246 • So.-Fr.Gibsonia, Pa.Hampton HS
Sophomore/Freshman (2011) ... did not see game action.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Hampton High School (2010) coached by Jacque DeMatteo ... four-year honor roll student ... ran 40-yard dash in 4.7 seconds ... four-year varsity starter on offense and defense ... played defensive end and tight end ... Key Statistics ... recorded 85 tackles and 13 sacks as a senior ... caught five passes for 136 yards and scored two touchdowns senior year ... made 32 tackles and nine sacks junior year ... caught seven passes for 62 yards as a junior ... registered 12 sacks as a sophomore ... Honors and Rankings ... three-star recruit and the No. 23 player in state of Pennsylvania by Rivals.com ... listed as No. 41 weakside defensive end nationally by Rivals.com ... three-star and the nation’s No. 50 defensive end according to Scouts, Inc. ... three-star and the No. 74 defensive end nationally by scout.com ... first-team all-state as a senior ... honorable mention all-state at defensive end sophomore year ... named to Pittsburgh Post Gazette Fabulous 22 senior year ... named to Valley News Dispatch all-star team at tight end as a junior and senior ... second-team all-conference at defensive end as a sophomore ... Other Sports ... played baseball, basketball and ran track ... three-year letterman in track and basketball ... voted team track MVP as junior ... finished second at state championships in Class AAA shot put senior year ... won WPIAL PIAA District VII Championship in shot put with a Personal best 54’11” ... placed fifth in WPIAL AAA finals in shot put as junior.
Personal ... Jordan Keith Paskorz was born July 18, 1991 ... brother, Stephen, played fullback at Notre Dame ... enrolled in the College of Literature, Science and the Arts, major undeclared.
kris pauloski
#93 • Placekicker6-3 • 204 • Jr.-So.Indianapolis, Ind.Pike HS
Junior/Sophomore (2011) ... did not see game action.
Sophomore/Freshman (2010) ... did not see game action.
Freshman (2009) ... U-M Athletic Academic Achievement ... redshirted ... did not see game action.
Prep ... attended Pike High School (2009) coached by Derek Moyers ... academic all-state as a senior ... four-year honor roll student ... two-year letterman as a kicker and punter ... helped team to conference, sectional and regional championships as a junior ... team finished as state runner-up junior year ... Key Statistics ... converted six-of-eight field goals and 40-of-41 extra points as a senior ... 40-of-52 kickoffs were downed for a touchback senior year ... Honors and Rankings ... named to Associated Press and Indiana Coaches Association 5A All-State team as a senior ... Indianapolis Star Super Team senior year ... all-conference, all-county and all-region as a senior ... voted school’s Special Team Player of the Year ... Other Sports ... lettered in soccer as a junior ... team claimed sectional title junior year.
Personal ... Kristopher Austin Pauloski was born May 14, 1991 ... father, Jeff, completed in Little 500 at Indiana University and placed third in 1982 ... uncle, Ervin Kunesh, played for the University of Wisconsin football team and participated in the 1960 Rose Bowl ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
tom pomarico **#91 • Long Snapper6-4 • 240 • 5th-Sr.Jackson, Mich.Lumen Christi HS
At Michigan ... two-year varsity letterman ... returning starter as long snapper ... started 37 games ... has four special teams tackles.
Fifth-Year Senior (2011)... appeared in all 12 games; started all 12 contests at long snapper.
Senior/Junior (2010) ... earned second varsity letter ... started all 13 contests ... made start at long snapper vs. Connecticut (Sept. 4) and Notre Dame (Sept. 11) ... made his third consecutive start at long snapper vs. Massachusetts (Sept. 18) ... opened the game at long snapper vs. Bowling Green (Sept. 25) ... started at long snapper in Big Ten opener at Indiana (Oct. 2) ... served as starting long snapper vs. Michigan State (Oct. 9) ... assisted on a tackle as starting long snapper vs. Iowa (Oct. 16) ... recorded one solo tackle as a starting long snapper at Penn State (Oct. 30) ... started at long snapper vs. Illinois (Nov. 6), at Purdue (Nov. 13) and vs. Wisconsin (Nov. 20) ... served as the starting long snap-per at Ohio State (Nov. 27) ... made start at long snapper vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... U-M Athletic Academic Achievement award ... earned first varsity letter ... started all 12 games as long snapper ... registered one tackle on punt coverage ... made career debut at long snapper vs. Western Michigan (Sept. 5) ... contributed as long snapper vs. Notre Dame (Sept. 12), Eastern Michigan (Sept. 19) and Indiana (Sept. 26) ... made first career road start At Michigan State (Oct. 3) ... served as the long snapper specialist against Iowa (Oct. 10), Delaware State (Oct. 17), Penn State (Oct. 24), Illinois (Oct. 31), Purdue (Nov. 7), Wisconsin (Nov. 14) and Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... did not see game action.
Freshman (2007) ... did not see game action.
Prep ... attended Lumen Christi High School (2007) ... three year letterman ... Honors and Rankings ... named all-state honorable mention as a junior and senior (2006-07) ... earned all-area honors junior and senior years (2006-07) ... named to Big 16 All-Conference squad final three seasons (2005-07).
Personal ... Thomas John Pomarico was born May 24, 1988 ... enrolled in the College of Literature, Science and Arts, majoring in classical civilization with a minor in global media studies.
Tom Pomarico’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2008 0/0 0-0-0 0-0 0-0 0-0 0-0 02009 12/0 1-0-1 0-0 0-0 0-0 0-0 02010 13/0 1-1-2 0-0 0-0 0-0 0-0 02011 12/0 0-1-1 0-0 0-0 0-0 0-0 0Career 37/0 2-2-4 0-0 0-0 0-0 0-0 0
aNtoNio poole#40 • Linebacker6-2 • 212 • Fr.Cincinnati, OhioWinton Woods HS
Freshman (2011) ... did not see game action.
Prep ... attended Winton Woods High School (2011) coached by Andre Parker... three-year starter at defense ... helped the team to the Division II state title as a junior ... Key Statistics ... had 80 tackles, 23 tackles for loss and five sacks as a senior ... Honors and Rankings ... four-star and the nation’s No. 17 outside linebacker according to Scout.com ... rated as a three-star prospect by Rivals.com ... listed as the No. 26 outside linebacker and No. 20 player in the state of Ohio according to Rivals.com ... three-star prospect and the No. 41 outside linebacker nation-ally according to ESPN.com ... earned AP first-team Division II All-State honors as a senior ... Cincinnati Enquirer Divisions II-VI all-area selection as a senior ... first-team all-Fort Ancient Valley Conference Buck-eye division senior year.
Personal ... Antonio Poole was born October 29, 1992 ... enrolled in the School of Kinesiology, major undeclared.
Jihad rasheed#18 • Running Back5-10 • 172 • So.-Fr.Detroit, Mich.Southeastern HS
Sophomore/Freshman (2011) ... did not see game action.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Southeastern High School ... Class Valedictorian senior year ... named all-state at defensive back as a senior, and three-time all-city at running back.
Personal ... enrolled in the School of Kinesiology, major undeclared.
thomas raWls#38 • Running Back5-10 • 219 • Fr.Flint, Mich.Flint Northern HS
Freshman (2011) ...appeared in nine games; played in four games as a reserve running back and seven games on special teams ... MINNESOTA (Oct. 1) ... earned 10 carries for a career-high 73 yards ... EAST-ERN MICHIGAN (Sept. 17) ... made collegiate debut as a reserve running back, rushing twice for four yards.
Prep ... attended Flint Northern High School (2011) coached by Fred Jackson Jr. ... Key Statistics ... car-ried the ball 150 times for 1,585 yards and scored 19 touchdowns as a senior ... rushed for a school record 396 yards against Bay City Central in Sep-tember 2010 ... gained 1,056 yards on 138 carries and scored 16 TDs as a junior ... recorded 101 tackles junior year ... Honors and Rankings ... three-star and the No. 19 overall player in the state of Michigan by Rivals.com ... three-star and the nation’s 77th-rated running back according to Scout.com ... received a three-star rating and is listed as the No. 84 running back nationally by ESPN.com ... named MVP of the Saginaw Valley Association ... rated as the No. 39 player on The Detroit News Blue Chip list ... listed as the 15th-best player in Michigan according to the Detroit Free Press ... earned all-state honorable men-tion, all-conference and all-city as a sophomore, ju-nior and senior.
Personal ... Thomas Rawls was born August 3, 1993 ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Thomas Rawls’ Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2011 9/0 13 79 6.1 15.8 0 25Career 9/0 13 79 6.1 15.8 0 25
Thomas Rawls’ Game-by-Game Rushing Statistics2011 Opponent Att. Yards Avg. TD LongWestern Michigan - - - - - Notre Dame - - - - - Eastern Michigan 2 4 2.0 0 3 San Diego State - - - - - Minnesota 10 73 7.3 0 25 at Northwestern 0 0 0.0 0 0 At Michigan State 0 0 0.0 0 0Purdue 1 2 2.0 0 2at Iowa 0 0 0.0 0 0at Illinois 0 0 0.0 0 0Nebraska 0 0 0.0 0 0Ohio State 0 0 0.0 0 0Season Total 13 79 6.1 0 25
Joe reyNolds *#85 • Wide Receiver6-1 • 191 • Jr.-So.Rochester, Mich.Rochester Adams HS
Junior/Sophomore (2011) ... played in two games; appeared in one game as a reserve wide receiver and con-tributed in two games on special teams.
Sophomore/Freshman (2010) ... earned first varsity letter ... Academic All-Big Ten ... made collegiate debut on special teams vs. Bowling Green (Sept. 25), recorded one solo tackle.
Freshman (2009) ... U-M Athletic Academic Achievement award ... redshirted ... did not see game action.
Prep ... attended Rochester Adams High School (2009) coached by Tony Patritto ... two-year varsity perform-er ... Key Statistics ... made 33 receptions for 700 yards and scored nine touchdowns as a senior ... Honors and Rankings ... All-Oakland Athletic Association selection as a senior ... Other Sports ... three-year varsity track performer ... state champion in 800-meter run as a junior ... three-time all-state selection in track.
Personal ... Joseph Bradley Reynolds was born July 18, 1991 ... enrolled in the College of Literature, Science and the Arts, majoring in Spanish.
deNard roBiNsoN **#16 • Quarterback6-0 • 195 • Jr.Deerfield Beach, Fla.Deerfield Beach HS
At Michigan ... two-year varsity letterman ... appeared in 37 career games; made 26 starts, 25 at quarterback and one at running back ... NCAA ... currently holds the NCAA season record for rushing yards by a quarterback (1,702), surpassing Air Forces’s Beau Morgan’s 1,494 against Wisconsin (Nov. 20, 2010) ... currently ranks 13th in career rushing yards by a quarterback (3,216) ... became the first player in NCAA history to pass for 2,500 yards and rush for 1,500 yards in a single season in 2010 ... fourth player in NCAA history to gain 2,000 yards passing and 1,000 rush-ing in a season twice in his career, joining Missouri’s Brad Smith, UAB’s Joe Webb and Nevada’s Colin Kaepernick ... became the eighth player in NCAA history to score 200 points and pass for 200 points in his career ... Big Ten Rushing ... second in career rushing yards by a quarterback (3,216), trailing Indiana’s Antwaan Randle El (3,895) ... U-M Rushing ... ranks eighth in career yardage (3,216) ... ranks fifth in career touchdowns (35) ... ranks seventh in career 100-yard games (14) ... surpassed 3,000 career rushing yards against Nebraska (Nov. 19, 2011) ... eclipsed 2,000 career rushing yards against Mississippi State in the Gator Bowl (Jan. 1, 2011) ... surpassed 1,000 career rushing yards against Bowling Green (Sept. 25, 2010) in the first quarter ... 11 career multi-touchdown games ... U-M Passing ... ranks eighth in career yardage (4,814) ... ranks sixth in career touchdown passes (38) ... ranks eighth in career comple-tions (329) ... ranks ninth in career passing attempts (559) ... 13 multi-touchdown games ... U-M Total Offense ... ranks third in career total offense (8,030) ... owns the top six and eight of the top nine single-game offensive outputs; record is 502 yards (244 passing, 258 rushing) at Notre Dame, 9/11/10) ... has 14 career games with three-plus total touch-downs (5 - 3 times, 4 - 4 times, 3 - 7 times).
Junior (2011) ... All-Big Ten second team (media) and honorable mention (coaches) ... Phil Steele’s Midseason All-Big Ten third team selection ... surpassed 1,000 rush-ing yards for the season, joining running back Fitzgerald Toussaint as the first U-M tandem to eclipse 1,000 rushing yards each since 1975 ... 1,163 rushing yards rank 20th for a single season at U-M ... 16 rushing TDs are fifth-best in a season at U-M ... 18 passing TDs are tied for 10th in a single-season at U-M ... semifinalist for Davey O’Brien National Quarterback Award ... named to Manning Award, Maxwell Award, Paul Hornung Award and Walter Camp Player of the Year preseason watch lists ... started at quarterback in all 12 games; has also played at running back and wide receiver ... OHIO STATE (Nov. 26) ... posted 337 total yards (170-rush-ing, 167-passing) and five total touchdowns for the third time in his career ... carried the ball 26 times for 170 yards and two touchdowns ... completed 14-of-17 passes for
167 yards with three touchdowns and no interceptions ... became first Michigan player in modern era to post at least two rushing and two passing touchdowns in back-to-back games ... named the Big Ten Co-Offensive Player of the Week ... NEBRASKA (Nov. 19) ... recorded 263 total yards (180 passing, 83 rushing) and four total touchdowns ... completed 11-of-18 passes and threw two touchdown passes ... scored rushing touchdowns on 14- and one-yard runs in the second and third quarter, respectively ...named the Big Ten Co-Offensive Player of the Week and the Rivals.com Big Ten Player of the Week ... ILLINOIS (Nov. 12) ... served as honorary game captain ... completed 6-of-10 passes for 92 yards and rushed for 30 yards with two touchdowns ... scored U-M’s first two touchdowns from nine and two yards out ... ninth career time rushing for two-plus touchdowns ... IOWA (Nov. 5) ... registered 249 total yards of offense (194 passing, 55 rushing) and two passing touchdowns ... PURDUE (Oct. 29) ... totaled 233 yards of total offense (170 passing, 63 rushing) ... recorded a two-yard rushing touchdown on U-M’s opening drive ... MICHIGAN STATE (Oct. 15) ... accumulated 165 yards total yards of offense (123 passing, 42 rushing) and two total touchdowns ... completed 9-of-24 passes for 123 yards with a 34-yard touchdown in the fourth quarter ... ran 18 times for 42 yards and scored on a 15-yard scamper on the open-ing drive ... NORTHWESTERN (Oct. 8) ... racked up 454 yards of total offense (337 passing, 117 rushing) for the third-best yardage mark in U-M history ... scored four touchdowns (2 passing, 2 rushing) for fifth straight game with three-plus touchdowns; fifth straight game with a rushing TD ... threw for 337 yards (17-for-26) for the second-best passing yard-age game of his career ... ran for 117 yards on 25 carries for the 13th 100-yard game of his career ... MINNESOTA (Oct. 1) ... Threw for two touchdowns and ran for one score ... Set a career best for consecutive completions to start a game (11) and finished 15-for-19 for 169 yards ... SAN DIEGO STATE (Sept. 24) ... Co-Big Ten Offensive Player of the Week and Rivals.com Big Ten Player of the Week ... Ran for 200 yards on 21 carries - his third-best single-game rush-ing effort - to become the third Wolverine to accrue three 200-yard rushing days ... three rushing touchdowns tied career high for second time ... EASTERN MICHIGAN (Sept. 17) ... Passed for a pair of touchdowns and rushed for one TD ... ran 26 times for 198 yards, his fourth-best career rush-ing display ... NOTRE DAME (Sept. 10) ... Big Ten Offensive Player of the Week, Davey O’Brien Quarterback of the Week, Capital One Cup Impact Performance of the Week and Rivals.com National and Big Ten Player of the Week ... accumulated 446 yards of total offense (337 passing, 117 rushing) for the fourth-best yardage mark in U-M history ... threw for career-high four touchdowns; also ran for a touchdown to tie career high for total TDs (5) for the second time ... passed for career-high 338 yards on 11-for-24; last completion was a 16-yard touchdown to Roy Roundtree to win the game with two seconds left ... ran 16 times for 108 yards and one touchdown.
Sophomore (2010) ... earned second varsity letter ... sixth in Heisman Trophy balloting ... Football Writers Association of America All-American at running back ... winner of the Chicago Tribune Silver Football as the Big Ten MVP ... U-M’s Bo Schembechler Team MVP ... Big Ten Offensive Player of the Year (coaches and media) ... All-Big Ten first team (media) and All-Big Ten honorable mention (coaches) ... Manning Award finalist ... Davey O’ Brien and Maxwell Awards semifinalist ... Walter Camp Player of the Year player to watch ... Paul Hornung Award watch list ... Phil Steele’s Midseason All-America third team ... Phil Steele’s Midseason All-Big Ten first team ... Walter Camp Football Foundation National Player of the Week (Connecticut, Notre Dame) ... AT&T All-American Player of the Week (Connecticut, Notre Dame) ... Big Ten Offensive Player of the Week (Connecticut, Notre Dame, Indiana) ... Davey O’Brien National Quarterback of the Week (Notre Dame, Indiana) ... Rivals.com Big Ten and National Player of the Week (Notre
Dame) ... Rivals.com Big Ten Player of the Week (Indiana) ... College Football Performance Award National Performer of the Week (Notre Dame, Indiana) ... started all 13 games at quarterback ... shattered Michigan records for touches (547) and total offense (4,272) in a single season ... second nationally and first in the Big Ten in total offense at 328.6 yards per contest ... completed 182-of-291 passes (62.5 pct.) for 2,570 yards with 18 touchdowns and 11 inter-ceptions ... 20th nationally in passer efficiency (149.58) ... recorded 256 carries for 1,702 yards and 14 touchdowns ... nation’s fourth-leading rusher (130.9 avg.) ... posted fourth-best single season rushing mark in Michigan history ... made first career start at quarterback vs. Connecticut (Sept. 4), setting school records for total offense (383 yards) and rushing yards by a quarterback (197 yards) ... carried the ball 29 times for 197 yards and one touchdown and com-pleted 19-of-22 passes for 186 yards and one touchdown against UConn ... reset the Michigan total offensive record one week later with 502 yards at Notre Dame (accounted for 502 of Michigan’s 532 yards); surpassed his school record total of 383 yards set against UConn ... set the U-M record with 68 total offensive plays (28 rushing and 40 passing) vs. ND ... his 258 rushing yards against the Irish was the best road performance ever for a Wolverine rusher and the fifth-best single-game effort in school history ... set career-highs in every passing category, completing 24-of-40 passes for 244 yards and one touchdown against the Irish ... matched career-high with two rushing TDs (87 and 2 yards) vs. ND ... became ninth quarterback in NCAA history to rush and pass for 200 yards in a game; last player to accomplish the feat was West Virginia’s Pat White against Pittsburgh on Nov. 16, 2006 (220 rushing and 204 passing) ... broke his own U-M record from UConn game and the Big Ten record for rushing yards by a quarterback against ND; shattered the league record of 217 yards set by NU’s Mike Kafka (at Minnesota, Nov. 1, 2008) ... scored game-winning touchdown against the Irish on a two-yard run with 27 sec-onds remaining in regulation ... led 12-play, 72-yard scoring drive that ended with his two-yard touchdown run for the victory; accounted for all 72 yards with six carries for 17 yards and 5-of-6 passing for 55 yards ... vs. Massachusetts (Sept. 18), carried the ball 17 times for 104 yards and one touchdown and completed 10-of-14 passes for 241 yards ... completed four passes of 35 yards or more, including a career-long 66-yard touchdown pass to Darryl Stonum vs. UMass ... had thrown 64 completions prior to his first interception of the season vs. UMass ... recorded five carries for 129 yards and two touchdowns and went 4-for-4 for 60 yards in only nine minutes of action vs. Bowling Green (Sept. 25) ... scored on two- and 47-yard runs early in the first quarter against the Falcons ... became the only player in NCAA history to run and pass for at least 200 yards in at least two games during the same season after rushing for 217 yards on 19 carries and passing for a career-high 277 yards (10-of-16) against Indiana (Oct. 2), racking up 494 yards of total offense ... scored five touchdowns -- a career-best three passing and two rushing -- against the Hoosiers, including a game-winning, four-yard rushing score with 17 seconds remaining ... set new career-long with a 74-yard pass to Roy Roundtree in the first quarter ... completed 17-of-29 passes for 215 yards and had 21 carries for 86 yards in start vs. Michigan State (Oct. 9) ... scored two touchdowns -- a 12-yard pass and four-yard rush -- against the Spartans ... surpassed 100-yards rushing (105) for the sixth time in 2010 on 18 carries and went 13-of-18 pass-ing for 96 yards with one touchdown -- an eight-yard pass to Vincent Smith -- in just over a half of action in start vs. Iowa (Oct. 16) ... eclipsed 1,000-yards rushing in a single season on his second run -- an eight-yarder -- against the Hawkeyes ... gained 381 yards of total offense against Penn State (Oct. 30) ... surpassed 100-yards rushing (191) for the seventh time of season -- scoring three touchdowns on 27 carries -- and went 11-of-23 passing for 190 yards and one touchdown -- a 60-yard pass to Kevin Koger -- against the Nittany Lions ... set the Big Ten season record for rushing
yards by a quarterback (1,538) against Penn State, surpass-ing Indiana’s Antwaan Randle El’s 1,270 yards in 2000 ... eclipsed the 300-yard passing mark (305) for the first time in his career on 10-for-20 passing and threw three touch-down passes in start vs. Illinois (Nov. 6) ... all three of his touchdown passes were longer than 30 yards (75, 33, 45) with the 75-yarder being a new career-long ... 19 rushes for 62 yards against the Fighting Illini ... completed 13-of-21 passes for 176 yards and a touchdown, while adding 68 rush yards in start against Purdue (Nov. 13) ... hooked up with Roy Roundtree on a nine-yard touchdown pass in the first quarter for his only score ... accounted for 360 yards of total offense and four touchdowns in start vs. Wisconsin (Nov. 20) ... completed 16-of-25 passes for 239 yards with two touchdowns -- a 24-yarder to Darryl Stonum and a 28-yarder to Roy Roundtree ... posted 22 carries for 121 yards and two touchdowns from four and 11 yards out ... set the NCAA season record for most rushing yards by a quarterback (1,538) against the Badgers, eclipsing Air Force’s Beau Morgan’s 1,494 yards from 1996 ... became the first player in NCAA history to pass for 2,000 yards and rush for 1,500 yards against Wisconsin ... rushed 18 times for 105 yards and completed 8-of-18 passes for 87 yards in start at Ohio State (Nov. 27) ... surpassed the U-M single season record for most touches in start vs. Mississippi State (Jan. 1) in the Gator Bowl, surpassing John Navarre’s mark in 2003 ... set career-highs for completions (27) and pass attempts (41), while throwing for 254 yards, two touchdowns and an interception ... carried the ball 11 times for 59 yards against the Bulldogs.
Freshman (2009) ... earned first varsity letter ... played in all 12 games ... saw action at quarterback in 12 games and started one contest at running back ... rushed 69 times for 351 yards and scored five touchdowns ... second on the team with five TDs (all rushing) ... completed 14-of-31 pass-es for 188 yards with two touchdowns and four intercep-tions ... debuted at quarterback vs. Western Michigan (Sept. 5), throwing for 18 yards on two completions, also rushed for 74 yards and a touchdown ... scored 43-yard touchdown run on first career snap in the WMU game ... played quar-terback vs. Notre Dame (Sept. 12), rushing for 21 yards on four carries ... gained 60 yards on three attempts and scored two rushing touchdowns vs. Eastern Michigan (Sept. 19) ... both touchdowns (13 and 36 yards) came on quarterback draws in the second half against the Eagles ... went 2-for-3 passing for 39 yards and totaled 24 rushing yards on 11 car-ries vs. Indiana (Sept. 26) ... played quarterback At Michigan State (Oct. 3) ... completed 3-of-4 passes for 30 yards at Iowa (Oct. 10), also rushed nine times for 49 yards and one touchdown against the Hawkeyes, scoring on a three-yard run late in the fourth quarter ... completed 3-of-4 passes for 85 yards and two touchdowns vs. Delaware State (Oct. 17) ... tossed first career passing touchdown to Kelvin Grady (career-long 38 yards) and added a 28-yard scoring pass to Martell Webb against the Hornets ... had six carries for 54 yards and a four-yard TD run against DSU ... saw game action at quarterback vs. Penn State (Oct. 24), rushing for 20 yards on four carries ... appeared at quarterback against Illinois (Oct. 31), completing his only pass for seven yards ... lined up at wide receiver against the Illini ... played run-ning back vs. Purdue (Nov. 7), recording one carry ... started the Wisconsin (Nov. 14) game at running back and played quarterback, rushing five times for 36 yards and completed a six-yard pass ... carried the ball 10 times for 31 yards and completed 2-of-4 passes vs. Ohio State (Nov. 21).
Prep ... attended Deerfield Beach High School (2009) coached by Art Taylor ... ran 40-yard dash in 4.32 seconds ... registered a 315-pound max on bench press and a 400-pound squat max ... helped lead team to state semifinals as a junior and third round as a senior ... three-year varsity starter at quarterback ... Key Statistics ... completed 262-of-576 attempts for 4,784 yards and 44 touchdowns as a three-year starter at quarterback ... carried 217 times for
1,132 yards and 13 touchdowns in his career ... completed 100-of-231 passes for 1,872 yards and 18 touchdowns as a senior ... rushed 93 times for 538 yards and eight TDs senior year ... threw for 1,961 yards and rushed for 428 yards as a junior ... contributed 19 total touchdowns junior year ... Honors and Rankings ... Prep Star All-American and named to the publication’s Top 250 ... four-star prospect by Rivals.com and scout.com ... listed as the No. 188 overall player in the country and the No. 14 athlete according to Rivals.com ... rated as the No. 35 overall prospect in the state of Florida by Rivals.com ... ranked as the eight-best athlete in the country and the 102nd overall prospect by Scouts, Inc. ... listed as the No. 8 athlete in the country by ESPN.com ... rated as the ninth-best prospect in the state of Florida according to SuperPrep ... listed as the nation’s 16th-best cornerback prospect and the 159th overall player nation-ally according to scout.com ... listed No. 4 on the Broward County Top 25 rankings by the Orlando Sun Sentinel ... first-team All-Broward County by The Miami Herald as a junior and senior ... selected to Mobile Press Register’s Super Southeast 120 ... played in the Miami-Dade vs. Broward All-Star game ... third-team all-state as a junior ... Other Sports ... ran track ... finished third in the 100-meter dash at the 2008 Florida 4A Track & Field State Championships ... member of the 2008 FHSAA state champion 4x100-meter relay team.
Personal ... Denard Xavier Robinson was born September 22, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Denard Robinson’s Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2009 12/1 69 351 5.1 29.2 5 432010 13/13 256 1702 6.6 130.9 14 872011 12/12 208 1163 5.6 5.6 16 53Career 37/26 533 3216 6.0 86.9 35 87
Denard Robinson’s Game-by-Game Rushing Statistics2011 Opponent Att. Yards Avg. TD LongWestern Michigan 8 46 5.8 0 12 Notre Dame 16 108 6.8 1 39 Eastern Michigan 26 198 7.6 1 52 San Diego State 21 200 9.5 3 53 Minnesota 6 51 8.5 1 18 at Northwestern 25 117 4.7 2 25 At Michigan State 18 42 2.3 1 15Purdue 15 63 4.2 1 28at Iowa 12 55 4.6 0 22at Illinois 12 30 2.5 2 11Nebraska 23 83 3.6 2 16Ohio State 26 170 6.5 2 41Season Total 208 1163 5.6 16 53
Denard Robinson’s Career Passing StatisticsYear GP/GS Att. Comp. Pct. Yards TD Int. Long2009 12/0 31 14 45.2 188 2 4 382010 13/13 291 182 62.5 2570 18 11 752011 12/12 237 133 56.1 2056 18 14 77Career 37/26 559 329 58.9 4814 38 29 77
Denard Robinson’s Game-by-Game Passing Statistics2011 Opponent Att. Comp. Pct. Yards TD Int. LongWestern Michigan 13 9 69.2 98 0 0 37Notre Dame 24 11 45.8 338 4 3 77Eastern Michigan 18 7 38.9 95 2 1 24San Diego State 17 8 47.1 93 0 2 32Minnesota 19 15 79.0 169 2 0 28at Northwestern 26 17 65.4 337 2 3 57At Michigan State 24 9 37.5 123 1 1 34Purdue 14 9 64.3 170 0 1 49at Iowa 37 17 46.0 194 2 1 19at Illinois 10 6 60.0 92 0 1 40Nebraska 18 11 61.1 180 2 1 46Ohio State 17 14 82.3 167 3 0 28Season Totals 237 133 56.1 2056 18 14 77
Robinson’s Career Bests:PassingAttempts: 40, at Notre Dame (Sept. 11, 2010)Completions: 24, at Notre Dame (Sept. 11, 2010)Yards: 338, vs. Notre Dame (Sept. 10, 2011)TDs: 4, vs. Notre Dame (Sept. 10, 2011)Long: 77, vs. Notre Dame (Sept. 10, 2011)
RushingAttempts: 29, vs. Connecticut (Sept. 3, 2010)Yards: 258, at Notre Dame (Sept. 11, 2010)TDs: 3, twice (last vs. San Diego State, Sept. 24, 2011)Long: 87, at Notre Dame (Sept. 11, 2010)
Jerald roBiNsoN#83 • Wide Receiver6-1 • 206 • So.-Fr.Canton, OhioSouth HS
Sophomore/Freshman (2011) ... appeared in last 10 games; played two games as a reserve wide receiver and in 10 games on special teams.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended South High School (2009) coached by Moe Daniska ... three-year starter at wide receiver and free safety ... Key Statistics ... made 31 receptions for 488 yards and three touchdowns as a senior ... contributed 35 tackles and three interceptions senior year ... caught 35 passes for 804 yards and nine TDs junior year ... recorded recording 56 tackles, 11 pass break ups, seven interceptions, two forced fumbles and two fumble recoveries as a junior ... had over 600 receiving yards and four touchdowns as a sophomore ... Honors and Rankings ... Prep Star All-American ... four-star and the No. 40 wide receiver nationally by scout.com ... three-star recruit and the No. 13 player in the state of Ohio according to Rivals.com ... listed as the No. 48 wide receiver in the country by Rivals.com ... rated as the No. 51 player in the Midwest by SuperPrep ... rated No. 1 wide receiver in Ohio on OhioVarsity.com ... three-star and the nation’s No. 98 wide receiver according to Scouts, Inc. ... Division III first team all-state as a junior and senior ... all-Ohio as a junior.
Personal ... Jerald Robinson was born Jan. 2, 1992 ... enrolled in the School of Kinesiology, majoring in sport management.
marviN roBiNsoN *#3 • Safety6-2 • 200 • So.Winter Haven, Fla.Lake Region HS
Sophomore (2011) ... played in four games; three at safety, including one start (Notre Dame) and four on special teams ... NOTRE DAME (Sept. 10) ... started at free safety, set career highs for tackles (7) and solo stops (5).
Freshman (2010) ... earned first varsity letter ... appeared in 11 games ... played on special teams units vs. Connecticut (Sept. 4) and Notre Dame (Sept. 11) ... missed the Massachusetts (Sept. 18) game due to a shoulder injury ... recorded two solo tackles in first game action at safety and contributed on special teams vs. Bowling Green (Sept. 25) ... appeared on special teams units in Big Ten opener at Indiana (Oct. 2) ... made one solo tackle on special teams vs. Michigan State (Oct. 9) ... contributed on special teams units against Iowa (Oct. 16), Penn State (Oct. 30) and Illnois (Nov. 6) ... appeared on special teams against Purdue (Nov. 13) ... did not see game action vs. Wisconsin (Nov. 20) ... sub-
stituted in at free safety and on special teams at Ohio State (Nov. 27) ... contibuted on special teams vs. Mississippi State (Jan. 1) in the Gator Bowl.
Prep ... attended Lake Region High School (2010) coached by Stephen Reynolds ... ran 40-yard dash in 4.55 seconds and had a 38-inch vertical leap ... Key Statistics ... recorded 78 tackles and two interceptions in five games during injury shortened senior year ... caught nine passes for 120 yards and scored one touchdown as a senior ... posted 97 tackles, four interceptions and four blocked punts junior year ... gained 458 rushing yards and scored four touchdowns (two rushing, two receiving) as a junior ... registered 93 tackles and three interceptions as a sophomore ... rushed 72 times for 476 yards and scored three TDs sophomore year ... made 45 stops and two picks as a freshman ... Honors and Rankings ... four-star and the nation’s 18th-best safety by scout.com ... four-star prospect and the No. 38 player in the state of Florida according to Rivals.com ... listed as the No. 20 outside linebacker recruit by Rivals.com ... rated as the No. 41 player in Florida by SuperPrep ... four-star and the nation’s No. 21 outside linebacker according to Scouts, Inc. ... Prep Star All-American ... second-team FSWA 4A at defensive back as a junior and earned first-team senior year ... all-county, all-district and all-area as a sophomore and junior.
Personal ... Marvin Robinson was born Sept. 21, 1991 ... Enrolled in the School of Kinesiology, majoring in sport management.
Marvin Robinson’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 11/0 3-0-3 0-0 0-0 0-0 0-0 02011 5/1 6-3-9 0-0 0-0 0-0 0-0 0Career 16/1 9-3-12 0-0 0-0 0-0 0-0 0
Marvin Robinson’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 2-1-3 0-0 0-0 0-0 0-0 0Notre Dame 4-2-6 0-0 0-0 0-0 0-0 0Eastern Michigan 0-0-0 0-0 0-0 0-0 0-0 0San Diego State 0-0-0 0-0 0-0 0-0 0-0 0Minnesota 0-0-0 0-0 0-0 0-0 0-0 0at Northwestern - - - - - -At Michigan State - - - - - -Purdue - - - - - -at Iowa - - - - - -at Illinois - - - - - -Nebraska - - - - - -Ohio State - - - - - -Season Totals 6-3-9 0-0 0-0 0-0 0-0 0
terreNce roBiNsoN *#82 • Wide Receiver5-9 • 177 • Sr.-Jr.Klein, TexasOak HS
Senior/Junior (2011) ... appeared in 11 games; played in three games as reserve wide receiver and 11 on special teams ... NEBRASKA (Nov. 19) ... made one tackle and forced first career fumble on kickoff coverage in third quarter ... NOTRE DAME (Sept. 10) ... recovered first career fumble on kickoff coverage on the final play of the game.
Junior/Sophomore (2010) ... made three starts -- two at kick returner and one at slot receiver -- and appeared in nine con-tests ... caught a 43-yard career-long reception from Denard Robinson vs. Connecticut (Sept. 4) ... made first career start at slot receiver against Notre Dame (Sept. 11) ... saw playing time at slot receiver vs. Massachusetts (Sept. 18) and Bowling Green (Sept. 25) ... appeared as a reserve slot receiver in Big Ten opener at Indiana (Oct. 2) ... played as a backup slot
receiver vs. Michigan State (Oct. 9) ... did not see game action vs. Iowa (Oct. 16) ... returned one kickoff for 23 yards at Penn State (Oct. 30) ... started at kick returner and substituted in as a reserve slot receiver vs. Illinois (Nov. 6) ... made start as kick returner against Purdue (Nov. 13) ... did not see game action vs. Wisconsin (Nov. 20) and at Ohio State (Nov. 27) ... did not play vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore/Freshman (2009) ... earned first varsity letter ... played in two games ... made career debut at slot receiver vs. Eastern Michigan (Sept. 19) ... posted first career reception for 13 yards in the third quarter vs. Delaware State (Oct. 17) ... had an 11-yard punt return against the Hornets.
Freshman (2008) ... did not see game action.
Prep ... attended Klein Oak High School coached by David Smith ... led team to a 10-2 season his senior season ... Key Statistics ... gained 2,477 career rushing yards on 263 carries and scored 29 touchdowns ... accumulated 2,106 rushing yards on 222 carries and scored 25 touchdowns, primarily coming from the quarterback position as a senior ... also caught 15 passes for 277 yards and three touchdowns as a senior ... sat out as a junior due to state transfer rule ... rushed 40 times for 350 yards and scored three touchdowns as a sophomore ... also added 19 receptions for 300 yards and caught one TD sophomore year ... Honors and Rankings ... four-star prospect and the nation’s No. 9 all-purpose back according to Rivals.com ... rated as the 34th-best player in the state of Texas by Rivals.com ... four-star prospect and the 16th-best running back nationally according to Scout.com ... the No. 18 athlete nationally by ESPN.com ... selected to the all-state second team senior year ... named Greater Houston Area Player of the Year as a senior ... received 1960 Sun Player of the Year awards ... district offensive player of the year award senior year ... named all-district second team as a sophomore ... received district all-academic team honors ... Other Sports ... three-time varsity track letterman ... won a gold medal at the Jr. Olympics in the 4x100 meter relay.
Personal ... Terrence Rynard Robinson was born May 19, 1990 ... attended the 2007 Tulsa and Houston Summer Camps ... enrolled in the College of Literature, Science and the Arts, majoring in sociology.
chris rock#95 • Defensive End6-5 • 267 • Fr.Columbus, OhioSt. Francis DeSales HS
Freshman (2011) ... did not see game action.
Prep ... attended St. Francis de Sales High School (2011) coached by Ryan Wiggins ... ran 40-yard dash in 4.8 seconds ... Key Statistics ... amassed 15 sacks junior year ... recorded 64 tackles and 16 sacks as a sophomore ... Honors and Rankings ... listed as the No. 69 defensive end nationally according to Scout.com ... three-star prospect and the No. 34 defensive end nationally by ESPN.com ... listed as a three-star recruit, the nation’s No. 50 defensive end and the No. 38 player in the state of Ohio according to Rivals.com ... AP All-Central District first team selection as a senior.
Personal ... Christopher Rock was born July 5, 1992 ... from the same high school as senior/junior offensive guard Patrick Omameh ... enrolled in the College of Literature, Science and the Arts, major undeclared.
craig roh **#88 • Defensive End6-5 • 269 • Jr.Scottsdale, Ariz.Chaparral HS
At Michigan ...two-year varsity letterman ... 2011 Academic All-Big Ten ... returning starter at outside linebacker ... started 37 consecutive games -- 20 at outside linebacker and 17 at defensive end.
Junior (2011)... Academic All-Big Ten ... All-Big Ten honor-able mention (media) ... appeared in 12 games; started all 12 games at defensive end and contributed each game on special teams ... tied for second on the team in TFLs (8) and sacks (4) ... OHIO STATE (Nov. 26) ... did not record a tackle, but drew an offensive holding penalty in the end zone that resulted in a Michigan safety in the first quarter ... PURDUE (Oct. 29). ... posted four tackles and a half-sack ... MICHIGAN STATE (Oct. 15) ... tallied six tackles and matched career best with two tackles for loss ... NORTHWESTERN (Oct. 8) ... registered a half sack for three yards ... MINNESOTA (Oct. 1) ... tied season high with five tackles, including one TFL ... SAN DIEGO STATE (Sept. 24) ... notched two tackles-for-loss, including one sack for 14 yards and forced a fumble ... EASTERN MICHIGAN (Sept. 17) ... set season high with five tackles, including a sack for six yards.
Sophomore (2010) ... earned second varsity letter ... started all 13 games, eight at outside linebacker and five at defen-sive end ... tallied 43 tackles, 5.5 TFLs, 0.5 sacks, two forced fumbles and one PBU ... posted five tackles and a team-high two TFLs vs. Connecticut (Sept. 4) ... registered two tackles, one TFL and batted down one pass at Notre Dame (Sept. 11) ... recorded four tackles vs. Massachusetts (Sept. 18) ... tallied two tackles vs. Bowling Green (Sept. 25) ... registered five tackles at Indiana (Oct. 2) ... made three tackles and assisted on a sack vs. Michigan State (Oct. 9) ... had three stops vs. Iowa (Oct. 16) ... posted three tackles at Penn State (Oct. 30) ... recorded a season-high six tackles, including one for a loss, and his first career forced fumble in start at defensive end vs. Illinois (Nov. 6) ... tallied four solo tackles, including one for a loss of 14 yards, and forced a fumble that led to a 58-yard touchdown return in start at defensive end against Purdue (Nov. 13) ... registered two tackles in start at defensive end vs. Wisconsin (Nov. 20) ... had two solo tackles in start at defensive end against Ohio State (Nov. 27) ... notched two solo tackles in start at defensive end vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... earned first varsity letter ... U-M Athletic Academic Achievement award ... CollegeFootballNews.com Freshman All-America honorable mention ... Sporting News Freshman All-Big Ten ... started all 12 games at outside linebacker ... posted 37 tackles, 7.5 tackles for loss, two sacks, one interception and three pass breakups ... made first career start at linebacker and contributed on special teams vs. Western Michigan (Sept. 5), recording four tackles, one TFL and an assisted sack ... posted two tackles vs. Notre Dame (Sept. 12) ... tallied seven tackles, a half-sack and his first collegiate interception vs. Eastern Michigan (Sept. 19) ... intercepted an Eagles pass that set up a U-M touchdown late in the third quarter ... started at linebacker vs. Indiana (Sept. 26) ... had two pass breakups and assisted on one tackle At Michigan State (Oct. 3) ... made two tackles at Iowa (Oct. 10) ... recorded two tackles for loss against Delaware State (Oct. 17) ... posted four stops, one sack and 1.5 TFLs for six yards vs. Penn State (Oct. 24) ... tallied three tackles at Illinois (Oct. 31) ... totaled five tackles, including a career-tying two TFLs vs. Purdue (Nov. 7) ... contributed two stop at Wisconsin (Nov. 14) ... tallied five tackles vs. Ohio State (Nov. 21).
Prep ... attended Chaparral High School (2009) coached by Charlie Ragle ... Spanish Honor Society ... 2009 Scholar-
Athlete Award from the College Football Hall of Fame ... 2009 Student-Athlete Award from ESPN Great Rivalry Series Game ... helped lead team to Class 4A-I state championship game during senior year ... led squad to state semifinals as a junior ... ran 40-yard dash in 4.6 seconds ... owns maximum bench press of 280 pounds and maximum squat of 400 pounds ... Key Statistics ... totaled 228 tackles and 30.5 sacks in his career ... broke school record for sacks in a season as a junior and again as a senior ... made 140 tackles, 56 tackles for loss, 16.5 sacks, one interception and two fumble recoveries as a senior ... recorded 99 tackles, 45 TFLs, 15.5 sacks and two fumble recoveries during junior campaign ... led team with eight tackles and two sacks in state semifinal game as a sophomore ... Honors and Rankings ... 2008-09 Gatorade Player of the Year in the state of Arizona ... four-star prospect and the No. 67 overall player nationally by scout.com ... listed as the eighth-best defensive end nationally according to scout.com ... SuperPrep All-American and the nation’s 12th-best defensive line prospect according to the publi-cation ... listed as the fourth-best prospect in the state of Arizona by SuperPrep ... Prep Star All-American and named to the publication’s Top 250 ... No. 48 overall player nation-ally by Scouts, Inc. ... four-star prospect and the fourth-best prospect in the state of Arizona according to Rivals.com ... 156th overall prospect nationally by Rivals.com ... rated as the nation’s seventh-best weakside defensive end by Rivals.com ... listed as the fourth-best pass rushing defensive end and as the No. 3 quickest first step among defensive ends by Rivals.com ... tallied one sack and three hurries in the Under Armour All-American game ... recipient of 2008 The Curley Culp Award as the state of Arizona’s outstanding defensive lineman ... coaches all-state first team as a junior and senior ... Arizona Republic and East Valley Tribune all-state first team junior and senior seasons ... Desert Sky first-team All-Region junior and senior years ... all-city first team as a junior and senior ... team Most Valuable Defensive Player final two years ... Other Sports ... three-year varsity letterman in basketball.
Personal ... Craig Robert Roh was born January 25, 1991 ... father, Fred, played basketball at Grand Valley State ... high school teammate of offensive tackle Taylor Lewan ... enrolled in the School of Kinesiology, majoring in sport management.
Craig Roh’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 12/12 17-20-37 7.5-22 2-12 1-0 0-0 32010 13/13 28-15-43 5.5-31 0.5-5 0-0 0-0 12011 12/12 18-11-29 8-37 4-31 0-0 0-0 0Career 37/37 63-47-110 21-90 6.5-48 1-0 0-0 4
Craig Roh’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-0-0 0-0 0-0 0-0 0-0 0Notre Dame 0-0-0 0-0 0-0 0-0 0-0 0Eastern Michigan 3-2-5 1-6 1-6 0-0 0-0 0San Diego State 2-0-2 2-15 1-14 0-0 0-0 0Minnesota 4-1-5 1-1 0-0 0-0 0-0 0at Northwestern 0-2-2 0.5-3 0.5-3 0-0 0-0 0At Michigan State 4-2-6 2-4 0-0 0-0 0-0 0Purdue 2-2-4 0.5-6 0.5-6 0-0 0-0 0at Iowa 3-0-3 1-2 1-2 0-0 0-0 0at Illinois 0-1-1 0-0 0-0 0-0 0-0 0Nebraska 0-1-1 0-0 0-0 0-0 0-0 0Ohio State 0-0-0 0-0 0-0 0-0 0-0 0Season Totals 18-11-29 8-37 4-31 0-0 0-0 0
Roh’s Career Bests:Tackles: 7, vs. Eastern Michigan (Sept. 19, 2009)Solos: 5, vs. Illinois (Nov. 6, 2010)Asst: 5, vs. Eastern Michigan (Sept. 19, 2009)TFLs: 2, five times (last At Michigan State, Oct. 15, 2011)Sacks: 1, four times (last at Iowa, Nov. 5, 2011)Int.: 1, vs. Eastern Michigan (Sept. 19, 2009)FR: NonePBUs: 2, At Michigan State (Oct. 3, 2009)
Jeremy ross#96 • Placekicker5-5 • 150 • So.-Fr.Ann Arbor, Mich.Pioneer HS
Sophomore/Freshman (2011) ... did not see game action.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Pioneer High School (2010) ... Key Statistics ... converted 22-of-25 career field goal opportunities and 105-of-112 PAT attempts ... Honors and Rankings ... two-time first-team all-conference ... honorable mention all-confer-ence as a sophomore ... All-State Dream Team as a senior by the Detroit Free Press ... first-team All-State selection as a senior, as selected by the Associated Press ... first team all-county and all-area as a senior ... honorable mention all-area as a junior and third-team all-area as a sophomore ... three-year varsity letterwinner ... two-time all-academic selection.
Personal... Jeremy Ryan Ross was born December 26, 1991... enrolled in School of Kinesiology, majoring in sport man-agement.
roy rouNdtree **#12 • Wide Receiver6-0 • 177 • Sr.-Jr.Trotwood, OhioTrotwood-Madison HS
At Michigan ... two-year varsity letterman ... has started in 29 consecutive games ... team’s active leader in career receiving yards and receptions ... surpassed 1,000 career receiving yards against Illinois (Nov. 6, 2010) ... set the Michigan record for receiving yards in a single game (246) against Illinois (Nov. 6, 2010) ... team’s top returning wide receiver from 2009 and 2010 ... switched from jersey #16 to #12 prior to 2009 spring drills.
Senior/Junior (2011) ...named to the Biletnikoff Award pre-season watch list ... appeared in all 12 games; started all 12 games at wide receiver; also played on special teams in eight games ... MICHIGAN STATE (Oct. 15) ... led the team with four receptions for 66 yards and 34-yard touchdown catch in the fourth quarter ... NORTHWESTERN (Oct. 8) ... grabbed three passes for a season-high 83 yards, including a 57-yarder on Michigan’s first drive of the second half ... NOTRE DAME (Sept. 10) ... made 16-yard catch for game-winning touch-down with two seconds remaining in the game.
Junior/Sophomore (2010) ... earned second varsity letter ... Biletnikoff Award watch list ... All-Big Ten second team (media) ... Big Ten co-Offensive Player of the Week (Illinois) ... College Football Performance Awards Wide Receiver of the Week (Illinois) ... Phil Steele’s Midseason All-Big Ten third team ... started all 13 contests ... third in the Big Ten for receiv-ing yards per game (71.9 avg.) and fourth in the Big Ten for receptions per game (5.5 avg.) ... team’s leading receiver with 72 catches for 935 yards and seven touchdowns ... led team with 12 receptions over 20 yards, including three over 70 yards ... made one reception in start vs. Connecticut (Sept. 4) ... team-high eight catches for 82 yards and one touchdown at Notre Dame (Sept. 11), a 31-yard TD reception ... made a 15-yard reception on third down that setup the game-winning two-yard run by Denard Robinson at ND ... made his third consecutive start at slot receiver, making two catches for 12 yards vs. Massachusetts (Sept.18) ... made an appear-ance on special teams vs. Massachusetts and recorded one solo tackle ... game-high nine receptions for 118 yards in start vs. Bowling Green (Sept. 25), eclipsing the 100-mark for the third time in his career ... topped 100 yards receving for
the second straight week in start at Indiana (Oct. 2), making five receptions for a career-matching 126 yards and a 32-yard touchdown ... added a game-high 74-yard reception in the first quarter -- the second longest in his career -- against the Hoosiers ... game-high six receptions for 48 yards in start vs. Michigan State (Oct. 9) ... snagged two passes for 10 yards in start vs. Iowa (Oct. 16) ... caught a game-high three passes for 15 yards in start at Penn State (Oct. 30) ... became the first Wolverine to eclipse 200 yards receiving in a single game (246) in start vs. Illinois (Nov. 6), scoring a career-best two touchdowns on nine catches ... his 246 receiving yards against the Illini broke Jack Clancy’s school record of 197 receving yards against Oregon State in 1966 ... scored his two touchdowns on a season-long 75-yarder and a fourth-down 33-yarder in addition to another 75-yard reception that set up a four-yard U-M rushing touchdown ... co-Big Ten Offensive Player of the Week for his performance against Illinois ... game-high six receptions for 69 yards and a touchdown in start against Purdue (Nov. 13) ... scored on a nine-yard toss in the first quarter for Michigan’s second touchdown against the Boilermakers ... game-high seven receptions for 114 receiving yards -- his fourth game of the season surpassing 100 receivng yards -- and a touchdown in start vs. Wisconsin (Nov. 20) ... scored on a 28-yard pass play late in the fourth quarter against the Badgers ... caught five passes for 43 yards in start at Ohio State (Nov. 27) ... grabbed game-high nine passes for 53 yards and a touchdown in start vs. Mississippi State (Jan. 1) in the Gator Bowl ... opened Gator Bowl scoring with a 10-yard touchdown grab on U-M’s opening drive of the game.
Sophomore/Freshman (2009) ... earned first varsity letter ... CollegeFootballNews.com Freshman All-America honorable mention ... Sporting News Freshman All-Big Ten ... played in 11 games at slot receiver and started the final four contests at the position ... led team with 32 receptions for 434 yards and three touchdowns ... returned one kickoff for 19 yards ... made career debut at slot receiver vs. Western Michigan (Sept. 5) ... did not see game action vs. Notre Dame (Sept. 12) ... played slot receiver vs. Eastern Michigan (Sept. 19) ... recorded his first collegiate reception for 35 yards vs. Indiana (Sept. 26) ... caught nine-yard touchdown pass from Tate Forcier that tied game with two seconds left in regulation At Michigan State (Oct. 3) ... played wideout at Iowa (Oct. 10) ... saw game action at slot receiver and kick returner vs. Delaware State (Oct. 17), returning one kickoff for 19 yards ... lined up at slot receiver vs. Penn State (Oct. 24) ... earned first career start at slot receiver against Illinois (Oct. 31), grabbing four passes for 92 yards ... had a 76-yard career long recep-tion on the opening drive of the second half against the Illini ... posted career-highs with 10 receptions for 126 yards in start at slot receiver vs. Purdue (Nov. 7) ... scored on a 43-yard reception in the second quarter against the Boilermakers ... led team with seven receptions for 56 yards and scored on a 10-yard pass at Wisconsin (Nov. 14) ... led team with 116 yards on nine catches vs. Ohio State (Nov. 21) ... caught 30 passes for 390 yards and two TDs in the final four games.
Freshman (2008) ... did not see game action.
Prep ... attended Trotwood-Madison High School (2008) coached by Maurice Douglas ... two-year starter at Belmont High in Dayton, Ohio, before transferring to Trotwood-Madison ... Key Statistics ... finished career with 165 catches for 2,637 yards and 28 touchdowns ... hauled in 86 passes for 1,238 yards and 13 touchdowns as a senior ... caught 49 passes for 987 yards and eight touchdowns as a junior ... recorded six interceptions while playing cornerback in 2005 ... Honors and Rankings ... four-star prospect and the nation’s No. 44 wide receiver recruit according to Rivals.com ... rated as the 17th-best prospect in the state of Ohio by Rivals.com ... three-star prospect and the No. 89 wide receiver in the country according to Scout.com ... PrepStar All-Midwest Region ... all-conference as a junior and senior ... Division II first-team all-state as a senior ... selected to play in the Big 33
Game ... honored as the division offensive player of the year as a senior ... all-area and all-district first teams senior year ... participated in the West Lafayette NIKE Camp ... all-state honorable mention junior year.
Personal ... Roy Randolph Roundtree was born March 7, 1989 ... from the same high school as tight end Brandon Moore and running back Michael Shaw ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Roy Roundtree’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2009 11/4 32 434 13.6 39.5 3 762010 13/13 72 935 13.0 71.9 7 752011 12/12 18 345 19.2 28.8 2 57Career 36/29 121 1668 13.8 46.3 12 76
Roy Roundtree’s Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan 2 13 6.5 0 10Notre Dame 1 16 16.0 1 16Eastern Michigan 0 0 0.0 0 0San Diego State 2 15 7.5 0 10Minnesota 0 0 0.0 0 0at Northwestern 3 83 27.7 0 57At Michigan State 4 66 16.5 1 34Purdue 2 61 30.5 0 49at Iowa 2 37 18.5 0 19at Illinois 0 0 0.0 0 0Nebraska 1 46 46.0 0 46Ohio State 1 8 8.0 0 8Season Totals 18 345 19.2 2 57
Roundtree’s Career Bests:ReceivingReceptions: 10, vs. Purdue (Nov. 7, 2009)Yards: 246, vs. Illinois (Nov. 6, 2010)Touchdowns: 2, vs. Illinois (Nov. 6, 2010)Long: 76, at Illinois (Oct. 31, 2009)
Jake ryaN#90 Linebacker6-3 • 230 • So.-Fr.Westlake, OhioSt. Ignatius HS
Sophomore/Freshman (2011)... appeared in all 12 games; played all 12 games at linebacker, starting 10 of them (Western Michigan, Eastern Michigan, San Diego State, Minnesota, Michigan State, Purdue, Iowa, Illinois, Nebraska, Ohio State), contributed on special teams in all 12 contests ... OHIO STATE (Nov. 26) ... made three tackles and added an assisted sack ... NEBRASKA (Nov. 19) ... recorded three tack-les, an assisted sack and first career forced fumble ... ILLINOIS (Nov. 12) ... set career high with four assisted stops and had an assisted TFL ... PURDUE (Oct. 29) ... four tackles, including one TFL for a loss of five yards ... MINNESOTA (Oct. 1) ... made one solo tackle for first career sack ... SAN DIEGO STATE (Sept. 24) ... recorded a career-high five tackles, including one for a loss, and first two career fumble recoveries ... WESTERN MICHIGAN (Sept. 3) ... made career debut and first collegiate start at strongside linebacker, notching one assisted tackle and deflecting a pass into the air that Brandon Herron inter-cepted and returned 94 yards for a touchdown.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended St. Ignatius High School (2010) coached by Chuck Kyle ... ran 40-yard dash in 4.57 seconds ... member of the state championship team during his junior year ... Key Statistics ... registered 104 tackles, 26 tackles for loss, eight sacks, four pass breakups and two fumble recoveries as a
senior ... injured during junior season and played mostly on special teams ... recovered onside kick at the end of the state championship game that clinched the title as a junior ... Honors and Rankings ... three-star and No. 45 prospect in the state of Ohio by Rivals.com ... rated 30th-best inside linebacker nationally according to Rivals.com ... three-star prospect and the No. 80 outside linebacker according to scout.com ... earned All-Ohio honors as a senior ... shared Defensive Player of the Year honors for Northeast District senior year ... named to Cleveland Plain Dealer All-Star Team.
Personal ... Jacob William Ryan was born Feb. 27, 1992 ... brother, Connor, is a receiver at Ball State ... father, Tim, was a wide receiver at Wake Forest (1980-84) ... grandfather, Francis Sweeney, was a defensive tackle at Xavier and went on to play in the Canadian Football League ... from the same high school as former Wolverines Pat and Mike Massey, Pat Kratus and Trent Zenkewicz ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Jake Ryan’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2011 12/10 14-16-30 7-17 2-5 0-0 2-0 0Career 12/10 14-16-30 7-17 2-5 0-0 2-0 0
Jake Ryan’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 0-1-1 0-0 0-0 0-0 0-0 0Notre Dame 2-2-4 1-2 0-0 0-0 0-0 0Eastern Michigan 2-1-3 1-2 0-0 0-0 0-0 0San Diego State 4-1-5 1-2 0-0 0-0 2-0 0Minnesota 1-0-1 1-3 1-3 0-0 0-0 0at Northwestern 1-0-1 0-0 0-0 0-0 0-0 0At Michigan State 0-0-0 0-0 0-0 0-0 0-0 0Purdue 1-3-4 1-5 0-0 0-0 0-0 0at Iowa 0-1-1 0.5-1 0-0 0-0 0-0 0at Illinois 0-4-4 0.5-0 0-0 0-0 0-0 0Nebraska 2-1-3 0.5-1 0.5-1 0-0 0-0 0Ohio State 1-2-3 0.5-1 0.5-1 0-0 0-0 0Season Totals 14-16-30 7-17 2-5 0-0 2-0 0
Ryan’s Career Bests:Tackles: 5, vs. San Diego State (Sept. 24, 2011)Solos: 4, vs. San Diego State (Sept. 24, 2011)Asst:4, at Illinois (Nov. 12, 2011)TFLs: 1, five times (last vs. Purdue, Oct. 29, 2011)Sacks: 1, vs. Minnesota (Oct. 1, 2011)Int.: NoneFR: 2, vs. San Diego State (Sept. 24, 2011)PBUs: None
michael schoField *#75 • Offensive Lineman6-7 • 299 • Jr.-So.Orland Park, Ill.Carl Sandburg HS
Junior/Sophomore (2011)... appeared in 12 games; started nine games at left guard (Western Michigan, Minnesota, Northwestern, Michigan State, Purdue, Iowa, Illinois, Nebraska, Ohio State) and played in two other games as a reserve offen-sive lineman; played all 12 games on special teams.
Sophomore/Freshman (2010) ... earned first varsity letter ... appeared in all 13 contests ... made career debut on field goal/PAT protection units vs. Connecticut (Sept. 4) and Notre Dame (Sept. 11) ... played on field goal/PAT protection unit vs. Massachusetts (Sept.18) ... saw first game action at right tackle as a reserve and contributed on special teams vs. Bowling Green (Sept. 25) ... contributed on field goal/PAT protection units in Big Ten opener at Indiana (Oct. 2) ... played on field goal/PAT protection units vs. Michigan State (Oct. 9) and Iowa (Oct. 16) ... contributed on special teams units at Penn State
(Oct. 30), vs. Illinois (Nov. 6) and at Purdue (Nov. 13) ... appeared on the field goal/PAT protection units vs. Wisconsin (Nov. 20) and at Ohio State (Nov. 27) ... saw game action on special teams units vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... U-M Athletic Academic Achievement award ... redshirted ... did not see game action.
Prep ... attended Carl Sandburg High School (2009) coached by Dave Wierzal ... three-year starter at offensive tackle ... played offensive and defensive tackle and tight end ... maxed out at 300 pounds on bench press and with a 420-pound squat ... Key Statistics ... did not allow a sack as a senior and entire offensive line was not flagged for a holding penalty all season ... led team with 83 tackles as a senior, including five sacks, four pass breakups, two forced fumbles, one fumble recovery ... started on both sides of the ball as senior ... had six touchdown catches and 11 sacks as a freshman ... Honors and Rankings ... Prep Star All-American and named to the publication’s Top 250 ... SuperPrep All-American and the nation’s No. 21 overall offensive line prospect ... four-star prospect and the No. 18 offensive tackle nationally accord-ing to Rivals.com ... four-star prospect and the 135th overall player nationally according to scout.com ... rated as 10th-best offensive tackle nationally according to scout.com ... selected as sixth-best prospect in the state of Illinois and the 221st overall player nationally by Rivals.com ... listed as the No. 41 offensive tackle nationally by Scouts, Inc. ... named the 42nd offensive tackle in the nation by ESPN.com ... listed as the No. 21 overall player in the Midwest by SuperPrep ... listed as the No. 18 overall player on the Detroit Free Press Best of the Midwest rankings ... all-area and all-conference as a junior and senior ... team co-captain and named most valu-able player as a senior ... started at right tackle and played left tackle in the inaugural Hawaii vs. Mainland Bowl following senior year ... Other Sports ... three-year letterman in track ... threw shot put and discus and competed in relays ... was a hurdler on the track team first two years.
Personal ... Michael Ross Schofield III was born November 15, 1990 ... enrolled in the School of Kinesiology, majoring in physical education.
alex schWaB#60 • Defensive Tackle6-0 • 241 • Sr.-Jr.Manassas, Va.Osbourn Park HS
Senior/Junior (2011) ... did not see game action.
Junior/Sophomore (2010) ... did not see game action.
Sophomore/Freshman (2009) ... U-M Athletic Academic Achievement ... did not see game action.
Prep ... attended Osbourn Park High School (2008) coached by Brian Beaty ... National Honor Society member ... grad-uated third in his class ... AP Scholar ... National Merit Scholarship Commended Student ... two-year varsity letter-man in football ... first-team All-Cedar Run District at guard senior year ... honorable mention All-Cedar Run District as a junior.
Personal ... Alexander Hans Schwab was born Feb. 10, 1990 ... enrolled in the College of Engineering, majoring in nuclear engineering and radiological sciences.
michael shaW ***#20 • Running Back6-1 • 195 • Sr.Trotwood, OhioTrotwood-Madison HS
At Michigan ... three-year letterman ... appeared in 39 career games and made 11 starting assignments ... has 190 carries for 1,001 yards and scored 14 touchdowns in his career ... eclipsed 1,000 career rushing yards against Illinois (Nov. 12, 2011) ... made 19 receptions for 124 yards and one touch-down during his career.
Senior (2011) ... appeared in nine games; played eight games at running back, including one start (Notre Dame); played three games on special teams ... ILLINOIS (Nov. 12) ... surpassed 1,000 career rushing yards with four-yard perfor-mance ... PURDUE (Oct. 29) ... earned five carries for 56 yards ... scored 14th career rushing touchdown with a 37-yarder in the fourth quarter ... NORTHWESTERN (Oct. 8) ... rushed six times for 25 yards and a two-yard touchdown, added a reception for 12 yards ... WESTERN MICHIGAN (Sept. 3) ... recorded longest touchdown run of career with a 44-yarder while recording four carries for 54 yards as a reserve run-ning back.
Junior (2010) ... earned third varsity letter ... played 11 and started five games at superback ... registered 75 rushes for 402 yards and nine touchdowns ... caught 10 passes for 75 yards ... had one kickoff return for seven yards in one appear-ance ... carried the ball a career-high 15 times for 48 yards and scored one touchdown vs. Connecticut (Sept. 4), also had 16-yard career long reception ... rushed five times for 12 yards and added three receptions for 28 yards at Notre Dame (Sept. 11) ... ran the ball 12 times for a career-high 126 rushing yards and three touchdowns vs. Massachusetts (Sept. 18), and his first collegiate multi-touchdown perfor-mance ... registered a 34-yard touchdown run, the longest touchdown run of his career, and had a 50-yard run, the lon-gest single rush of his career vs. Massachusetts. ... recorded 12 carries for 59 yards and a touchdown in start vs. Bowling Green (Sept. 25), scoring on a two-yard rush late in the second quarter ... caught one pass for two yards against the Falcons ... missed the Indiana (Oct. 2) game due to a knee injury ... returned to action as a reserve superback vs. Michigan State (Oct. 9), rushing four times for 29 yards and catching two passes for 17 yards ... three carries for six yards in limited action at superback vs. Iowa (Oct. 16) ... one carry for four yards at Penn State (Oct. 30) ... matched career-high with three rushing touchdowns as a reserve superback vs. Illinois (Nov. 6), carrying the ball nine times for 44 yards ... scored two of his three touchdowns in the first and third overtimes -- five- and one-yarders, respectively ... had two carries for three yards as a reserve superback before leaving contest with a head injury against Purdue (Nov. 13) ... missed Wisconsin (Nov. 20) game due to head injury ... returned to action in start at superback against Ohio State (Nov. 27), car-rying the ball eight times for 52 yards, including a one-yard rushing touchdown ... returned one kickoff for seven yards in spot duty against the Buckeyes ... posted four carries for 19 yards and one reception for two yards as a reserve super-back vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore (2009) ... earned second varsity letter ... played in nine games and started three at superback ... rushed 42 times for 185 yards and scored two touchdowns ... appeared at running back vs. Western Michigan (Sept. 5), rushing for 37 yards on seven carries ... did not see game action vs. Notre Dame (Sept. 12) ... posted nine rushes for 53 yards and scored his first career rushing touchdown vs. Eastern Michigan (Sept. 19) ... had three straight rushes for 34 yards that were capped by a five-yard touchdown in the second quarter against EMU ... two rushes for five yards vs. Indiana (Sept. 26) ... did not play At Michigan State (Oct. 3) ... carried
the ball four times for 17 yards at Iowa (Oct. 10) ... made first start of the season at superback vs. Delaware State (Oct. 17), had nine carries for career-high 73 yards and one TD on two-yard rush on the opening drive against DSU ... 11-yard career long reception from superback position vs. Penn State (Oct. 24) ... did not see game action at Illinois (Oct. 31) ... earned starting assignment at superback vs. Purdue (Nov. 7), carrying the ball once for two yards ... played superback at Wisconsin (Nov. 14) ... started at superback vs. Ohio State (Nov. 21), carrying the ball seven times and caught one pass.
Freshman (2008) ... earned first varsity letter ... played in 10 games and started two at superback ... team’s third-leading rusher ... carried the ball 42 times for 215 yards and caught six passes for 32 yards and one touchdown ... made career debut vs. Utah (Aug. 30), caught three passes for 17 yards and had 12-yard kick return ... scored team’s first points of the season on an eight-yard touchdown pass from Nick Sheridan against the Utes ... rushed twice for 45 yards against Miami (Sept. 6) ... recorded the team’s longest run of the season on a 30-yard dash against Miami and grabbed one pass for three yards ... rushed twice for five yards at Notre Dame (Sept. 13) ... did not play vs. Wisconsin (Sept. 27) ... one catch for seven yards and added a six-yard carry vs. Illinois (Oct. 4) ... rushed four times for 19 yards vs. Toledo (Oct. 11) ... played superback at Penn State (Oct. 18) ... did not play vs. Michigan State (Oct. 25) ... rushed four times for 10 yards at Purdue (Nov. 1) ... posted career-highs with eight carries for 71 yards and added a five-yard reception at Minnesota (Nov. 8) ... started in a two-back set with Brandon Minor against the Gophers, his first career starting assign-ment ... had a 48-yard career long run against the Gophers that set up K.C. Lopata’s school record-tying fifth field goal ... rushed seven times for 17 yards vs. Northwestern (Nov. 15), his second consecutive starting assignment ... rushed a career-high 12 times for 41 yards at Ohio State (Nov. 22).
Prep ... attended Trotwood-Madison High School (2008) coached by Maurice Douglas ... benched 285 pounds, squatted 425 and registered a 35-inch vertical jump ... Key Statistics ... rushed 383 times for 2,325 yards and scored 36 touchdowns during his career ... finished Prep career with 33 catches for 680 yards and eight touchdowns ... gained over 1,250 rushing yards and 300 receiving yards as a senior ... rushed 180 times for 975 yards and scored 21 touchdowns as a junior ... 10 receptions for 200 yards and one TD junior year ... carried the ball 80 times for 475 yards and three scores as a sophomore ... Honors and Rankings ... four-star prospect and the nation’s seventh-best running back recruit according to Rivals.com ... rated as sixth-best player in the state of Ohio by Rivals.com ... four-star recruit and the 29th-best running back nationally by Scout.com ... listed as the No. 58 running back in the nation by ESPN.com ... tabbed top-300 prospect by Tom Lemming ... named the No. 42 offensive player in the country and No. 19 in the Midwest by G&W Recruiting Report ... selected to the Big 33 game.
Personal ... Michael Allen Shaw was born November 24, 1989 ... from the same high school as tight end Brandon Moore and wide receiver Roy Roundtree ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Michael Shaw’s Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2008 10/2 42 215 5.1 21.5 0 482009 9/3 42 185 4.4 20.6 2 222010 11/5 75 402 5.4 36.5 9 502011 9/1 31 201 6.5 22.3 3 44Career 39/11 190 1003 5.3 25.7 14 50
Michael Shaw’s Game-by-Game Rushing Statistics2011 Opponent Att. Yards Avg. TD LongWestern Michigan 4 54 13.5 1 44 Notre Dame 2 -3 - 0 0
Eastern Michigan 1 3 3.0 0 3 San Diego State 0 0 0.0 0 0 Minnesota 8 60 7.5 0 18 at Northwestern 6 25 4.2 1 9 At Michigan State - - - - -Purdue 5 56 11.2 1 37at Iowa - - - - -at Illinois 3 4 1.3 0 7Nebraska 2 2 1.0 0 2Ohio State - - - - -Season Total 31 201 6.5 3 44
Michael Shaw’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2008 10/2 6 32 5.3 3.2 1 82009 9/3 2 5 2.5 0.5 0 112010 11/5 10 75 7.5 6.8 0 162011 9/1 1 12 12.0 1.3 0 12Career 39/11 19 124 6.5 3.2 1 16
Shaw’s Career Bests:RushingAttempts: 15, vs. Connecticut (Sept. 4, 2010)Yards: 126, vs. Delaware State (Oct. 17, 2009)Touchdowns: 3, twice (last vs. Illinois, Nov. 6, 2010)Long: 50, vs. Massachusetts (Sept. 18 2010)
ReceivingReceptions: 3, twice (last at Notre Dame, Sept. 11, 2010)Yards: 28, at Notre Dame (Sept. 11, 2010)Touchdowns: 1, vs. Utah (Aug. 30, 2008)Long: 16, vs. Connecticut (Sept. 4, 2010)
Floyd simmoNs **#23 • Safety6-0 • 194 • Sr.-Jr.Detroit, Mich.Crockett Technical HS
Senior/Junior (2011) ... appeared in all 12 games; played in all 12 on special teams ... NEBRASKA (Nov. 19) ... recorded a career-best-matching three tackles and forced third career fumble on kickoff coverage ... NOTRE DAME (Sept. 10) ... forced second career fumble on final kick return of the game.
Junior/Sophomore (2010) ... earned second varsity letter ... appeared in all 13 contests ... posted nine special teams tackles ... saw game action on special teams vs. Connecticut (Sept. 4) and at Notre Dame (Sept. 11) ... contributed on kick-off coverage unit vs. Massachusetts (Sept. 18) and Bowling Green (Sept. 25) ... made three tackles on special teams in Big Ten opener at Indiana (Oct. 2) ... tallied one special teams tackle vs. Michigan State (Oct. 9) ... had one solo tackle on special teams units vs. Iowa (Oct. 16) ... had one solo tackle on special teams units at Penn State (Oct. 30) ... made one solo tackle on special teams and had a huge block on the kickoff return unit to spring Darryl Stonum for season-long 61-yard return late in the first half vs. Illinois (Nov. 6) ... reg-istered one solo tackle on special teams at Purdue (Nov. 13) and vs. Wisconsin (Nov. 20) ... contributed on special teams at Ohio State (Nov. 27) ... assisted on a tackle as a reserve cornerback and on special teams vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore/Freshman (2009) ... earned first varsity letter ... played on special teams units in eight games ... contributed five tackles and one tackle for loss ... made career debut at linebacker and played on special teams vs. Western Michigan (Sept. 5) ... contributed on special teams vs. Notre Dame (Sept. 12) ... posted two tackles, including one TFL, from linebacker spot vs. Eastern Michigan (Sept. 19) ... recorded one solo tackle on special teams vs. Indiana (Sept.
26) ... played special teams in road games At Michigan State (Oct. 3) and Iowa (Oct. 10) ... appeared at outside linebacker and on special teams vs. Delaware State (Oct. 17), recording one tackle and a forced fumble ... posted one special teams stop vs. Penn State (Oct. 24) ... did not play in final four con-tests of the season due to injury.
Freshman (2008) ... did not see game action.
Prep ... attended Crockett Technical High School (2008) coached by Rod Oden ... National Honor Society ... mem-ber of Student Government ... Skills USA participant ... Key Statistics ... recorded 11 interceptions and scored five touch-downs as a senior ... posted four picks and scored seven TDs junior year ... Honors and Rankings ... all-conference, all-city and all-state as a senior ... honorable mention all-conference junior year.
Personal ... Floyd F. Simmons was born August 6, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in political science.
Floyd Simmons’ Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 8/0 4-1-5 1-4 0-0 0-0 0-0 02010 13/0 8-2-10 0-0 0-0 0-0 0-0 02011 12/0 6-0-6 0-0 0-0 0-0 0-0 0Career 33/0 18-3-21 1-4 0-0 0-0 0-0 0
christopher smith
#31 • Kicker6-0 • 177 • FrWashington, DCSt. Albans HS
Freshman (2011) ... did not see game action.
Personal ... enrolled in the College of Literature, Science and the Arts, major undeclared.
viNceNt smith **#2 • Running Back5-6 • 172 • Jr.Pahokee, Fla.Pahokee HS
At Michigan ... two-year letterman ... played in 32 games, each at running back, earning 11 starts ... 233 career carries for 1,173 yards and eight touchdowns ... reached 1,000-yard rushing mark vs. Eastern Michigan (Sept. 17, 2011) ... became the first Michigan player in modern history to score a touch-down running, passing and receiving in the same game vs. Minnesota (Oct. 1, 2011); sixth Big Ten player to complete the “hat-trick” since 1996 ... 35 career receptions for 354 yards and six touchdowns ... 354 career receiving yards are ninth all-time by a U-M running back.
Junior (2011) ... appeared in 11 games; 11 at running back, making one start (Minnesota); kick returner during the first four games ... third-best rusher on the team with 303 rushing yards ... MINNESOTA (Oct. 1) ... started and became first U-M player in program history to score a touchdown rushing, passing and receiving; the first in FBS since 2009 and the sixth in the Big Ten since 1996 ... tallied 72 yards of total offense (28-receiving, 27-rushing, 17-passing) while completing first and only career pass attempt ... SAN DIEGO STATE (Sept. 24) ... Scored first rushing touchdown of the season on a seven-yard run ... compiled 91 all-purpose yards (47-rushing, 44-receiving) ... EASTERN MICHIGAN (Sept. 17) ... recorded 118 rushing yards (second career 100-yard rush-ing game) to surpass 1,000 career rushing yards ... accrued
149 all-purpose yards (118-rushing, 31-kick return) ... NOTRE DAME (Sept. 10) ... scored first touchdown of the season on 21-yard screen pass ... tallied 127 all-purpose yards (98-kick return, 26-receiving, 3-rushing).
Sophomore (2010) ... earned second varsity letter ... played superback in all 13 contests, started 10 ... has 136 carries for 601 yards and five touchdowns ... caught 15 passes for 130 yards and two touchdowns ... scored a pair of touchdowns against Connecticut (Sept. 4), reaching the end zone on a 12-yard run and an 11-yard reception ... rushed 14 times for 51 yards and added three catches for 18 yards against the Huskies ... carried the ball seven times for 17 yards and added a three-yard reception at Notre Dame (Sept. 11) ... made his first career start at superback, while gaining 42 yards on 11 carries vs. Massachusetts (Sept. 18) ... 12 carries for 62 yards and scored a pair of rushing touchdowns in start vs. Bowling Green (Sept. 25) ... set career-long with a 56-yard touchdown rush in start at Indiana (Oct. 2) ... carried the ball nine times for 80 yards against the Hoosiers ... recorded seven carries for 34 yards and two receptions for 13 yards in start vs. Michigan State (Oct. 9) ... rushed 10 times for 39 yards and caught two passes for 22 yards and an eight-yard touchdown in start vs. Iowa (Oct. 16) ... rushed nine times for 24 yards and caught two passes for a season-high 36 yards at Penn State (Oct. 30) ... posted 13 carries for a team-high 73 yards in start vs. Illinois (Nov. 6) ... caught two passes for 19 yards against the Illini ... carried the ball a career-best 18 times for 99 yards and a touchdown in start against Purdue (Nov. 13) ... followed his blockers perfectly on a 19-yard touchdown run early in the third quarter for the Wolverines’ third score against the Boilermakers ... rushed 11 times for 50 yards and collected one pass for two yards in start at super-back vs. Wisconsin (Nov. 20) ... had eight carries for 17 yards as a backup superback at Ohio State (Nov. 27) ... recorded seven carries for 13 yards and caught two passes for 17 yards in start vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... earned first varsity letter ... appeared in eight games at superback ... carried the ball 48 times for 276 yards (5.8 avg.) and scored one touchdown ... caught 10 passes for 82 yards and scored twice receiving ... made career debut at running back vs. Western Michigan (Sept. 5), rushing for 23 yards on six attempts ... did not see game action vs. Notre Dame (Sept. 12) ... had two carries for 10 yards vs. Eastern Michigan (Sept. 19) ... recorded a solo tackle on an EMU interception return ... did not see game action vs. Indiana (Sept. 26) or Michigan State (Oct. 3) ... had a two-yard run at Iowa (Oct. 10) ... had first career 100-yard rushing per-formance vs. Delaware State (Oct. 17), setting career-highs with 17 carries for 166 yards and a touchdown ... scored first career touchdown on a six-yard rush in the first quarter against the Hornets ... had a 37-yard career-long scamper in the second quarter against DSU ... did not see game action vs. Penn State (Oct. 24) ... carried the ball three times at Illinois (Oct. 31) ... appeared at running back vs. Purdue (Nov. 7), rushing for 12 yards on three attempts ... had a 12-yard kick return against the Boilermakers ... caught seven passes for 54 yards and rushed eight times for 28 yards at Wisconsin (Nov. 14) ... scored first career receiving touchdown on a 21-yard pass play from Tate Forcier against the Badgers ... his seven catches against Wisconsin were the first of his career ... rushed eight times for 32 yards and grabbed three recep-tions for 28 yards vs. Ohio State (Nov. 21) ... scored team’s only touchdown against the Buckeyes on an 18-yard pass from Forcier in the third quarter.
Prep ... attended Pahokee High School (Dec. 2008) coached by Blaze Thompson ... helped lead his team to three straight class 2B state championships ... ran a 4.5-second 40-yard dash ... Key Statistics ... rushed for 4,677 yards and 58 touch-downs during his career ... eclipsed 2,000 yards rushing and scored 29 touchdowns as a senior ... returned eight kickoffs for 332 during his senior year ... rushed for over 1,300 yards and scored 14 touchdowns as a junior ... had 85 carries for
925 yards (10.3 avg.) and score 15 TDs sophomore year ... Honors and Rankings ... Palm Beach Post Small Schools Offensive Player of the Year as a senior ... Palm Beach Post Small Schools All-Area first team senior year ... rated as the No. 100 prospect in state of Florida by the Miami Herald ... three-star prospect according to Rivals.com and scout.com ... rated as the nation’s No. 33 running back according to Rivals.com ... All-Southeast region selection by Prep Star ... selected as No. 101 running back in the country by scout.com ... listed as 78th overall prospect in the state of Florida by SuperPrep ... all-state first team as a junior and senior.
Personal ... Vincent Smith was born February 7, 1990 ... from the same high school as defensive tackle Richard Ash, wide receiver Martavious Odoms and linebacker Brandin Hawthorne ... enrolled in the College of Literature, Science and the Arts, majoring in Afro-American and African studies.
Vincent Smith’s Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2009 8/0 48 276 5.8 30.7 1 372010 13/10 136 601 4.4 46.2 5 562011 11/1 49 296 6.0 26.9 2 38Career 32/11 233 1173 5.0 36.7 8 56
Vincent Smith’s Game-by-Game Rushing Statistics2011 Opponent Att. Yards Avg. TD LongWestern Michigan 2 11 5.5 0 7 Notre Dame 1 3 3.0 0 3 Eastern Michigan 9 118 13.1 0 38 San Diego State 9 47 5.2 1 32 Minnesota 5 27 5.4 1 10 at Northwestern 3 8 2.7 0 6 At Michigan State 8 37 4.6 0 26Purdue 6 28 4.7 0 6at Iowa 4 14 3.5 0 11at Illinois 1 0 0.0 0 0Nebraska - - - - -Ohio State 1 3 3.0 0 3Season Total 49 296 6.0 2 38
Vincent Smith’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2009 8/0 10 82 8.2 10.3 2 212010 13/10 15 130 8.7 10.0 2 192011 11/1 10 142 14.2 14.2 2 32Career 32/11 35 354 10.1 11.4 6 32
Vincent Smith’s Game-by-Game Receiving Statistics2011 Opponent No. Yards Avg. TD LongWestern Michigan 0 0 0.0 0 0Notre Dame 2 26 13.0 1 21Eastern Michigan 0 0 0.0 0 0San Diego State 3 44 14.7 0 32Minnesota 1 28 28.0 1 28at Northwestern 1 6 6.0 0 6At Michigan State 0 0 0.0 0 0Purdue 1 26 26.0 0 26at Iowa 2 12 6.0 0 7at Illinois 0 0 0.0 0 0Nebraska - - - - -Ohio State 0 0 0.0 0 0Season Totals 10 142 14.2 2 32
Vincent Smith’s Career Kick Return StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2009 1/0 1 12 12.0 12.0 0 122010 0/0 0 0 0.0 0.0 0 02011 4/4 7 129 18.4 32.3 0 24Career 5/4 8 141 17.6 28.2 0 24
Smith’s Career Bests:RushingAttempts: 18, at Purdue (Nov. 13, 2010)Yards: 166, vs. Delaware State (Oct. 17, 2009)
Touchdowns: 2, vs. Bowling Green (Sept. 25, 2010)Long: 56, at Indiana (Oct. 2, 2010)
ReceivingReceptions: 7, at Wisconsin (Nov. 14, 2009)Yards: 54, at Wisconsin (Nov. 14, 2009)Touchdowns: 1, six times (last vs. Minnesota, Oct. 1, 2011)Long: 32, last vs. San Diego State (Sept. 24, 2011)
Kick ReturnsAttempts: 5, vs. Notre Dame (Sept. 10, 2011)Yards: 98, vs. Notre Dame (Sept. 10, 2011)Touchdowns: NoneLong: 24, vs. Notre Dame (Sept. 10, 2011)
darryl stoNum
#22 • Wide Receiver6-2 • 195 • SrStafford, TexasDulles High School
At Michigan ... three-year letterman ... started 25 of his 36 games played during his career ... caught 76 passes for 1,008 yards and scored six touchdowns in his career ... surpassed 1,000 career receiving yards against Mississippi State (Jan. 1, 2011) ... returned 62 kickoffs for 1,538 yards and one touch-down ... set U-M season kickoff return marks with 39 returns for 1,001 yards in 2009 ... enrolled at the University of Michigan in January 2008 and partici-pated in spring drills.
Senior (2011) ... redshirted.
Junior (2010) ... earned third varsity letter ... played all 13 contests and started 12 games at wide receiv-er ... second-leading receiver with 49 catches for 633 yards and four touchdowns ... returned 22 kickoffs for 513 yards ... caught a team-high five passes for 34 yards and had a 19-yard kick return vs. Connecticut (Sept. 4) ... made four receptions for 33 yards and returned four kickoffs for 101 yards at Notre Dame (Sept. 11) ...caught a team-high three catches for a career-high 121 yards and two touchdowns vs. Massachusetts (Sept. 18)...registered a career-long 66-yard touchdown reception en route to his first collegiate multi-touchdown game vs. Massachusetts ... grabbed three passes for 38 yards and returned three kickoffs for 49 yards in start vs. Bowling Green (Sept. 25) ... started at wideout and kick returner in Big Ten opener at Indiana (Oct. 2), returning four kicks for 83 yards ... made start at wide receiver and saw action at kick returner vs. Michigan State (Oct. 9), returning two kicks for 35 yards ... caught a career-high nine passes for 97 yards in start vs. Iowa (Oct. 16) ... caught one pass for seven yards at Penn State (Oct. 30) ... posted four receptions for 47 yards and a touchdown in start vs. Illinois (Nov. 6) ... regis-tered the game-tying touchdown to force overtime on a nine-yard reception with under two minutes remaining in regulation ... had one kickoff return for a season-long 61 yards to set up a Michigan field goal late in the first half against the Fighting Illini ... posted two receptions for 17 yards in start against Purdue (Nov. 13). ... collected four passes for 99 yards and a touchdown in start vs. Wisconsin (Nov. 20) ... scored on a 24-yard reception along the right side-lines for Michigan’s first touchdown ... also returned four kickoffs for 103 yards against the Badgers ... hauled in a game-high seven receptions for 81 yards in start at Ohio State (Nov. 27) ... caught seven passes for 59 yards in start vs. Mississippi State (Jan. 1) in the Gator Bowl.
Sophomore (2009) ... earned second varsity letter ... played in all 12 games and started three contests at wide receiver ... caught 13 passes for 199 yards and one touchdown ... returned 39 kickoffs for 1,001 yards and one touchdown ... became the first player in school history to gain 1,000 return yards in a season ... played at wide receiver and contrib-uted on special teams vs. Western Michigan (Sept. 5), returning one kickoff for 20 yards ... made start at wide receiver and played on special teams vs. Notre Dame (Sept. 12), tallying four receptions for 54 yards ... took a kickoff 94 yards for a touchdown on his only return for the game early in the second quarter against the Irish ... his kickoff return was the sixth-longest in school history ... started at wide receiver and kick returner vs. Eastern Michigan (Sept. 19), recording one reception for 10 yards and three returns for 60 yards ... played wide receiver and kick returner vs. Indiana (Sept. 26), returning seven kicks for 218 yards with a long of 45 yards ... fell three yards short of breaking the school record for most kickoff return yards in a single game (221)... matched the second-best total for kickoff returns in a single game in U-M history, falling one short of the record (8) ... set career highs with 97 receiving yards on five receptions At Michigan State (Oct. 3) ... had a 60-yard career long touch-down reception against the Spartans ... returned three kickoffs for 60 yards vs. MSU ... caught one pass for nine yards in start at wide receiver against Iowa (Oct. 10) ... returned five kickoffs for 91 yards against the Hawkeyes ... grabbed one ball for 19 yards and had a 28-yard kickoff return vs. Delaware State (Oct. 17) ... played wide receiver and kick returner vs. Penn State (Oct. 24), returning two kickoffs for 42 yards ... returned two kickoffs for 32 yards at Illinois (Oct. 31) ... lined up at wideout against the Illini ... appeared at wide receiver and kickoff returner vs. Purdue (Nov. 7), returning five kickoffs for 158 yards ... broke Steve Breaston’s sea-son kickoff return marks with performance against the Boilermakers ... returned six kickoffs for 135 yards and played wide receiver at Wisconsin (Nov. 14) ... had a 10-yard reception and returned three kickoffs for 63 yards vs. Ohio State (Nov. 21).
Freshman (2008) ... earned first varsity letter ... started 10 games at wide receiver ... played in 11 contests at wideout ... caught 14 passes for 176 yards and one touchdown ... made career debut vs. Utah (Aug. 30), earning starting nod at wide receiver ... collected a five-yard reception against the Utes ... started and grabbed one pass for eight yards vs. Miami (Sept. 6) ... started and snagged three passes for career-high 35 yards at Notre Dame (Sept. 13) ... snared a 30-yard career long reception against the Irish ... started at wide receiver vs. Wisconsin (Sept. 27) ... did not dress vs. Illinois (Oct. 4) ... played wide receiver vs. Toledo (Oct. 11) ... snagged two passes for nine yards at Penn State (Oct. 18) ... had a five-yard reception in start vs. Michigan State (Oct. 25) ... gained 61 yards on two catches and scored first career touch-down at Purdue (Nov. 1) ... crossed the goal line on a 51-yard catch-and-run in the second quarter against the Boilermakers ... the 51-yard pass from Steven Threet was the longest of the season for the Wolverines ... made a 10-yard catch at Minnesota (Nov. 8) ... caught two passes for 10 yards vs. Northwestern (Nov. 15) ... had a 33-yard catch-and-run in start at Ohio State (Nov. 22).
Prep ... attended John Foster Dulles High School (2008) coached by Jim Creech ... Key Statistics ...fin-ished career with 94 receptions for 1,910 yards and
26 touchdowns ... caught 39 passes for 591 yards and scored three touchdowns as a senior ... also rushed the ball 29 times for 175 yards and scored one TD senior year ... made 49 receptions for 1,078 yards and scored 16 touchdowns as a junior ... took two of his seven punt returns for touchdowns junior year ... had seven punt returns for 223 yards (31.9 avg.) as a junior ... Honors and Rankings ... PrepStar All-American and the 65th-best player in the country according to the publication ... participated in the Under Armour All-American game ... four-star prospect, nation’s seventh-best wide receiver and the fifth-best player in the state of Texas according to Rivals.com ... rated as the 41st-best prospect in the country by Rivals.com and selected as the second-best wideout after the catch ... four-star prospect and the 12th-best wide receiver nationally according to Scout.com ... rated as the 71st-best overall player nationally on the ESPN 150 rankings ... picked as the No. 79 player in the country by Tom Lemming ... named the No. 18 prospect in the Big 12 Region and the No. 45 offensive player in the nation by G&W Recruiting Report ... named to the Houston Touchdown Club’s first team as a senior ... Associated Press honorable mention all-state as a junior and senior... first-team all-district, first-team junior all-state and second-team all-state as a junior and senior... named district MVP junior and senior years ... Other Sports ... varsity letterman in track ... ran in five events including the 100 meter, 200 meter, 400 meter, 4x200-meter relay and the 4x400-meter relay.
Personal ... Darryl Cornell Stonum was born February 14, 1990 ... high school teammate of U-M linebacker Brandon Herron and cornerback Troy Woolfolk ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
alex sWieca
#8 • Quarterback6-1 • 210 • FrNew York, NYThe Frisch HS
Freshman (2011) ... did not see game action.
Personal ... enrolled in the College of Literature, Science and the Arts, major undeclared.
terreNce talBott *#37 • Cornerback5-11 • 178 • So.Huber Heights, OhioWayne HS
Sophomore (2011)... appeared in two games; played both games on special teams.
Freshman (2010) ... earned first varsity letter ... appeared in all 13 contests ... played cornerback in 11 games ... reg-istered 16 tackles and one pass breakup ... made career debut vs. Connecticut (Sept. 4), playing cornerback and on special teams units ... assisted on one tackle and had one pass breakup against the Huskies ... played special teams and cornerback at Notre Dame (Sept. 11) ... played on spe-cial teams vs. Massachusetts (Sept. 18), assisting with one tackle ... appeared as a reserve at cornerback and special teams vs. Bowling Green (Sept. 25) ... made two solo tackles as a reserve cornerback and on special teams in Big Ten opener at Indiana (Oct. 2) ... tallied four tackles as a reserve
cornerback and on special teams vs. Michigan State (Oct. 9) ... had three solo tackles as a backup cornerback and on special teams vs. Iowa (Oct. 16) ... registered a solo tackle as a reserve cornerback and on special teams units at Penn State (Oct. 30) ... posted two solo tackles on special teams vs. Illinois (Nov. 6) ... substituted in as a reserve cornerback and contributed on special teams against Purdue (Nov. 13) ... assisted on tackle as a backup cornerback and on special teams vs. Wisconsin (Nov. 20) and at Ohio State (Nov. 27) ... contributed on special teams units vs. Mississippi State (Jan. 1) in the Gator Bowl.
Prep ... attended Wayne High School (2010) coached by Jay Minton ... ran 40-yard dash in 4.47 seconds ... had a 39-inch vertical leap ... benched 300 pounds and squatted 405 pounds ... Key Statistics ... registered 25 tackles, one interception and one fumble recovery in four games during injury shortened senior year ... posted 45 stops, two forced fumbles, one fumble recovery and three interceptions junior year ... missed sophomore season due to injury ... Honors and Rankings ... three-star and the No. 47 prospect in the state of Ohio according to Rivals.com ... three-star and the nation’s 107th-rated cornerback by scout.com ... rated as the No. 112 overall prospect in the Midwest by SuperPrep ... three-star prospect and the nation’s No. 32 cornerback according to Scouts, Inc. ... named to the Ohio High School Coaches Association North-South All-Star Classic ... two-time first-team Greater Western Ohio Conference selection ... Other Sports ... ran 100m dash, 4x100m relay and was a long jumper on varsity track team.
Personal ... Terrence Lamar Talbott was born Jan. 2, 1992 ... enrolled in the College of Literature, Science and the Arts, major undeclared.
Terrence Talbott’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 13/0 9-6-15 0-0 0-0 0-0 0-0 12011 2/0 0-0-0 0-0 0-0 0-0 0-0 0Career 15/0 9-6-15 0-0 0-0 0-0 0-0 1
raymoN taylor#6 • Defensive Back5-10 • 169 • Fr.Detroit, Mich.Highland Park HS
At Michigan ... swtiched jersey numbers from #21 to #6 prior the San Diego State game his freshmen season (Sept. 24, 2011).
Freshman (2011) ... appeared in 10 games; three as a reserve cornerback and 10 on special teams ... EASTERN MICHIGAN (Sept. 17) ... made career debut and assisted on one tackle.
Prep ... attended Highland Park Community High School (2011) coached by Cedric Dertch ... four-year letterman ... played receiver, tailback, defensive back and returned both punts and kicks during his career ... Key Statistics ... finished his senior season with 48 tackles and five interceptions ... also played running back and wide receiver and recorded 1,000 yards and 14 touchdowns on offense ... registered seven interceptions as a junior ... Honors and Rankings ... four-star recruit and the 14th-best athlete accord-ing to Rivals.com ... listed as the sixth-best prospect in the state of Michigan by Rivals.com ... received a three-star rating and is the No. 49 cornerback pros-pect nationally according to Scout.com ... three-star recruit and the No. 95 athlete nationally according to ESPN.com ... first-team Division 3-4 all-state as a defensive back senior year ... rated as the No. 16
player on The Detroit News Blue Chip list ... listed as the eighth-best player in Michigan according to the Detroit Free Press.
Personal ... Raymon Taylor was born July 24, 1992 ... enrolled in the College of Literature, Science and the Arts, major un-declared.
Raymon Taylor’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2011 10/0 1-1-2 0-0 0-0 0-0 0-0 0Career 10/0 1-1-2 0-0 0-0 0-0 0-0 0
Fitzgerald toussaiNt * #28 • Running Back5-10 • 195 • Jr.-So.Youngstown, OhioLiberty HS
At Michigan ... In 2011, became 31st Wolverine to reach 1,000-yards rushing in a single season.
Junior/Sophomore (2011) ... All-Big Ten honorable men-tion (coaches and media) ... appeared in 11 games, played 11 games at running back, starting 10 of them (Western Michigan, Eastern Michigan, San Diego State, Northwestern, Michigan State, Purdue, Iowa, Illinois, Nebraska, Ohio State); played one game on special teams ... team’s second lead-ing rusher with 1,011 rushing yards ... has rushed for 100 yards in five of 10 starts ... OHIO STATE (Nov. 26) ... posted 20 carries for 120 yards ... surpassed 100 rushing yards for the third straight week and fourth time in five games ... joined Denard Robinson as the first U-M tandem to eclipse 1,000 rushing yards each in a season since 1975 ... NEBRASKA (Nov. 19) ... recorded a career-high 29 carries for 138 yards and a career-matching two touchdowns ... ran for over 100 yards for the second straight week and third time in four games ... scored touchdowns on one- and 31-yard runs in the second half ... caught career-high two passes for four yards, setting new career long of seven yards ... ILLINOIS (Nov. 12) ... set career highs for carries (27) and rushing yards (192) to go along with a touchdown ... surpassed 100-yard barrier for third career game ... scored on a 27-yard run in the fourth quarter for U-M’s last touchdown ... IOWA (Nov. 5) ... had 16 carries for a team-high 58 yards and caught third career pass for first career receiving touchdown from five yards out ... PURDUE (Oct. 29) ... set career highs for carries (20) and rushing yards (170) and matched career high with two rushing touchdowns ... scored on a two-yarder in the second quarter and a highlight-worthy 59-yarder in the third quarter ... second career game with 100-plus rushing yards ... NORTHWESTERN (Oct. 8) ... had career-high 14 car-ries, earning 25 yards ... MINNESOTA (Oct. 1) ... recorded first career 100-yard rushing performance with 108 yards on 11 carries and touchdown ... EASTERN MICHIGAN (Sept. 17) ... earned 11 carries for 46 yards and a one-yard touchdown in the third quarter ... WESTERN MICHIGAN (Sept. 3) ... posted 11 carries for 80 yards and a career-best two touchdowns in first collegiate start at running back.
Sophomore/Freshman (2010) ... earned first varsity letter ... appeared in five games: four at superback and two at kick returner ... made one start at superback ... missed games against Connecticut (Sept. 4), Notre Dame (Sept. 11) and Massachusetts (Sept. 18) with a knee injury ... made col-legiate debut at superback vs. Bowling Green (Sept. 25), car-rying the ball twice for 66 yards and a five-yard touchdown ... had a 61-yard rush on his first collegiate snap against the Falcons ... missed the next five games against Indiana (Oct. 2), Michigan State (Oct. 9), Iowa (Oct. 16), Penn State (Oct. 30) and Illinois (Nov. 6) due to a shoulder injury ... returned to game action as a reserve superback against Purdue (Nov. 13) ... substituted in as a kickoff returner vs. Wisconsin (Nov. 20) ...
had four carries for 16 yards as a backup superback against Ohio State (Nov. 27) ... made first career start at superback vs. Mississippi State (Jan. 1) in the Gator Bowl, rushing twice for five yards and catching one pass for five yards ... served as kick return specialist against the Bulldogs, returning one kick off for 28 yards.
Freshman (2009) ... U-M Athletic Academic Achievement award ... redshirted ... did not see game action.
Prep ... attended Liberty High School (2009) coached by Jeff Whittaker ... posted a maximum bench press of 315 pounds and a maximum squat of 530 pounds ... Key Statistics ... car-ried 455 times for 4,690 yards and 65 touchdowns during his career ... rushed for 2,239 yards on 241 carries and scored 28 touchdowns as a senior ... gained 1,400 yards as a junior and 1,100 yards as a sophomore ... Honors and Rankings ... Prep Star All-American and named to the publication’s Top 250 ... selected as the nation’s 95th-best prospect by Tom Lemming ... four-star prospect and the No. 8 all-purpose back nation-ally according to Rivals.com ... selected as the 14th-best player in the state of Ohio and the 239th overall prospect nationally according to Rivals.com ... rated the 28th-best player nationally by ESPN.com ... listed No. 61 overall pros-pect in the Midwest by SuperPrep ... listed as No. 21 running back in the country by Scouts, Inc. ... three-star performer and the nation’s No. 49 running back according to scout.com ... all-conference, all-county and all-district as a senior ... Division III All-State senior year ... 2008 Trumbull County Player of the Year ... Ohio Division III Co-Offensive Player of the Year and the Youngstown Vindicator Offensive Player of the Year senior season ... first-team All-Trumbull County as a junior and senior ... three-time all-conference ... All-Ohio first team during his senior year ... first-team Division III-IV run-ning back by OhioVarsity.com ... Other Sports ... lettered in track and field ... ran the 100-meters and 4x100-meter relay.
Personal ... Fitzgerald DAndre Toussaint was born May 4, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in Afro-American and African studies.
Fitzgerald Toussaint’s Career Rushing StatisticsYear GP/GS Att. Yards Avg. Per/Game TD Long2010 4/1 8 87 10.9 21.8 1 612011 11/10 174 1011 5.8 91.9 9 65Career 15/11 182 1098 6.0 73.2 10 65
Fitzgerald Toussaint’s Game-by-Game Rushing Statistics2011 Opponent Att. Yards Avg. TD LongWestern Michigan 11 80 7.3 2 43 Notre Dame - - - - - Eastern Michigan 11 46 4.2 1 12 San Diego State 13 67 5.2 0 11 Minnesota 11 108 9.8 1 35 at Northwestern 14 25 1.8 0 7 At Michigan State 2 7 3.5 0 4Purdue 20 170 8.5 2 59at Iowa 16 58 3.6 0 11at Illinois 27 192 7.1 1 65Nebraska 29 138 4.8 2 31Ohio State 20 120 6.0 0 26Season Total 174 1011 5.8 9 65
Fitzgerald Toussaint’s Career Receiving StatisticsYear GP/GS No. Yards Avg. Per/Game TD Long2010 4/1 1 5 5.0 1.3 0 52011 11/10 5 14 2.8 1.3 1 7Career 15/11 6 19 3.2 1.3 1 7
Toussaint’s Career Bests:RushingAttempts: 29, vs. Nebraska (Nov. 19, 2011)Yards: 192, at Illinois (Nov. 12, 2011)Touchdowns: 2, three times (last vs. Nebraska, Nov. 19, 2011)Long: 65, at Illinois (Nov. 12, 2011)
ReceivingReceptions: 2, vs. Nebraska (Nov. 19, 2011)Yards: 5, twice (last at Iowa, Nov. 5, 2011)Touchdowns: 1, at Iowa (Nov. 5, 2011)Long: 7, vs. Nebraska (Nov. 19, 2011)
Kick ReturnsAttempts: 1, vs. Mississippi State (Jan. 1, 2011)Yards: 28, vs. Mississippi State (Jan. 1, 2011)Touchdowns: NoneLong: 28, vs. Mississippi State (Jan, 1, 2011)
ryaN vaN BergeN ***#53 • Defensive End6-6 • 288 • 5th-Sr.Whitehall, Mich.Whitehall HS
At Michigan ...three-year letterman ... played in 49 contests and made 37 starts along defensive line ... started 17 games at defensive tackle and 20 contests at defensive end ... surpassed 100 career tackles against San Diego State (Sept. 24, 2011).
Fifth-Year Senior (2011)... All-Big Ten honorable men-tion (coaches and media) ... named to the Ted Hendricks Award preseason watch list ... played in all 12 games; started 11 games on defensive line (Western Michigan, Notre Dame, Eastern Michigan, San Diego State, Minnesota, Northwestern, Michigan State, Iowa, Illinois, Nebraska, Ohio State), contributing on special teams in 10 games ... led the team with 12 TFLs and five sacks ... had second-most fumble recoveries on the team with three ... OHIO STATE (Nov. 26) ... posted career-best-matching seven tackles, including two for a loss, an assisted sack and a pass breakup ... finished with nine TFLs in his last five regular-season games ... NEBRASKA (Nov. 19) ... recorded two tackles -- both for a loss -- and a sack to go along with fourth career fumble recovery and a PBU ... ILLINOIS (Nov. 12) ... matched a career high with seven tackles and three TFLs ... set new career best with 2.5 sacks ... named the Big Ten Co-Defensive Player of the Week ... named the CFPA National Defensive Performer of the Week and National Defensive Lineman of the Week ... IOWA (Nov. 5) ... tallied two solo tackles, including a tackle for a loss of three yards ... NORTHWESTERN (Oct. 8). ... made pass break-up and three tackles ... MINNESOTA (Oct. 1) ... recorded one sack for four yards ... SAN DIEGO STATE (Sept. 24) ... notched first forced fumble of career, also had a tackle-for-loss and a pass breakup ... NOTRE DAME (Sept. 10) ... made one tackle-for-loss and recovered a fumble ... WESTERN MICHIGAN (Sept. 3) ... recovered a fumble.
Senior/Junior (2010) ... earned third varsity letter ... started all 13 games at defensive end ... recorded 37 tackles, 8.5 TFLs, four sacks and one pass breakup ... contributed four tackles vs. Connecticut (Sept. 4) ... assisted on two stops and batted down one pass at Notre Dame (Sept. 11) ... assisted tackle for loss vs. Massachusetts (Sept. 18) ... earned his first sack of the season in start vs. Bowling Green (Sept. 25) ... had one tackle for a loss of two yards in start at Indiana (Oct. 2) ... recorded one sack for a loss of 12 yards in start vs. Michigan State (Oct. 9) ... tallied two stops in start vs. Iowa (Oct. 16) ... registered a season-high six tackles at Penn State (Oct. 30) ... assisted on two tackles in start vs. Illinois (Nov. 6) ... posted four solo tackles, including two tackles for loss and one sack in start against Purdue (Nov. 13) ... assisted on a tackle in start vs. Wisconsin (Nov. 20) ... notched five solo tackles, including career-high three tackles for loss, and a sack in start at Ohio State (Nov. 27) ... career-high seven tackles in start at defen-sived end vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... earned second varsity letter ... started all 12 games at defensive tackle ... recorded 40 tackles, 6.5 tackles for loss, five sacks, one fumble recovery and four pass breakups ... scored first career touchdown on a 14-yard fumble return for a score at Wisconsin (Nov. 14) ... made second career start at defensive tackle vs. Western Michigan (Sept. 5), recording two tackles and first career assisted sack ... posted two tackles vs. Notre Dame (Sept. 12) ... tallied four tackles, including one for a loss, vs. Eastern Michigan (Sept. 19) ... recorded a career-high six tackles, including his first solo sack, and broke up two passes vs. Indiana (Sept. 26) ... his sack resulted in a loss of 12 yards and forced IU to punt which led to U-M’s game-winning scoring drive ... posted five tackles and one sack At Michigan State (Oct. 3) ... matched career high with six stops and an assisted TFL at Iowa (Oct. 10) ... recorded one solo tackle vs. Delaware State (Oct. 17) ... made three tackles and assisted on a sack against Penn State (Oct. 24) ... posted three tackles and one sack at Illinois (Oct. 31) ... totaled five stops, one sack and one pass PBU vs. Purdue (Nov. 7) ... returned a fumble 14 yards for his first career touchdown at Wisconsin (Nov. 14) ... added one solo stop against the Badgers ... contributed two tackles vs. Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... earned first varsity let-ter ... recipient of U-M’s John F. Maulbetsch Award as the distinguished freshman athlete given on the basis of desire, character, capacity for leadership and potential for future success following spring drills ... played in all 12 games and made one start at defensive end ... posted 13 tackles and one pass breakup ... recorded one tackle and contributed on special teams vs. Utah (Aug. 30), his first collegiate action ... posted two tackles vs. Miami (Sept. 6) ... assisted on two tackles at Notre Dame (Sept. 13) ... contributed on defense and special teams vs. Wisconsin (Sept. 27) ... posted one stop from defensive end vs. Illinois (Oct. 4) ... three tackles in first career start vs. Toledo (Oct. 11) ... played defensive end and special teams at Penn State (Oct. 18) ... recorded first career pass breakup vs. Michigan State (Oct. 25) ... recorded one stop at defensive end and contributed on special teams at Purdue (Nov. 1) ... played defensive end and special teams at Minnesota (Nov. 8) ... recorded one solo stop vs. Northwestern (Nov. 15) ... two tackles at Ohio State (Nov. 22).
Freshman (2007) ... did not see game action.
Prep ... attended Whitehall Senior High School (2006) coached by Andy Malbouef ... National Football Foundation and College Hall of Fame Scholar-Athlete ... National Honor Society member ... All-West Michigan Conference Academic Award winner ... Fox/McDonald’s Scholar-Athlete ... earned 11 varsity letters ... Key Statistics ... posted 199 tackles, 11 sacks, 44.5 tackles for loss, three forced fumbles, four fumble recoveries and four interceptions during his career ... recorded seven career carries for 36 yards and a touchdown ... made 58 receptions for 932 yards and scored seven receiv-ing TDs in his career ... collected 76 tackles, four sacks and 11 TFLs as a senior ... blocked three punts, kicked three field goals and had 19 receptions for 258 yards and three TDs as a senior ... racked up 65 solo tackles as a junior, including 32 TFLs, seven sacks and four interceptions ... posted 20 catches for 275 yards and four TDs from the tight end position junior year ... tallied 74 stops as a sophomore, including 19 TFLs, three interceptions and forced one fumble ... Honors and Rankings ... listed as an All-American by PrepStar Magazine ... ranked the No. 8 defensive end in the country and a four-star prospect by Scout.com ... four-star prospect, the No. 17 strongside defensive end nationally and the No. 11 player in Michigan by Rivals.com ... listed as the No. 7 recruit in the state of Michigan by the Detroit Free Press ... listed No. 22 on Detroit Free Press Best of the Midwest list ... named to The Detroit News “Dream Team” and Associated Press All-State team following senior season ... All-West Michigan Conference first team at defensive end and tight end as a junior and senior ... first-team all-area junior and senior
years ... selected to participate in Michigan East vs. West All-Star game ... Detroit Athletic Club 2007 Michigan High School Male Athlete of the Year ... Whitehall High School and Muskegon Area Hall of Fame Male Athlete of the Year as a senior ... Other Sports ... lettered in track and basketball ... captain and MVP of the basketball team as a junior and senior ... averaged 15 points and 13.5 rebounds per game as a junior ... all-area and all-conference in basketball as a junior and senior ... Detroit Free Press All-State honorable mention senior year ... set school record in the discus with a throw of 163 feet ... regional discus champion junior and senior year.
Personal ... Ryan Charles Van Bergen was born March 18, 1989 in Las Vegas, Nev. ... attended the 2005 and 2006 Michigan Summer Football Camps ... enrolled in the College of Literature, Science and the Arts, majoring in sociology.
Ryan Van Bergen’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2008 12/1 8-5-13 0-0 0-0 0-0 0-0 12009 12/12 20-20-40 6.5-44 5-40 0-0 1-14 42010 13/13 21-16-37 8.5-43 4-35 0-0 0-0 12011 12/11 24-17-41 12-54 5-34 0-0 3-0 4Career 49/37 73-58-131 27-141 14-109 0-0 4-14 10
Ryan Van Bergen’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 1-2-3 0-0 0-0 0-0 1-0 0Notre Dame 2-0-2 1-2 0-0 0-0 1-0 0Eastern Michigan 0-4-4 0-0 0-0 0-0 0-0 0San Diego State 2-0-2 1-5 0-0 0-0 0-0 1Minnesota 1-1-2 1-4 1-4 0-0 0-0 0at Northwestern 2-1-3 0-0 0-0 0-0 0-0 1At Michigan State 1-2-3 0-0 0-0 0-0 0-0 0Purdue 2-2-4 1-3 0-0 0-0 0-0 0at Iowa 2-0-2 1-3 0-0 0-0 0-0 0at Illinois 4-3-7 3-28 2.5-27 0-0 0-0 0Nebraska 2-0-2 2-4 1-2 0-0 1-0 1Ohio State 5-2-7 2-5 0.5-1 0-0 0-0 1Season Totals 24-17-41 12-54 5-34 0-0 3-0 4
Van Bergen’s Career BestsTackles: 7, three times (last vs. Ohio State, Nov. 26, 2011)Solos: 5, three times (last vs. Ohio State, Nov. 26, 2011)Asst: 5, vs. Indiana (Sept. 26, 2009)TFLs: 3, twice (last at Illinois, Nov. 12, 2011)Sacks: 2.5, at Illinois (Nov. 12, 2011)Int.: NoneFR: 1, four times (last vs. Nebraska, Nov. 19, 2011)PBUs: 2, vs. Indiana (Sept. 26, 2009)
Jared vaN slyke *#31 • Safety6-2 • 195 • 5th-Sr.St. Louis, Mo.John Burroughs HS
Prior to Michigan ... attended Southeast Missouri State University (2007-08).
Fifth-Year Senior (2011)... appeared in 11 games; six as a reserve safety and 11 on special teams ... PURDUE (Oct. 29) ... served as the honorary senior game captain.
Senior/Junior (2010) ... did not see game action due to a clavicle injury.
Junior/Sophomore (2009) ... earned first varsity letter ... played in nine games ... contributed two special teams tackles ... did not see game action vs. Western Michigan (Sept. 5) ... made career debut on the final defensive play of the game vs. Notre Dame (Sept. 12) ... saw action on special teams vs. Eastern Michigan (Sept. 19) and Indiana (Sept. 26)
... contributed one special teams tackle At Michigan State (Oct. 3) ... did not see game action at Iowa (Oct. 10) ... posted one tackle from safety position and on special teams vs. Delaware State (Oct. 17) ... did not see game action vs. Penn State (Oct. 24) ... played on special teams at Illinois (Oct. 31) and against Purdue (Nov. 7) ... saw action on punt return unit at Wisconsin (Nov. 14) and against Ohio State (Nov. 21).
Sophomore/Freshman (2008) ... did not see game action.
Prep ... attended John Burroughs High School (2007) ... Key Statistics ... had the highest completion percentage and highest quarterback rating in the state of Missouri as a junior ... Honors and Rankings ... all-state as a senior ... three-time all-conference first team selection ... St. Louis Post Dispatch Top 30 recruit ... named conference player of the year as a senior ... Other Sports ... three-time all-conference first team in basketball and baseball ... collected all-state accolades in baseball senior year ... all-state honorable mention in basketball as a senior.
Personal ... Jared Michael Van Slyke was born Jan. 6, 1989 ... father, Andy, was the first base coach for Detroit Tigers and a Major League Baseball player with the St. Louis Cardinals, Pittsburgh Pirates, Baltimore Orioles and Philadelphia Phillies ... father was a three-time MLB All-Star and five-time Gold Glove Award winner ... brother, A.J., played baseball at the University of Kansas and was drafted by the St. Louis Cardinals (2005) ... brother, Scott, was drafted by the Los Angeles Dodgers in 2005 ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Jared Van Syke’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2009 9/0 2-0-2 0-0 0-0 0-0 0-0 02010 0/0 0-0-0 0-0 0-0 0-0 0-0 02011 11/0 1-1-2 0-0 0-0 0-0 0-0 1Career 20/0 3-1-4 0-0 0-0 0-0 0-0 1
QuiNtoN WashiNgtoN *#76 • Defensive Tackle 6-4 • 302 • Jr.-So.St. Stephen, S.C.Timberland HS
Junior/Sophomore (2011)... saw action in nine games; played in six games as a defensive reserve and eight games on special teams.
Sophomore/Freshman (2010) ... earned first varsity letter ... appeared in all 13 contests ... made two assisted tackles after moving from offensive line to defensive line prior to Penn State game (Oct. 30) ... made career debut on field goal/PAT protection unit vs. Connecticut (Sept. 4) ... played on field goal/PAT protection unit at Notre Dame (Sept. 11) ... saw action at H-back in goal line package against the Irish ... appeared on special teams vs. Massachusetts (Sept. 18) ... saw first game action at right guard and contributed on special teams vs. Bowling Green (Sept. 25) ... played on PAT protection unit at Indiana (Oct. 2) ... appeared on field goal/PAT protection units vs. Michigan State (Oct. 9) and Iowa (Oct. 16) ... made first career appearance at nose tackle against the Nittany Lions, recording his first career tackle ... contributed on special teams units at PSU ... appeared as a reserve nose tackle in goal line situations and on field goal/PAT protection units vs. Illinois (Nov. 6) ... played on the field goal/PAT protection units against Purdue (Nov. 13) ... played as a backup nose tackle and contributed on special teams vs. Wisconsin (Nov. 20) ... substituted in at defensive tackle and assisted on a tackle against Ohio State (Nov. 27) ... contributed on field goal/PAT protection units against the Buckeyes ... appeared as a reserve nose tackle and on special teams units vs. Mississippi State (Jan. 1) in the Gator Bowl.
Freshman (2009) ... redshirted ... did not see game action.
Prep ... attended Timberland High School (2009) coached by Art Craig ... registered 375-pound maximum on bench press and 565-pound squat max ... Honors and Rankings ... Prep Star All-American and named to the publication’s Top 250 ... nation’s No. 6 offensive guard according to Scouts, Inc. ... No. 82 overall prospect nationally by Scouts, Inc. ... four-star pros-pect according to Rivals.com ... rated as the eighth-best guard prospect by Rivals.com ... listed as the 10th-best performer in the state of South Carolina and the 213th overall player nationally according to Rivals.com ... three-star performer and the nation’s No. 19 offensive guard by scout.com ... listed as the No. 14 player in the state of South Carolina by SuperPrep ... ranked as sixth-best offensive guard in the country and the No. 82 prospect overall by ESPN.com ... first-team all-state offensive lineman as a senior ... selected to Orlando Sentinel All-Southern team and Mobile Press Register’s Super Southeast 120 ... participant in the North Carolina-South Carolina Shrine Bowl and the Under Armour All-American game ... runner-up for Mr. Football in the state of South Carolina as a senior ... selected as the Lineman of the Year in the state of South Carolina senior year ... Other Sports ... lettered in track and field ... participated in shot put and discus.
Personal ... Quinton Arthur Washington was born July 16, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Quinton Washington’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2010 13/0 0-2-2 0-0 0-0 0-0 0-0 02011 9/0 1-0-1 0-0 0-0 0-0 0-0 0Career 22/0 1-2-3 0-0 0-0 0-0 0-0 0
steve WatsoN ***#84 • Tight End6-4 • 255 • 5th-Sr.Cherry Hills Village, Colo.Mullen HS
At Michigan ... three-year letterman ... appeared in 28 career contests and made four starts at tight end ... recorded eight tackles, one TFL and one pass breakup ... switched from tight end to defensive end prior to spring drills in 2009 ... switched back to tight end from defensive end prior to the 2011 sea-son ... special teams contributor.
Fifth-Year Senior (2011)... played in all 12 games; appeared in three games as a fullback and nine other games as a tight end, including four starts (Northwestern, Michigan State, Iowa, Nebraska); contributed on special teams in 12 games ... NORTHWESTERN (Oct. 8) ... made first career start ... first career reception was a nine-yard touchdown.
Senior/Junior (2010) ... earned third varsity letter ... appeared in six contests ... made season debut on special teams vs. Bowling Green (Sept. 25) ... saw game action as a reserve at defensive tackle vs. Michigan State (Oct. 9) ... substituted in at defensive end vs. Iowa (Oct. 16) and at Penn State (Oct. 30) ... did not see game action vs. Illinois (Nov. 6) and at Purdue (Nov. 13) and vs. Wisconsin (Nov. 20) ... returned to action as a backup defensive end against Ohio State (Nov. 27) ... recorded three tackles as a reserve defensive end vs. Mississippi State (Jan. 1) in the Gator Bowl.
Junior/Sophomore (2009) ... earned second varsity letter ... played in six games ... appeared at linebacker and played on special teams vs. Western Michigan (Sept. 5) ... contributed on special teams against Notre Dame (Sept. 12), Eastern Michigan (Sept. 19) and Indiana (Sept. 26) ... did not see game action in road games At Michigan State (Oct. 3) or Iowa (Oct. 10) ... appeared at outside linebacker and special
teams vs. Delaware State (Oct. 17), recording first career tackles (two) and one PBU ... did not play vs. Penn State (Oct. 24) ... made a career-high three tackles, including one TFL, at outside linebacker against Illinois (Oct. 31) ... did not see game action in final three games.
Sophomore/Freshman (2008) ... earned first varsity letter ... played on special teams units in four games ... made col-legiate debut on special teams at Purdue (Nov. 1) ... played special teams at Minnesota (Nov. 8) and vs. Northwestern (Nov. 15) ... contributed on special teams at Ohio State (Nov. 22).Freshman (2007) ... did not see game action.
Prep ... attended Mullen High School (2006) coached by Det Betti ... named team captain as a senior ... Key Statistics ... collected 59 catches for 720 yards and scored 10 receiving touchdowns during career ... recorded 15 career tackles and three sacks as a defensive end ... caught 28 balls for 428 yards and seven TDs as a senior ... made 16 receptions for 131 yards and a touchdown during junior season ... tallied 15 catches for 161 yards as a sophomore ... Honors and Rankings ... PrepStar Magazine All-American ... three-star prospect, the No. 19 tight end in the country and the No. 5 player in the state of Colorado by Rivals.com ... four-star recruit and the No. 15 tight end in the country according to Scout.com ... rated No. 17 tight end in the nation in the Velocity-PrepStar Top 250 ... named first-team All-Centennial Conference as a tight end following senior season ... selected as the top tight end in Class 5A by the Rocky Mountain News ... named to All-Colorado team by the Denver Post and first-team all-state by the Rocky Mountain News ... all-league at tight end as a junior and second-team as a sophomore ... honorable mention all-state as a junior.
Personal ... Stephen Ross Watson was born May 5, 1988 in Denver, Colo. ... father, Steve Sr., was a Pro Bowl receiver for the Broncos (1979-87) ... father played collegiately at Temple University (1975-78) ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
matt Wile#45 • Kicker6-2 • 208 • Fr.San Diego, Calif.Francis W. Parker HS
Freshman (2011) ... appeared in 12 games; kicked off in all 12 games and punted in first four games ... kicked off 75 times with 64.0 yards/kick average, 19 touchbacks ... ILLINOIS (Nov. 12) ... recorded career-best five touchbacks on six kickoffs ... named the CFPA Kickoff Specialist of the Week ... SAN DIEGO STATE (Sept. 24) ... career-best 49.0 yards/punt aver-age on four attempts; two 50+ yards, including ca-reer-high 51 yarder; two inside-20 punts ... WESTERN MICHIGAN (Sept. 3) ... made career debut as special-ist on kickoffs and punts.
Prep ... attended Francis W. Parker High School (2011) coached by John Morrison ... Key Statistics ... made 10-of-13 field goals with a long of 49 yards and also had 91 of his 101 kickoffs go for touch-backs during his senior season ... punted six times for an average of 41 yards and pinned the East team inside their own 20-yard line twice during the U.S. Army All-American Game ... converted 9-of-12 field goals with a long of 48 yards as a junior ... averaged a touchback on 89.9 percent of his kickoffs junior year ... Honors and Rankings ... rated as the nation’s fourth-best kicker by Scout.com ... listed as the No. 44 kicker nationally by ESPN.com ... two-star pros-pect according to Rivals.com ... named to the Max-
Preps.com Small Schools All-American Team as a junior and to the services Sophomore All-American Team.
Personal ... Matthew Wile was born June 20, 1992 ... his father, grandfather, great-grandfather and great-great-grandfather all attended U-M Medical School ... father, Dr. Peter Wile, is the team physician for the San Diego State Aztecs ... enrolled in the College of Engineering, major undeclared.
Matt Wile’s Career Punting StatisticsYear GP No. Yards Avg. Long 50+ I202011 4 14 576 41.1 51 2 4Career 4 14 576 41.1 51 2 4
Matt Wile’s Game-by-Game Punting Statistics2011 No. Yards Avg. Lg 50+ 20-10-5 YLWestern Michigan 2 82 41.0 47 0 1-0-0 13Notre Dame 5 193 38.6 47 0 1-0-0 14Eastern Michigan 3 105 35.0 41 0 0-0-0 0San Diego State 4 196 49.0 51 2 2-0-0 17Minnesota - - - - - - -at Northwestern - - - - - - -At Michigan State - - - - - - -Purdue - - - - - - -at Iowa - - - - - - -at Illinois - - - - - - -Nebraska - - - - - - -Ohio State - - - - - - -Season Totals 14 576 41.1 51 2 4-0-0 0
keNNy WilkiNs#41 • Defensive Tackle6-3 • 280 • So.-Fr.Washington, Pa.Trinity HS
Sophomore/Freshman (2011) ... did not see game action.
Freshman (2010) ... did not see game action ... redshirted.
Prep ... attended Trinity High School (2010) coached by Ed Dalton ... ran 40-yard dash in 4.61 seconds and had 31-inch vertical leap ... bench pressed 385 pounds and squatted 375 pounds ... Key Statistics ... recorded 59 tackles, 6.5 sacks, two fumble recoveries during injury-shortened senior season ... 89 tackles, 12 sacks, two fumbles caused and two fumbles recovered for touchdowns as a junior ... posted 48 tackles as a sophomore ... Honors and Rankings ... four-star and the No. 9 prospect in state of Pennsylvania according to Rivals.com ... listed as 15th-best weakside defensive end by Rivals.com ... three-star prospect and No. 68 defensive end nationally according to scout.com ... three-star and nation’s No. 41 out-side linebacker according to Scouts, Inc. ... WPIAL first-team all-state as junior and honorable mention as senior ... first-team all-conference junior and senior seasons ... all-conference, all-county and Washington Elite 11 accolades as a junior.
Personal ... Kenneth Leslie Wilkins was born Feb. 20, 1992 ... cousin, Travis Thomas, was Notre Dame team captain in 2006 ... cousin, Bryan Thomas, plays at Bowling Green ... enrolled in the College of Literature, Science and the Arts, major undeclared.
steve WilsoN#4 • Quarterback5-11 • 180 • Sr.-Jr.White Lake, Mich.Lakeland HS
Senior/Junior (2011) ... did not see game action.
Prep … attended Lakeland H.S. (2008) … Class Valedictorian … National Honor Society … Scholar-Athlete ... two-year varsity letterman … first-team all-conference selection as a senior … All-Oakland County honorable mention as a senior … All-State Academic Team as a senior … also lettered three times in track and field and twice in basketball.
Personal ... Steven James Wilson was born October 8, 1990 ... enrolled in the College of Literature, Science and the Arts, majoring in cellular and molecular biology with a minor in German studies.
troy WoolFolk ***#29 • Cornerback6-0 • 191 • 5th-Sr.Sugar Land, TexasDulles HS
At Michigan ... three-year letterman ... returning starter in the secondary ... played in 44 career games and made 23 starts ... recorded 90 tackles and five pass breakups during his career ... special teams contributor.
Fifth-Year Senior (2011) ... appeared in all 12 games; played seven at cornerback, starting six of them (Western Michigan, Eastern Michigan, San Diego State, Minnesota, Northwestern, Michigan State), and five at safety, starting four (Purdue, Iowa, Illinois, Ohio State); played all 12 on spe-cial teams ... IOWA (Nov. 5) ... totaled six tackles, including a career-best five assisted stops, as starting safety ... EASTERN MICHIGAN (Sept. 17) ... served as the honorary senior game captain in start at cornerback.
Senior (2010) ... redshirted ... suffered season-ending ankle injury during fall camp.
Junior (2009) ... earned third varsity letter ... started all 12 games in the secondary ... made six starts at safety and six at cornerback ... career-best 46 tackles and one pass breakup ... made first career start at safety and assisted on special teams vs. Western Michigan (Sept. 5) ... recorded four tackles against the Broncos ... career-high eight tackles from safety position vs. Notre Dame (Sept. 12) ... made four tackles at safety vs. Eastern Michigan (Sept. 19) ... registered two tackles at safety vs. Indiana (Sept. 26) ... contributed five tackles At Michigan State (Oct. 3) ... started at cornerback against Iowa (Oct. 10), his first career start at that position ... posted four tackles and one PBU against the Hawkeyes ... posted one stop at cornerback vs. Delaware State (Oct. 17) ... made one solo tackle at cornerback vs. Penn State (Oct. 24) ... recorded two tackles against Illinois (Oct. 31) ... earned starting assignment at cornerback vs. Purdue (Nov. 7) ... contributed three tackles from cornerback spot at Wisconsin (Nov. 14) ... returned to starting safety position and made seven stops vs. Ohio State (Nov. 21).
Sophomore (2008) ... earned second varsity letter ... played in all 12 games ... second on the team with 10 special teams tackles ... played cornerback and special teams vs. Utah (Aug. 30), tallying one stop ... assisted on two special teams tackles vs. Miami (Sept. 6) ... recorded one special teams stop at Notre Dame (Sept. 13) ... one special teams stop vs. Wisconsin (Sept. 27) ... one tackle on special teams vs. Illinois (Oct. 4) ... posted one special teams tackle vs. Toledo (Oct.
11) ... earned one special teams stop at Penn State (Oct. 18) ... played cornerback and special teams vs. Michigan State (Oct. 25) ... contributed on special teams at Purdue (Nov. 1) and at Minnesota (Nov. 8) ... posted two solo tackles against Gophers ... played cornerback in nickel package and saw special teams action vs. Northwestern (Nov. 15) ... contrib-uted on special teams at Ohio State (Nov. 22).
Outdoor Track (2007-08) ... U.S. Track & Field and Cross Country Coaches Association All-Region team for perfor-mance with 4x100-meter relay ... member of 4x100-meter relay team that placed fifth (40.06) at the NCAA Mideast Regional ... member of outdoor Big Ten champion team ... helped claim conference title with a sixth-place finish in the 100m dash, logging Personal best time of 10.58 ... ran opening leg for 4x100-meter relay team that claimed conference crown.
Freshman (2007) ... earned first varsity letter ... played in eight games ... registered five tackles and two pass breakups ... played on special teams units vs. Appalachian State (Sept. 1), Oregon (Sept. 8), Notre Dame (Sept. 15), Penn State (Sept. 22) and Northwestern (Sept. 29) ... made career debut against the Mountaineers ... played special teams and as reserve cornerback vs. Eastern Michigan (Oct. 6), had one solo tackle and two pass breakups ... career-high four stops vs. Purdue (Oct. 13), playing cornerback and special teams ... did not play against Illinois (Oct. 20), Minnesota (Oct. 27) or Michigan State (Nov. 3) ... played on special teams at Wisconsin (Nov. 10) ... did not see game action vs. Ohio State (Nov. 17) or against Florida in Capital One Bowl (Jan. 1).
Prep ... attended Dulles High School (2006) coached by Jim Creech ... Key Statistics ... posted 81 tackles, 11 interceptions and four pass breakups during career ... tallied 43 tackles, four pass breakups and five interceptions as a senior ... Honors and Rankings ... three-star prospect and the No. 44 cornerback prospect according to Scout.com and Rivals.com ... No. 95 player in the state of Texas according to Rivals.com ... All-Region by PrepStar Magazine ... all-conference as a senior ... Touchdown Club finalist for the Defensive Player of the Year ... rated among the Houston Chronicle’s top 100 players in the state ... all-district as a junior and senior ... Other Sports ... four-year track letterman ... 200m district champion as senior ... 100m, 200m, 800m relay district champion as a junior ... qualified for state meet as junior and senior.
Personal ... Troy Dion Woolfolk was born July 24, 1989 in Sugar Land, Texas ... son of U-M All-American tailback Butch Woolfolk (1978-81) ... father played professionally for Houston Oilers, Detroit Lions, N.Y. Giants ... from same high school as Brandon Herron and Darryl Stonum ... attended 2006 Michigan Summer Football Camp ... enrolled in the College of Literature, Science and the Arts, majoring in general studies.
Troy Woolfolk’s Career Defensive StatisticsYear GP/GS S-A-TT TFL Sacks Int. FR PBU2007 8/0 3-2-5 0-0 0-0 0-0 0-0 22008 12/0 7-2-10 0-0 0-0 0-0 0-0 02009 12/12 30-16-46 0-0 0-0 0-0 0-0 12010 0/0 0-0-0 0-0 0-0 0-0 0-0 02011 12/10 16-13-29 0-0 0-0 0-0 0-0 2Career 44/22 56-33-90 0-0 0-0 0-0 0-0 5
Troy Woolfolk’s Game-by-Game Defensive Statistics2011 Opponent S-A-TT TFL Sacks Int. FR PBUWestern Michigan 2-0-2 0-0 0-0 0-0 0-0 0Notre Dame 3-0-3 0-0 0-0 0-0 0-0 0Eastern Michigan 0-0-0 0-0 0-0 0-0 0-0 0San Diego State 3-2-5 0-0 0-0 0-0 0-0 0Minnesota 1-0-1 0-0 0-0 0-0 0-0 0at Northwestern 0-0-0 0-0 0-0 0-0 0-0 1At Michigan State 2-0-2 0-0 0-0 0-0 0-0 0Purdue 1-3-4 0-0 0-0 0-0 0-0 0
at Iowa 1-5-6 0-0 0-0 0-0 0-0 0at Illinois 2-1-3 0-0 0-0 0-0 0-0 0Nebraska 0-1-1 0-0 0-0 0-0 0-0 1Ohio State 1-1-2 0-0 0-0 0-0 0-0 0Season Totals 16-13-29 0-0 0-0 0-0 0-0 2
Woolfolk’s Career Bests:Tackles: 8, vs. Notre Dame (Sept. 12, 2009)Solos: 5, twice (last vs. Ohio State, Nov. 21, 2009)Assists: 5, at Iowa (Nov. 5, 2011)TFLs: NoneSacks: NoneInt.: NoneFR: NonePBUs: 2, vs. Eastern Michigan (Oct. 6, 2008)
charlie zeller#19 • Safety5-11 • 194 • Jr.-So.Centennial, Colo.Cherry Creek HS
Junior/Sophomore (2011) ... did not see game action.
Prep … attended Cherry Creek High School (2009) … three-time Academic All-State … Honor Athlete, given to student athlete who best exemplifies excellence in the classroom and on the field … National Honor Society member … Excalibur Men’s Service Club … three-year varsity letterman … two-time all-conference … helped Cherry Creek to state championship game as a senior … recorded 209 tackles, four interceptions and one sack in last two seasons … also recorded 35 receptions for 436 yards and four touchdowns … lettered three years in varsity basketball.
Personal ... Charles William Zeller was born November 14, 1990 ... son of Warren and Bonnie Zeller ... mother, Bonnie, played tennis at the University of Colorado (1977-80) ... sis-ter, Brooke, ran cross country at Wheaton College (2006-09) ... brother, Jeff, played tennis at Stanford (2006-2009) ... en-rolled in the Stephen M. Ross School of Business, majoring in business administration.
Record Book(Through November 27, 2011)
RUSHING RECORDS
Rushing
Ron Johnson Tshimanga Biakabutuka Mike Hart
Game1. Chris Perry ...............................................51 at Michigan State, Nov. 1, 20032. Mike Hart .................................................44 Penn State, Sept. 22, 20073. Ron Johnson ...........................................42 Northwestern, Oc.t 4, 1967 Anthony Thomas ...................................42 at Indiana, Oct. 30, 19995. Mike Hart .................................................40 at Illinois, Oct. 16, 20046. Butch Woolfolk .......................................39 at Michigan State, Oct. 10, 1981
Rushing Attempts
Season1. Chris Perry 338 20032. Anthony Thomas 319 20003. Mike Hart 318 20064. T. Biakabutuka 303 19955. Anthony Thomas 301 19996. Jamie Morris 282 1987
Mike Hart 282 20048. Gordon Bell 273 19759. Chris Perry 267 2002
10. Lawrence Ricks 266 198211. Mike Hart 265 200712. Tony Boles 262 198813. Denard Robinson 256 2010 14. Ron Johnson 255 1968 15. Butch Woolfolk 253 1981
Career1. Mike Hart 1,015 2004-07
2. Anthony Thomas 924 1997-00 3. Chris Perry 811 2000-03 4. Jamie Morris 809 1984-87 5. Butch Woolfolk 718 1978-81 6. Tyrone Wheatley 688 1991-94 7. Billy Taylor 587 1969-71 8. Rob Lytle 557 1973-76 9. Lawrence Ricks 541 1979-82 10. Gordon Bell 535 1973-7511. Denard Robinson 533 2009- 12. Ed Shuttlesworth 532 1971-73 13. Ricky Powers 526 1990-93 14. Russell Davis 523 1975-78 15. Harlan Huckleby 500 1975-78
Game1. Ron Johnson ........................................ 347 Wisconsin, Nov. 16, 19682. Tshimanga Biakabutuka .................. 313 Ohio State, Nov. 25, 19953. Jon Vaughn .......................................... 288 UCLA, Sept. 22, 19904. Ron Johnson ........................................ 270 Navy, Oct. 7, 19675. Denard Robinson .......................258 at Notre Dame, Sept. 11, 2010
Rushing Yards
Season1. T. Biakabutuka 1,818 19952. Anthony Thomas 1,733 20003. Jamie Morris 1,703 19874. Denard Robinson 1,702 2010
5. Chris Perry 1,674 20036. Mike Hart 1,562 20067. Rob Lytle 1,469 19768. Butch Woolfolk 1,459 19819. Mike Hart 1,455 2004
10. Tony Boles 1,408 198811. Ron Johnson 1,391 196812. Gordon Bell 1,388 197513. Lawrence Ricks 1,388 198214. Jon Vaughn 1,364 199015. Mike Hart 1,361 200716. Tyrone Wheatley 1,357 199217. Billy Taylor 1,297 1981 Anthony Thomas 1,297 199919. Ricky Powers 1,197 199120. Denard Robinson 1,163 2011
Career1. Mike Hart 5,040 2004-07
2. Anthony Thomas 4,472 1997-00 3. Jamie Morris 4,393 1984-87 4. Tyrone Wheatley 4,178 1991-94 5. Butch Woolfolk 3,861 1978-81 6. Chris Perry 3,696 2000-03 7. Rob Lytle 3,317 1973-76 8. Denard Robinson 3,216 2009- 9. Billy Taylor 3,072 1969-7110. Gordon Bell 2,900 1973-75 11. T. Biakabutuka 2,810 1993-9512. Lawrence Ricks 2,751 1979-82 13. Harlan Huckleby 2,624 1975-78 14. Ricky Powers 2,554 1990-93 15. Russell Davis 2,550 1975-7816. Ron Johnson 2,440 1966-6817. Ed Shuttlesworth 2,343 1971-73 18. Tony Boles 2,247 1987-89 19. Stan Edwards 2,206 1977-81 20. Rick Leach 2,176 1975-78
Average Gain Per RushGame (Min. 5 carries)
1. Leroy Hoard.......................................18.28Indiana, Oct. 22, 1988
2. Tom Harmon .....................................18.14 at Chicago, Oct. 21, 19393. Rob Lytle ............................................18.00 Michigan State, Oct. 9, 19764. Tony Boles ..........................................17.90 at Wisconsin, Oct. 1, 19885. Russell Davis .....................................16.57 Stanford, Sept. 18, 1976
Game (Min. 10 carries)1. Rob Lytle ............................................18.00
Michigan State, Oct. 9, 19762. Tony Boles ..........................................17.90
at Wisconsin, Oct. 1, 19883. Tyrone Wheatley .............................15.70 vs. Washington, Jan. 1, 19934. Billy Taylor ..........................................15.60 Indiana, Oct. 30, 19715. Anthony Thomas .............................14.08 at Hawaii, Nov. 28, 1998
Game (Min. 15 carries)1. Tyrone Wheatley .............................15.70 Washington, Jan. 1, 19932. Tyrone Wheatley .............................11.79 Iowa, Oct. 3, 19923. Denard Robinson ............................11.42 at Indiana Oct. 2, 20104. Ron Johnson .....................................11.19 Wisconsin, Nov. 16, 19685. Bob Nussbaumer.............................11.00 Purdue, Oct. 28, 1944
Game (Min. 20 carries)1. Ron Johnson .....................................11.19
Wisconsin, Nov. 16, 19682. Ted Kress ............................................10.90
at Northwestern, Oct. 18, 19523. Billy Taylor ..........................................10.71
at Iowa, Nov. 15, 19694. Chris Perry .........................................10.55 Central Michigan, Aug. 30, 20035. Ron Johnson .....................................10.38 Navy, Oct. 7, 19676. Jamie Morris .....................................10.17 Alabama, Jan. 2, 1988
Season (Min. 75 carries)1. Tyrone Wheatley 7.34 19922. Bill Daley 6.81 19433. Tom Harmon 6.80 19394. Rob Lytle 6.65 19765. Denard Robinson 6.64 2010
6. Steve Smith 6.48 19837. Bob Nussbaumer 6.44 19448. Tony Boles 6.40 19899. Jack Weisenburger 6.39 1947
10. Jon Vaughn 6.31 1990
Career (Min. 200 carries)1. Jon Vaughn 6.29 1989-90
2. Tyrone Wheatley 6.07 1991-94 3. Denard Robinson 6.03 2009- 4. Rob Lytle 5.96 1973-76 5. T. Biakabutuka 5.95 1993-95 6. Bob Nussbaumer 5.75 1943-45 7. Tony Boles 5.70 1987-89 8. Leroy Hoard 5.43 1987-89 9. Jamie Morris 5.43 1984-87 10. Gordon Bell 5.42 1973-75
Game1. Ron Johnson ............................................. 5 Wisconsin, Nov. 16, 19682. Fritz Seyferth............................................. 4 Minnesota, Oct. 24, 1970 Ed Shuttlesworth .................................... 4 Minnesota, Oct. 28, 1972 Rob Lytle .................................................... 4 Indiana, Oct. 25, 1975 Chris Howard ............................................ 4 UCLA, Sept. 28, 1996 Anthony Thomas ..................................... 4 at Hawaii, Nov. 28, 1998
Rushing Touchdowns
Season1. Ron Johnson 19 19682. Anthony Thomas 18 2000
Chris Perry 18 20034. Anthony Thomas 17 19995. Denard Robinson 16 2011
6. Anthony Thomas 15 1998 7. Tom Harmon 14 1940 Rob Lytle 14 1976 Jamie Morris 14 1987 Chris Perry 14 2002 Mike Hart 14 2006 Mike Hart 14 2007 Denard Robinson 14 2010
Career1. Anthony Thomas 55 1997-00
2. Tyrone Wheatley 47 1991-94 3. Mike Hart 41 2004-07 4. Chris Perry 39 2000-03 5. Denard Robinson 35 2009- 6. Rick Leach 34 1975-78 7. Steve Smith 31 1980-83 8. Billy Taylor 30 1969-71 Tom Harmon 30 1938-4010. Butch Woolfolk 29 1978-81 11. Gordon Bell 28 1973-75 12. Ron Johnson 26 1966-68 Ed Shuttlesworth 26 1971-73 Rob Lytle 26 1973-76
RECORD BOOK
Most Games, 100+ YardsSeason
1. Jamie Morris 10 1987 2. Anthony Thomas 9 2000 Mike Hart 9 2006 Mike Hart 9 2007 Denard Robinson 9 2010 6. Gordon Bell 8 1975 Rob Lytle 8 1976 T. Biakabutuka 8 1995 Chris Perry 8 2003 10. Butch Woolfolk 7 1981 Lawrence Ricks 7 1982 Tony Boles 7 1988 Tyrone Wheatley 7 1992 Tyrone Wheatley 7 1993 Anthony Thomas 7 1999
Career1. Mike Hart 28 2004-07
2. Anthony Thomas 22 1997-00 3. Tyrone Wheatley 20 1991-94 4. Jamie Morris 18 1984-87 5. Butch Woolfolk 16 1979-82 6. Rob Lytle 15 1973-76 7. Denard Robinson 14 2009- 8. Billy Taylor 13 1969-71 Gordon Bell 13 1973-75 T. Biakabutuka 13 1993-95
11. Chris Perry 12 2000-03
Most Games, 150+ YardsSeason
1. Anthony Thomas 6 20002. Rob Lytle 5 1976
Jamie Morris 5 1987 Mike Hart 5 20045. Ron Johnson 4 1968
Tony Boles 4 1988 T. Biakabutuka 4 1995 Chris Perry 4 2003 Mike Hart 4 2007 Denard Robinson 4 2010
Career1. Mike Hart 12 2004-07
2. Anthony Thomas 9 1997-00 3. Jamie Morris 8 1984-87 4. Billy Taylor 7 1969-71 Butch Woolfolk 7 1979-82 Tyrone Wheatley 7 1991-94 Denard Robinson 7 2009- 8. Ron Johnson 6 1966-68 Rob Lytle 6 1973-76 10. Tony Boles 5 1987-89 Chris Perry 5 2000-0312. Gordon Bell 4 1973-75 Lawrence Ricks 4 1979-82
T. Biakabutuka 4 1993-95
Most Games, 200+ YardsSeason
1. Mike Hart 3 20042. Tom Harmon 2 1939
Ron Johnson 2 1968 T. Biakabutuka 2 1995 Jon Vaughn 2 1990 Tyrone Wheatley 2 1992 Chris Perry 2 2003 Denard Robinson 2 2010
Career1. Mike Hart 5 2004-07
2. Ron Johnson 3 1966-68 Denard Robinson 3 2009- 4. Tom Harmon 2 1938-40 T. Biakabutuka 2 1993-95 Jon Vaughn 2 1989-90 Tyrone Wheatley 2 1991-94 Jamie Morris 2 1984-87 Chris Perry 2 2000-03
Average Yards Per GameSeason (Min. 6 games)
1. Anthony Thomas 144.4 2000 2. Jamie Morris 141.9 1987 3. T. Biakabutuka 139.8 1995 4. Ron Johnson 139.1 1968 5. Bill Daley 136.2 1943 6. Mike Hart 136.1 2007 7. Denard Robinson 130.9 2010 8. Chris Perry 128.8 2003 9. Tony Boles 128.0 1988 10. Mike Hart 120.2 2006 11. Tyrone Wheatley 123.4 1992 12. Rob Lytle 122.4 1976
Career (Min. 15 games) 1. Mike Hart 117.2 2004-07 2. Billy Taylor 102.4 1969-71 3. Tyrone Wheatley 97.2 1991-94 4. T. Biakabutuka 93.7 1993-95 5. Anthony Thomas 93.2 1997-00 6. Rob Lytle 92.1 1973-76 7. Butch Woolfolk 91.9 1978-81 8. Jamie Morris 91.5 1984-87 9. Ron Johnson 90.3 1966-68 10. Tony Boles 89.9 1987-8911. Tom Harmon 88.9 1938-40
Yards Att. Player Class Opponent Date347 31 Ron Johnson Sr. Wisconsin Nov. 16, 1968313 37 Tim Biakabutuka Jr. Ohio State Nov. 25, 1995288 32 Jon Vaughn So. UCLA Sept. 22, 1990270 26 Ron Johnson Jr. Navy Oct. 7, 1967258 28 Denard Robinson So. at Notre Dame Sept. 11, 2010253 39 Butch Woolfolk Sr. at Michigan State Oct. 10, 1981235 15 Tyrone Wheatley So. Washington Jan. 1, 1993234 23 Jamie Morris Sr. Alabama Jan. 2, 1988234 40 Mike Hart Fr. at Illinois Oct. 16, 2004232 22 Chris Perry Sr. Central Michigan Aug. 30, 2003228 35 Anthony Thomas Sr. at Illinois Sept. 23, 2000225 21 Billy Taylor So. at Iowa Nov. 15, 1969224 19 Tyrone Wheatley So. Iowa Oct. 3, 1992224 33 Mike Hart Fr. Michigan State Oct. 30, 2004219 51 Chris Perry Sr. at Michigan State Nov. 1, 2003218 20 Ted Kress Jr. at Northwestern Oct. 18, 1952218 36 Mike Hart So. at Michigan State Oct. 1, 2005217 19 Denard Robinson So. at Indiana Oct. 2, 2010216 26 Bill Daley Jr. at Northwestern Oct. 2, 1943215 22 Mike Hart Sr. Eastern Michigan Oct. 6, 2007213 33 Tony Boles So. Wake Forest Sept. 24, 1988210 29 Jamie Morris Jr. at Ohio State Nov. 22, 1986210 28 Gordon Bell Sr. at Wisconsin Sept. 13, 1975206 19 Tom Harmon Jr. Yale Oct. 28, 1939206 33 Mike Hart Fr. at Purdue Oct. 23, 2004205 34 Tim Biakabutuka Jr. Northwestern Oct. 7, 1995205 31 Ron Johnson Sr. at Duke Sept. 28, 1968202 29 Tom Harmon Jr. at Pennsylvania Nov. 18, 1939201 21 Jon Vaughn So. at Notre Dame Sept. 15, 1990200 21 Denard Robinson Jr. San Diego State Sept. 24, 2011199 37 Anthony Thomas Sr. at Northwestern Nov. 4, 2000198 26 Denard Robinson Jr. Eastern Michigan Sept. 17, 2011197 22 Bill Daley Jr. at Illinois Oct. 30, 1943197 29 Denard Robinson So. Connecticut Sept. 4, 2010197 42 Anthony Thomas Jr. at Indiana Oct. 30, 1999196 31 Lawrence Ricks Sr. Purdue Nov. 13, 1982196 19 Tim Biakabutuka Jr. Minnesota Oct. 28, 1995195 31 Mike Hart Jr. at Minnesota Sept. 30, 2006194 37 Tim Biakabutuka Jr. at Michigan State Nov. 4, 1995194 24 Butch Woolfolk So. Minnesota Oct. 13, 1979193 16 Jamie Morris Sr. Northwestern Oct. 31, 1987192 29 Glenn Doughty So. Washington Sept. 27, 1969192 32 Tyrone Wheatley Jr. at Penn State Oct. 16, 1993192 27 Fitzgerald Toussaint So. at Illinois Nov. 12, 2011191 27 Denard Robinson So. at Penn State Oct. 30, 2010190 19 Butch Woolfolk So. Wisconsin Nov. 3, 1979189 23 Billy Taylor Jr. Iowa Nov. 14, 1970188 23 Mike Hart Sr. Appalachian State Sept. 1, 2007187 35 Mike Hart Sr. Notre Dame Sept. 15, 2007187 13 Carlos Brown Sr. Eastern Michigan Sept. 19, 2009186 27 Butch Woolfolk Sr. UCLA Dec. 31, 1981184 27 Chris Perry Sr. Houston Sept. 13, 2003184 29 Lawrence Ricks So. California Oct. 4, 1980184 32 Tony Boles So. Minnesota Nov. 5, 1988183 13 Anthony Thomas So. at Hawaii Nov. 28, 1998182 18 Jamie Morris Sr. Wisconsin Oct. 3, 1987182 24 Anthony Thomas Sr. at UCLA Sept. 16, 2000182 26 Butch Woolfolk Jr. Washington Jan. 1, 1981182 32 Anthony Thomas Sr. vs. Auburn Jan. 1, 2001182 35 Tyrone Wheatley Sr. at Iowa Oct. 1, 1994180 10 Rob Lytle Sr. Michigan State Oct. 9, 1976179 10 Tony Boles So. at Wisconsin Oct. 1, 1988179 24 Jamie Morris So. Indiana Oct. 26, 1985177 31 Lawrence Ricks Sr. at Illinois Nov. 6, 1982177 13 Wes Bradford Jr. Minnesota Oct. 27, 1951176 26 Butch Woolfolk Sr. at Indiana Oct. 3, 1981176 27 Ricky Powers So. at Boston College Sept. 7, 1991175 25 Rob Lytle Sr. at Indiana Oct. 23, 1976175 25 Anthony Thomas Sr. Michigan State Oct. 21, 2000175 27 Chris Perry Jr. Wisconsin Nov. 16, 2002
RUSHING RECORDS
100-Yard RushersYards Att. Player Class Opponent Date172 18 Rob Lytle Sr. at Northwestern Oct. 16, 1976172 11 Billy Taylor Sr. Indiana Oct. 30, 1971172 17 Anthony Thomas Jr. Northwestern Nov. 6, 1999172 28 Tyrone Wheatley So. Michigan State Oct. 10, 1992172 31 Gordon Bell Sr. at Minnesota Nov. 1, 1975171 20 Jamie Morris Sr. Long Beach State Sept. 26, 1987171 26 Tyrone Wheatley Jr. Houston Sept. 25, 1993171 35 Anthony Thomas Sr. Penn State Nov. 11, 2000170 20 Fitzgerald Toussaint So. Purdue Oct. 29, 2011170 26 Denard Robinson Jr. Ohio State Nov. 26, 2011168 22 Jesse Johnson So. at Iowa Oct. 5, 1991167 42 Ron Johnson Jr. Northwestern Nov. 4, 1967167 21 Russell Davis Jr. at Purdue Nov. 12, 1977166 23 Gordon Bell Jr. Purdue Nov. 16, 1974166 33 Billy Taylor Sr. at Minnesota Oct. 23, 1971166 17 Vincent Smith Fr. Delaware State Oct. 17, 2009165 29 Rob Lytle Sr. at Ohio State Nov. 20, 1976165 15 Bob Nussbaumer Jr. Purdue Oct. 28, 1944164 22 Jim Pace Sr. Ohio State Nov. 23, 1957164 29 Stan Edwards Jr. Purdue Nov. 15, 1980164 38 Ricky Powers So. Notre Dame Sept. 14, 1991163 34 Ron Johnson Sr. at Indiana Oct. 19, 1968162 30 Tom Kuzma So. Ohio State Nov. 22, 1941162 26 Jon Vaughn So. Michigan State Oct. 13, 1990160 35 Mike Hart Fr. Minnesota Oct. 9, 2004159 23 Gordon Bell Jr. at Indiana Nov. 2, 1974158 20 Rob Lytle So. Minnesota Oct. 26, 1974158 14 Tony Boles Jr. Indiana Oct. 28, 1989158 23 Leroy Hoard So. at Ohio State Nov. 19, 1988157 18 Harlan Huckleby Fr. Northwestern Oct. 18, 1975157 16 Harlan Huckleby So. Stanford Sept. 18, 1976157 25 Roosevelt Smith So. Wisconsin Oct. 15, 1977157 21 Brandon Minor So. Minnesota Oct. 27, 2007156 22 Jamie Morris So. Nebraska Jan. 1, 1986155 13 Billy Taylor So. at Illinois Nov. 8, 1969155 24 Brandon Minor Jr. at Purdue Nov. 1, 2008154 31 Chris Perry Sr. Ohio State Nov. 22, 2003154 25 Mike Hart Jr. Ball State Nov. 4, 2006154 19 Brandon Minor Sr. Purdue Nov. 7, 2009153 23 Tyrone Wheatley Sr. Michigan State Oct. 8, 1994153 24 Lawrence Ricks Sr. Wisconsin Sept. 11, 1982153 27 Tony Boles So. at Northwestern Oct. 29, 1988153 21 Rob Lytle Sr. at Purdue Nov. 6, 1976153 44 Mike Hart Sr. Penn State Sept. 22, 2007152 16 Butch Woolfolk Jr. at Indiana Nov. 1, 1980152 18 Stan Edwards Jr. Illinois Oct. 25, 1980152 21 Leroy Hoard Jr. Ohio State Nov. 25, 1989152 31 Jamie Morris Sr. at Indiana Oct. 24, 1987152 19 Ron Johnson Sr. Michigan State Oct. 12, 1968151 31 Billy Taylor So. at Minnesota Oct. 25, 1969151 26 Billy Taylor Jr. Minnesota Oct. 24, 1970151 26 Ricky Powers So. at Illinois Nov. 16, 1991151 20 Ed Shuttlesworth Jr. Tulane Sept. 30, 1972151 23 Mike Hart Fr. Northwestern Nov. 13, 2004150 14 Tom Kuzma So. at Columbia Nov. 15, 1941149 29 Jamie Morris Sr. at Minnesota Nov. 7, 1987149 29 Billy Taylor Jr. Michigan State Oct. 17, 1970149 32 B.J. Askew Sr. Michigan State Nov. 2, 2002148 20 Tyrone Wheatley Sr. Purdue Nov. 5, 1994148 24 Tyrone Wheatley So. Minnesota Oct. 24, 1992148 21 Ricky Powers So. at Michigan State Oct. 12, 1991148 22 Tony Boles So. at Iowa Oct. 15, 1988147 22 Rob Lytle Jr. Indiana Oct. 25, 1975147 4 Steve Smith Sr. at Minnesota Nov. 12, 1983147 24 Harlan Huckleby Jr. Navy Sept. 24, 1977147 14 Bob Nussbaumer Jr. Northwestern Oct. 14, 1944146 31 Harlan Huckleby Jr. at Michigan State Oct. 8, 1977146 31 Mike Hart Jr. Vanderbilt Sept. 2, 2006146 25 Tyrone Wheatley Jr. Notre Dame Sept. 11, 1993144 26 John Herrnstein Sr. USC Sept. 27, 1958
144 14 Michael Taylor So. Northwestern Oct. 31, 1987Yards Att. Player Class Opponent Date144 19 Tyrone Wheatley Sr. Penn State Oct. 15, 1994143 23 Tyrone Wheatley So. at Northwestern Nov. 7, 1992143 25 Tim Biakabutuka Jr. Memphis Sept. 9, 1995142 19 Leroy Hoard So. USC Jan. 2, 1989142 19 Gordon Bell Jr. at Illinois Nov. 9, 1974142 15 Billy Taylor So. Wisconsin Nov. 1, 1969142 28 Tom Harmon Sr. Pennsylvania Oct. 26, 1940142 23 Mike Hart Jr. at Ohio State Nov. 18, 2006141 35 Gordon Bell Sr. at Illinois Nov. 15, 1975141 31 Butch Woolfolk Jr. at Ohio State Nov. 22, 1980141 28 Chuck Heater So. at Illinois Oct. 21, 1972141 15 Tim Biakabutuka So. Michigan State Oct. 8, 1994141 9 Tyrone Wheatley Fr. Northwestern Nov. 9, 1991140 20 Jim Detwiler Sr. at Ohio State Nov. 19, 1966140 20 Jamie Morris Jr. Oregon State Sept. 20, 1986140 24 Tim Biakabutuka Fr. Purdue Nov. 6, 1993140 24 Chris Perry Sr. Illinois Oct. 18, 2003139 26 Tim Biakabutuka Jr. at Penn State Nov. 18, 1995139 23 Butch Woolfolk Sr. Notre Dame Sept. 19, 1981139 24 Stan Edwards So. at Michigan State Oct. 6, 1979139 27 Rick Rogers Sr. Northwestern Oct. 13, 1984139 19 Carl Ward Jr. at Illinois Nov. 6, 1965139 25 Tom Harmon Sr. at Ohio State Nov. 23, 1940138 30 Bob Wiese So. Ohio State Nov. 20, 1943138 15 Glenn Doughty So. Vanderbilt Sept. 20, 1969138 23 Harlan Huckleby Sr. at Northwestern Nov. 11, 1978138 28 Jamie Morris Fr. Wisconsin Sept. 22, 1984138 32 Anthony Thomas Jr. Notre Dame Sept. 4, 1999138 29 Fitzgerald Toussaint So. Nebraska Nov. 19, 2011137 29 Leroy Hoard So. Illinois Nov. 12, 1988137 24 Bob Timberlake Jr. Iowa Nov. 16, 1963136 20 Jamie Morris Sr. at Illinois Nov. 14, 1987136 29 Butch Woolfolk Jr. Michigan State Oct. 11, 1980135 18 Lawrence Ricks Sr. Minnesota Oct. 30, 1982135 24 Bill Daley Jr. Notre Dame Oct. 9, 1943134 21 Ralph Chubb Jr. at Pennsylvania Nov. 4, 1944134 25 Russell Davis Sr. Purdue Nov. 18, 1978134 18 Tyrone Wheatley So. at Indiana Oct. 17, 1992134 24 Ron Johnson Sr. at Northwestern Nov. 2, 1968134 17 Gordon Bell Jr. Minnesota Oct. 26, 1974133 17 Chuck Heater Jr. at Iowa Sept. 15, 1973133 25 Clarence Williams So. Boston College Sept. 21, 1996133 31 Chris Perry Sr. Notre Dame Sept. 13, 2003132 20 Tyrone Wheatley Sr. Wisconsin Oct. 29, 1994132 13 Tracy Williams So. at Wisconsin Oct. 1, 1988132 21 Anthony Thomas So. vs. Arkansas Jan. 1, 1999132 13 Carlos Brown So. Minnesota Oct. 20, 2007131 23 Butch Woolfolk Fr. Minnesota Oct. 28, 1978131 19 Harlan Huckleby So. Wisconsin Sept. 11, 1976131 20 Carl Ward Sr. Illinois Nov. 5, 1966131 16 Tom Harmon Sr. at California Sept. 28, 1940131 25 Jon Vaughn So. at Purdue Nov. 3, 1990131 14 Anthony Thomas Sr. Rice Sept. 9, 2000131 25 Sam McGuffie Fr. at Notre Dame Sept. 13, 2008130 14 Steve Smith Sr. Indiana Oct. 1, 1983130 23 Jamie Morris Sr. Ohio State Nov. 21, 1987129 33 Tony Boles So. Miami (Fla.) Sept. 17, 1988129 20 Rob Lytle Sr. Minnesota Oct. 30, 1976129 20 Anthony Thomas Fr. Iowa Oct. 18, 1997129 32 Mike Hart Sr. vs. Florida (Capital) Jan. 1, 2008129 5 Denard Robinson So. Bowling Green Sept. 25, 2010128 24 Harlan Huckleby Jr. at Illinois Sept. 10, 1977128 18 Don Moorhead Jr. Washington Sept. 27, 1969128 10 Chuck Heater Jr. Indiana Nov. 3, 1973128 7 Leroy Hoard So. Indiana Oct. 22, 1988128 19 Jamie Morris Sr. Notre Dame Sept. 12, 1987128 12 Tim Biakabutuka So. Boston College Sept. 4, 1994128 15 Jon Vaughn So. Mississippi Jan. 1, 1991128 27 Ricky Powers Fr. at Ohio State Nov. 24, 1990128 15 Jim Pace Sr. Indiana Nov. 16, 1957128 21 Anthony Thomas Jr. Illinois Oct. 23, 1999127 7 Tom Harmon Jr. at Chicago Oct. 21, 1939127 12 Chris Howard Jr. at Minnesota Oct. 26, 1996127 24 Ricky Powers Fr. Minnesota Nov. 17, 1990
RECORD BOOK
127 25 Mike Hart Sr. Oregon Sept. 8, 2007127 30 Dennis Brown Jr. Indiana Oct. 21, 1967Yards Att. Player Class Opponent Date127 30 Butch Woolfolk So. Indiana Oct. 27, 1979127 34 Anthony Thomas Jr. at Penn State Nov. 13, 1999126 26 Bob Westfall Sr. at Illinois Nov. 1, 1941126 24 Stan Edwards Jr. California Oct. 4, 1980126 23 Harlan Huckleby So. Michigan State Oct. 9, 1976126 13 Lawrence Ricks Jr. Northwestern Oct. 24, 1981126 12 Steve Smith Sr. Purdue Nov. 5, 1983126 11 B.J. Askew Sr. at Minnesota Nov. 9, 2002126 31 Mike Hart Jr. Iowa Oct. 21, 2006126 12 Michael Shaw Jr. Massachusetts Sept. 18, 2010125 26 Rick Rogers Jr. Iowa Oct. 22, 1983125 14 Jamie Morris Fr. Minnesota Nov. 10, 1984125 28 Ed Shuttlesworth So. at Purdue Nov. 13, 1971124 19 Rick Rogers Jr. Washington State Sept. 10, 1983124 22 Lawrence Ricks Sr. Indiana Oct. 2, 1982124 20 Rick Rogers Jr. Northwestern Oct. 15, 1983124 18 Tyrone Wheatley Jr. N.C. State Jan. 1, 1994124 21 Gordon Bell Sr. Ohio State Nov. 22, 1975124 31 Mike Hart Jr. at Notre Dame Sept. 16, 2006123 13 Mel Anthony Sr. Oregon State Jan. 1, 1965123 23 Lawrence Ricks So. at Indiana Nov. 1, 1980123 20 Bob Chappuis So. Iowa Oct. 5, 1946122 21 Anthony Thomas Fr. Baylor Sept. 20, 1997122 27 B.J. Askew Jr. at Penn State Oct. 6, 2001122 25 Chris Perry Sr. at Northwestern Nov. 15, 2003122 22 Mike Hart Jr. Michigan State Oct. 7, 2006121 22 Ron Johnson Sr. Navy Oct. 5, 1968121 20 Rob Lytle Jr. at Michigan State Oct. 11, 1975121 23 Jesse Johnson Jr. Illinois Nov. 14, 1992121 20 Mel Anthony Sr. at Iowa Nov. 14, 1964121 21 Tom Kuzma Fr. at Illinois Nov. 1, 1941121 22 Clarence Williams Sr. Wisconsin Nov. 14, 1998121 25 Mike Hart Fr. San Diego State Sept. 18, 2004121 22 Denard Robinson So. Wisconsin Nov. 20, 2010120 15 Jim Pace Jr. Illinois Nov. 10, 1956120 18 Lawrence Ricks Sr. at Iowa Oct. 16, 1982120 20 Dave Fisher Sr. Purdue Oct. 15, 1966120 21 Anthony Thomas Sr. at Purdue Oct. 7, 2000120 22 Chris Howard Sr. at Penn State Nov. 8, 1997120 23 Chris Perry Jr. Washington Aug. 31, 2002120 28 Chris Howard Jr. Penn State Nov. 16, 1996120 28 Tom Harmon Sr. Michigan State Oct. 5, 1940120 31 Justin Fargas Fr. at Northwestern Oct. 17, 1998120 20 Fitzgerald Toussaint So. Ohio State Nov. 26, 2011119 21 Bob Wiese Jr. Northwestern Oct. 14, 1944119 23 Jamie Morris So. Notre Dame Sept. 14, 1985119 14 Butch Woolfolk Sr. at Wisconsin Sept. 12, 1981119 24 Gordon Bell Sr. Missouri Oct. 4, 1975118 9 Alan Jefferson So. Washington State Sept. 19, 1987118 10 Bennie McRae Sr. at Illinois Nov. 11, 1961118 17 Chris Perry Jr. Western Michigan Sept. 7, 2002118 19 Bob Chappuis So. Wisconsin Nov. 16, 1946118 20 Jesse Johnson Jr. at Purdue Oct. 31, 1992118 21 Jamie Morris Jr. at Hawaii Dec. 6, 1986118 23 Ricky Powers So. Purdue Nov. 2, 1991118 25 Billy Taylor Sr. Ohio State Nov. 20, 1971118 n.a. Jack Weisenberger Sr. at Northwestern Oct. 18, 1947118 9 Vincent Smith Jr. Eastern Michigan Sept. 17, 2011117 14 Gordon Bell Sr. Indiana Oct. 25, 1975117 15 Billy Taylor Sr. at Michigan State Oct. 9, 1971117 20 Gil Chapman Jr. at Michigan State Oct. 13, 1973117 15 Tyrone Wheatley Jr. Washington State Sept. 4, 1993117 27 Bob Ptacek Sr. Illinois Nov. 8, 1958117 32 Tim Biakabutuka Jr. at Boston College Sept. 16, 1995117 17 Bob Nussbaumer Jr. at Marquette Sept. 23, 1944117 25 Butch Woolfolk Sr. Navy Sept. 26, 1981117 15 Anthony Thomas So. Eastern Michigan Sept. 19, 1998117 27 Mike Hart So. Northern Illinois Sept. 3, 2005117 26 Max Martin So. Eastern Michigan Sept. 17, 2005117 23 Brandon Minor Jr. at Penn State Oct. 18, 2008117 25 Denard Robinson Jr. at Northwestern Oct. 8, 2011116 15 Steve Smith So. Illinois Nov. 7, 1981116 15 Dave Raimey Jr. Duke Nov. 4, 1961
RUSHING RECORDS
105 25 Sam McGuffie Fr. Toledo Oct. 11, 2008105 18 Denard Robinson So. Iowa Oct. 16, 2010105 18 Denard Robinson So. at Ohio State Nov. 27, 2010Yards Att. Player Class Opponent Date104 18 Harlan Huckleby Sr. Arizona Oct. 7, 1978104 14 Carl Ward Jr. Ohio State Nov. 20, 1965104 18 Rob Lytle Jr. Ohio State Nov. 22, 1975104 27 Donald Peterson Sr. at Illinois Nov. 3, 1951104 21 Jesse Johnson So. at Illinois Nov. 16, 1991104 9 Bob Ptacek So. Indiana Nov. 17, 1956104 10 Walter Cross Fr. Syracuse Sept. 12, 1998104 17 Denard Robinson Jr. Massachusetts Sept. 18, 2010103 17 Tony Branoff Sr. at Illinois Nov. 5, 1955103 22 Billy Taylor Sr. Illinois Oct. 16, 1971103 16 Gil Chapman Jr. Illinois Nov. 10, 1973103 11 Don Moorhead Jr. Vanderbilt Sept. 20, 1969103 19 Tony Boles So. at Ohio State Nov. 19, 1988103 10 Chris Perry Fr. Bowling Green Sept. 2, 2000102 22 Dave Raimey Jr. Iowa Nov. 18, 1961102 13 Anthony Thomas So. Wisconsin Nov. 14, 1998102 21 Mike Hart Sr. Purdue Oct. 13, 2007101 17 Gene Derricotte Fr. Purdue Oct. 28, 1944101 11 Bob Perryman Sr. at Indiana Oct. 25, 1986101 19 Rob Lytle Sr. Stanford Sept. 18, 1976101 20 Chuck Heater Sr. at Wisconsin Oct. 19, 1974101 15 Rob Lytle So. Navy Sept. 28, 1974100 14 Gordon Bell Sr. Northwestern Oct. 18, 1975100 n.a. Jack Weisenberger Sr. Ohio State Nov. 22, 1947100 25 Tim Biakabutuka So. at Notre Dame Sept. 10, 1994100 24 Chris Howard Jr. Michigan State Nov. 2, 1996100 22 Tony Boles Jr. at Michigan State Oct. 14, 1989100 19 Tyrone Wheatley So. at Ohio State Nov. 21, 1992100 18 Bob Wiese So. Indiana Nov. 6, 1943100 26 Chris Howard Sr. at Wisconsin Nov. 15, 1997
116 27 Ed Shuttlesworth Sr. Ohio State Nov. 24, 1973116 7 Russell Davis So. Stanford Sept. 18, 1976116 23 Anthony Thomas Jr. Purdue Oct. 2, 1999Yards Att. Player Class Opponent Date116 19 Mike Hart Jr. Central Michigan Sept. 9, 2006115 24 Ed Shuttlesworth Jr. at UCLA Sept. 23, 1972115 16 Chuck Ortmann Jr. Minnesota Oct. 22, 1949115 9 Tony Boles Jr. at Illinois Nov. 11, 1989115 23 Carlos Brown Jr. Northwestern Nov. 15, 2008114 n.a. Bob Weise So. at Notre Dame Nov. 14, 1942114 12 Dave Raimey So. Duke Oct. 8, 1960114 10 Rick Leach So. Minnesota Oct. 30, 1976114 13 Clarence Williams Sr. at Notre Dame Sept. 5, 1998113 17 Tony Branoff So. Ohio State Nov. 21, 1953113 20 Rob Lytle Jr. Stanford Sept. 20, 1975113 23 Don Dufek Sr. California Jan. 1, 1951113 13 Preston Henry Jr. at Washington Sept. 26, 1970113 18 Bob Timberlake Sr. Purdue Oct. 17, 1964113 23 Ricky Powers Fr. Illinois Nov. 10, 1990113 28 Tyrone Wheatley Jr. Iowa Oct. 2, 1993113 11 Kerry Smith Jr. Minnesota Oct. 30, 1982113 12 Bob Nussbaumer So. Wisconsin Nov. 13, 1943113 25 Carlos Brown So. at Illinois Oct. 20, 2007112 14 Ricky Powers Fr. Mississippi Jan. 1, 1991112 15 B.J. Askew Jr. Western Michigan Sept. 22, 2001112 16 Ed Shuttlesworth So. Iowa Nov. 6, 1971112 18 Tom Harmon Jr. Iowa Oct. 14, 1939112 19 Chris Howard Sr. Baylor Sept. 20, 1997112 21 Chris Perry Sr. Indiana Sept. 27, 2003112 26 Mike Hart Jr. at Penn State Oct. 14, 2006111 16 Ed Shuttlesworth So. Virginia Sept. 18, 1971111 16 Tim Biakabutuka Jr. at Indiana Oct. 21, 1995111 31 Anthony Thomas Jr. Ohio State Nov. 20, 1999110 14 Rob Lytle Sr. Wake Forest Oct. 2, 1976110 15 Don Dufek Sr. Northwestern Nov. 18, 1950110 19 Russell Davis Jr. Texas A&M Oct. 1, 1977110 13 Bob Perryman So. BYU Dec. 21, 1984110 29 Gerald White Jr. Ohio State Nov. 23, 1985110 27 Lawrence Ricks Sr. at Ohio State Nov. 20, 1982110 21 Chris Howard Sr. at Michigan State Oct. 25, 1997110 15 Mike Hart Sr. at Michigan State Nov. 3, 2007109 14 Elroy Hirsch Jr. Minnesota Oct. 23, 1943109 16 Chris Howard Jr. UCLA Sept. 28, 1996109 21 Tom Harmon Sr. at Harvard Oct. 12, 1940109 28 Mike Hart So. Minnesota Oct. 8, 2005108 11 David Underwood Jr. Houston Sept. 6, 2003108 14 Carl Ward So. Minnesota Oct. 24, 1964108 17 Ron Johnson Jr. at Minnesota Oct. 28, 1967108 17 Leroy Hoard Jr. USC Jan. 1, 1990108 23 Anthony Thomas Sr. Bowling Green Sept. 2, 2000108 25 Gordon Bell Jr. at Ohio State Nov. 23, 1974108 31 Jamie Morris Sr. at Michigan State Oct. 10, 1987108 23 Mike Hart So. Penn State Oct. 15, 2005108 12 Brandon Minor Fr. Ball State Nov. 4, 2006108 16 Denard Robinson Jr. Notre Dame Sept. 10, 2011108 11 Fitzgerald Toussaint So. Minnesota Oct. 1, 2011107 22 Kerry Smith Sr. at Wisconsin Sept. 24, 1983107 24 Ron Johnson Jr. Michigan State Oct. 14, 1967107 14 Bob Perryman Sr. at Hawaii Dec. 6, 1986107 28 Ed Shuttlesworth Jr. Michigan State Oct. 14, 1972106 17 Stan Edwards So. Kansas Sept. 22, 1979106 16 Thomas Wilcher Jr. at South Carolina Sept. 21, 1985106 20 Dave Fisher Jr. Wisconsin Oct. 30, 1965106 18 Butch Woolfolk Sr. Northwestern Oct. 24, 1981106 12 Ricky Powers Fr. at Wisconsin Oct. 6, 1990106 30 Mike Hart Sr. at Northwestern Sept. 29, 2007106 16 Brandon Minor Sr. Notre Dame Sept. 12, 2009105 11 Ed Davis Fr. Houston Sept. 26, 1992105 16 Tyrone Wheatley Jr. Ohio State Nov. 20, 1993105 22 Butch Woolfolk So. at Purdue Nov. 10, 1979105 25 Chris Howard Jr. at Ohio State Nov. 23, 1996105 19 Gordon Bell Sr. at Michigan State Oct. 11, 1975105 8 Rob Lytle Jr. Northwestern Oct. 18, 1975105 15 Wes Bradford So. Indiana Nov. 11, 1950105 28 Billy Taylor Sr. at Northwestern Sept. 11, 1971105 24 Jerome Jackson Jr. at Northwestern Oct. 29, 2005
119RECORD BOOK
Name Att Yds Opponent Site Date ResultTony Boles 10 179 Wisconsin A Oct. 1, 1988 W, 62-14Tracy Williams 13 132
Leroy Hoard 23 158 Ohio State A Nov. 19, 1988 W, 34-31Tony Boles 19 103
Jon Vaughn 15 128 Mississippi 1 Jan. 1, 1991 W, 35-3Ricky Powers 14 112
Ricky Powers 26 151 Illinois A Nov.16, 1991 W, 20-0Jesse Johnson 21 104
Tyrone Wheatley 23 153 Michigan State H Oct. 8, 1994 W, 40-20Tim Biakabutuka 15 141
Tyrone Wheatley 20 148 Purdue A Nov. 5, 1994 W, 45-23Tim Biakabutuka 12 100
Anthony Thomas 21 122 Baylor H Sept. 20, 1997 W, 21-3Chris Howard 19 112
Clarence Williams 22 121 Wisconsin H Nov. 14, 1998 W, 27-10Anthony Thomas 13 102
Anthony Thomas 23 108 Bowling Green H Sept. 2, 2000 W, 42-7Chris Perry 10 103
Chris Perry 27 184 Houston H Sept. 6, 2003 W, 50-3David Underwood 11 108
Mike Hart 25 154 Ball State H Nov. 4, 2006 W, 34-26Brandon Minor 12 108
Brandon Minor 21 157 Minnesota H Oct. 27, 2007 W, 34-10Carlos Brown 13 132
Michael Shaw 12 126 Massachusetts H Sept. 18, 2010 W, 42-37Denard Robinson 17 104
Denard Robinson 26 198 Eastern Michigan H Sept. 17, 2011 W, 31-2Vincent Smith 9 118
Denard Robinson 26 170 Ohio State H Nov. 26, 2011 W, 40-34Fitzgerald Toussaint 20 120
1- Gator Bowl, Jacksonville, FL
Name Att Yds Opponent Site Date ResultBob Westfall 26 126 Illinois A Nov. 1, 1941 W, 20-0Tom Kuzma 21 121
Bob Nussbaumer 14 147 Northwestern H Oct. 14, 1944 W, 27-0Bob Wiese 21 119
Bob Nussbaumer 15 165 Purdue H Oct. 28, 1944 W, 40-14Gene Derricotte 17 101
Glenn Doughty 15 138 Vanderbilt H Sept. 20, 1969 W, 42-14Don Moorhead 11 103
Glenn Doughty 29 192 Washington H Sept. 27, 1969 W, 45-7Don Moorhead 18 128
Billy Taylor 21 225 Iowa A Nov. 15, 1969 W, 51-6Glenn Doughty 17 100
Rob Lytle 20 158 Minnesota H Oct. 26, 1974 W, 49-0Gordon Bell 17 134
Rob Lytle 20 111 Michigan State A Oct. 11, 1975 W, 16-6Gordon Bell 19 105
Harlan Huckleby 18 157 Northwestern H Oct. 18, 1975 W, 69-0Rob Lytle 8 105Gordon Bell 14 100
Rob Lytle 22 147 Indiana H Oct. 25, 1975 W, 55-7Gordon Bell 14 117
Gordon Bell 21 124 Ohio State H Nov. 22, 1975 L, 14-21Rob Lytle 18 104
Harlan Huckleby 16 157 Stanford H Sept. 18, 1976 W, 51-0Russell Davis 7 116Rob Lytle 19 101
Rob Lytle 10 180 Michigan State H Oct. 9, 1976 W, 42-10Harlan Huckleby 23 126
Rob Lytle 20 129 Minnesota H Oct. 30, 1976 W, 45-0Rick Leach 10 114
Roosevelt Smith 25 157 Wisconsin H Oct. 15, 1977 W, 56-0Russell Davis 19 105
Butch Woolfolk 29 194 Minnesota H Oct. 13, 1979 W, 31-21Lawrence Reid 17 179
Lawrence Ricks 29 184 California H Oct. 4, 1980 W, 38-13Stan Edwards 24 126
Butch Woolfolk 16 152 Indiana A Nov. 1, 1980 W, 35-0Lawrence Ricks 23 123
Lawrence Ricks 13 126 Northwestern H Oct. 24, 1981 W, 38-0Butch Woolfolk 18 106
Lawrence Ricks 29 184 Minnesota H Oct. 30, 1982 W, 52-14Kerry Smith 11 113
Jamie Morris 21 118 Hawaii A Dec. 6, 1986 W, 27-10Robert Perryman 14 107
Jamie Morris 16 193 Northwestern H Oct. 31, 1987 W, 29-6Michael Taylor 14 144 Team Record with Two or More 100-yard Rushers
Overall Record: 36-1 Road Games: 8-0Home Games: 27-1 Neutral Site Games: 1-0
100-Yard Rushing Duos
Ordered by number of times rushed over 100 yards
Mike Hart (28)Yds. Att. Opponent, Year (Class) 234 40 at Illinois, 2004 (Fr.)224 33 Michigan State, 2004 (Fr.)216 36 at Michigan State, 2005 (So.)215 22 Eastern Michigan, 2007 (Sr.)206 33 at Purdue, 2004 (Fr.)195 31 at Minnesota, 2006 (Jr.)188 23 Appalachian State, 2007 (Sr.)187 35 Notre Dame, 2007 (Sr.)160 35 Minnesota, 2004 (Fr.)154 25 Ball State, 2006 (Jr.)153 44 Penn State, 2007 (Sr.)151 23 Northwestern, 2004 (Fr.)146 31 Vanderbilt, 2006 (Jr.)142 23 at Ohio State, 2006 (Jr.)129 32 vs. Florida, 2007* (Sr.)127 25 Oregon, 2007 (Sr.)126 31 Iowa, 2006 (Jr.)124 31 at Notre Dame, 2006 (Jr.)122 22 Michigan State, 2006 (Jr.)121 25 San Diego State, 2004 (Fr.)117 27 Northern Illinois, 2005 (So.)116 19 Central Michigan, 2006 (Jr.)112 26 at Penn State, 2006 (Jr.)110 15 at Michigan State, 2007 (Sr.)109 28 Minnesota, 2005 (So.)108 23 Penn State, 2005 (So.)106 30 at Northwestern, 2007 (Sr.)102 21 Purdue, 2007 (Sr.)* Capital One Bowl
Anthony Thomas (22)Yds. Att. Opponent, Year (Class)228 35 at Illinois, 2000 (Sr.)199 37 at Northwestern, 2000 (Sr.)197 42 at Indiana, 1999 (Jr.)183 13 at Hawaii, 1998 (So.)182 24 at UCLA, 2000 (Sr.)182 32 vs. Auburn, 2001 * (Sr.)175 25 Michigan State, 2000 (Sr.)172 17 vs. Northwestern, 1999 (Jr.)171 35 vs. Penn State, 2000 (Sr.)138 32 vs. Notre Dame, 1999 (Jr.)132 21 vs. Arkansas, 1999 * (So.)131 14 vs. Rice, 2000 (Sr.)129 20 vs. Iowa, 1997 (Fr.)128 21 vs. Illinois, 1999 (Jr.)127 34 at Penn State, 1999 (Jr.)122 21 vs. Baylor, 1997 (Fr.)120 21 at Purdue, 2000 (Sr.)117 15 vs. E. Michigan, 1998 (So.)116 23 vs. Purdue, 1999 (Jr.)111 31 vs. Ohio State, 1999 (Jr.)108 23 vs. Bowling Green, 2000 (Sr.)102 13 vs. Wisconsin, 1998 (So.)* Florida Citrus Bowl
Tyrone Wheatley (20)Yds. Att. Opponent, Year (Class)235 15 vs. Washington, 1993* (So.)224 19 vs. Iowa, 1992 (So.)192 32 at Penn State, 1993 (Jr.)182 35 at Iowa, 1994 (Sr.)172 28 vs. Michigan State, 1992 (So.)171 26 vs. Houston, 1993 (Jr.)153 23 vs. Michigan State, 1994 (Sr.)
RUSHING RECORDS
100-Yard Rushing Leaders148 20 vs. Purdue, 1994 (Sr.)148 24 vs. Minnesota, 1992 (So.)146 25 vs. Notre Dame, 1993 (Jr.)144 19 vs. Penn State, 1994 (Sr.)143 23 at Northwestern, 1992 (So.)141 9 vs. Northwestern, 1991 (Fr.)134 18 at Indiana, 1992 (So.)132 20 vs. Wisconsin, 1994 (Sr.)124 18 vs. N.C. State, 1994^ (Jr.)117 15 vs. Washington State, 1993 (Jr.)113 28 vs. Iowa, 1993 (Jr.)105 16 vs. Ohio State, 1993 (Jr.)100 19 at Ohio State, 1992 (So.)*Rose Bowl; ^Hall of Fame Bowl
Jamie Morris (18)Yds. Att. Opponent, Year (Class)234 23 vs. Alabama, 1988* (Sr.)210 29 at Ohio State, 1986 (Jr.)193 16 vs. Northwestern, 1987 (Sr.)182 18 vs. Wisconsin, 1987 (Sr.)179 24 vs. Indiana, 1985 (So.)171 20 vs. Long Beach State, 1987 (Sr.)156 22 vs. Nebraska, 1986^ (So.)152 31 at Indiana, 1987 (Sr.)149 29 at Minnesota, 1987 (Sr.)140 20 vs. Oregon State, 1986 (Jr.)138 28 vs. Wisconsin, 1984 (Fr.)136 20 at Illinois, 1987 (Sr.)130 23 vs. Ohio State, 1987 (Sr.)128 19 vs. Notre Dame, 1987 (Sr.)125 14 vs. Minnesota, 1984 (Fr.)119 23 vs. Notre Dame, 1985 (So.)118 21 at Hawaii, 1986 (Jr.)108 31 at Michigan State, 1987 (Sr.)*Hall of Fame Bowl; ^Fiesta Bowl
Butch Woolfolk (16)Yds. Att. Opponent, Year (Class)253 39 at Michigan State, 1981 (Sr.)194 24 vs. Minnesota, 1979 (So.)190 19 vs. Wisconsin, 1979 (So.)186 27 vs. UCLA*, 1981 (Sr.)182 26 vs. Washington, 1981^ (Jr.)176 26 at Indiana, 1981 (Sr.)152 16 vs Indiana, 1980 (Jr.)141 31 at Ohio State, 1980 (Jr.)139 23 vs. Notre Dame, 1981 (Sr.)136 29 vs. Michigan State, 1980 (Jr.)131 23 vs. Minnesota, 1978 (Fr.)127 30 vs. Indiana, 1979 (So.)119 14 at Wisconsin, 1981 (Sr.)117 25 vs. Navy, 1981 (Sr.)106 18 vs. Northwestern, 1981 (Sr.)105 22 at Purdue, 1979 (So.)*Bluebonnet Bowl; ^Rose Bowl
Rob Lytle (15)Yds. Att. Opponent, Year (Class)180 10 vs. Michigan State, 1976 (Sr.)175 25 at Indiana, 1976 (Sr.)172 18 at Northwestern, 1976 (Sr.)165 29 at Ohio State, 1976 (Sr.)158 20 vs. Minnesota, 1974 (So.)153 21 at Purdue, 1976 (Sr.)147 22 vs. Indiana, 1975 (Jr.)129 20 vs. Minnesota, 1976 (Sr.)121 20 at Michigan State, 1975 (Jr.)113 20 vs. Stanford, 1975 (Jr.)110 14 vs. Wake Forest, 1976 (Sr.)
105 8 vs. Northwestern, 1975 (Jr.)104 18 vs. Ohio State, 1975 (Jr.)101 19 vs. Stanford, 1976 (Sr.)101 15 vs. Navy, 1974 (So.)
Gordon Bell (13)Yds. Att. Opponent, Year (Class)210 28 at Wisconsin, 1975 (Sr.)172 31 at Minnesota, 1975 (Sr.)166 23 vs. Purdue, 1974 (Jr.)159 23 at Indiana, 1974 (Jr.)142 19 at Illinois, 1974 (Jr.)141 35 at Illinois, 1975 (Sr.)134 17 vs. Minnesota, 1974 (Jr.)124 21 vs. Ohio State, 1975 (Sr.)119 24 vs. Missouri, 1975 (Sr.)117 14 vs. Indiana, 1975 (Sr.)108 25 at Ohio State, 1974 (Jr.)105 19 at Michigan State, 1975 (Sr.)100 14 vs. Northwestern, 1975 (Sr.)
Denard Robinson (14)Yds. Att. Opponent, Year (Class)258 28 at Notre Dame, 2010 (So.)217 19 at Indiana, 2010 (So.)200 21 San Diego State, 2011 (Jr.)198 26 Eastern Michigan, 2011 (Jr.)197 29 Connecticut, 2010 (So.)191 27 at Penn State, 2010 (So.)170 26 Ohio State, 2011 (Jr.)129 5 Bowling Green, 2010 (So.)121 22 Wisconsin, 2010 (So.)117 25 at Northwestern, 2011 (Jr.)108 16 Notre Dame, 2011 (Jr.)105 18 Iowa, 2010 (So.)105 18 at Ohio State, 2010 (So.)104 17 Massachusetts, 2010 (So.)
Billy Taylor (13)Yds. Att. Opponent, Year (Class)225 21 at Iowa, 1969 (So.)189 23 vs. Iowa, 1970 (Jr.)172 11 vs. Indiana, 1971 (Sr.)166 33 at Minnesota, 1971 (Sr.)155 13 at Illinois, 1969 (So.)151 31 at Minnesota, 1969 (So.)151 26 vs. Minnesota, 1970 (Jr.)149 29 vs. Michigan State, 1970 (Jr.)142 15 vs. Wisconsin, 1969 (So.)118 25 vs. Ohio State, 1971 (Sr.)117 15 at Michigan State, 1971 (Sr.)105 28 at Northwestern, 1971 (Sr.)103 22 vs. Illinois, 1971 (Sr.)
Tim Biakabutuka (13)Yds. Att. Opponent, Year (Class)313 37 vs. Ohio State, 1995 (Jr.)205 34 vs. Northwestern, 1995 (Jr.)196 19 vs. Minnesota, 1995 (Jr.)194 37 at Michigan State, 1995 (Jr.)143 25 vs. Memphis, 1995 (Jr.)141 15 vs. Michigan State, 1994 (So.)139 26 at Penn State, 1995 (Jr.)140 24 vs. Purdue, 1993 (Fr.)128 12 vs. Boston College, 1994 (So.)117 32 at. Boston College, 1995 (Jr.)111 16 at Indiana, 1995 (Jr.)100 25 at Notre Dame, 1994 (So.)
Chris Perry (12)Yds. Att. Opponent, Year (Class)232 22 vs. C. Michigan, 2003 (Sr.)219 51 at Michigan State, 2003 (Sr.)184 27 vs. Houston, 2003 (Sr.)175 27 vs. Wisconsin, 2002 (Jr.)154 31 vs. Ohio State, 2003 (Sr.)140 24 vs. Illinois, 2003 (Sr.)133 31 vs. Notre Dame, 2003 (Sr.)122 25 at Northwestern, 2003 (Sr.)120 23 vs. Washington, 2002 (Jr.)118 17 vs. Western Mich., 2002 (Jr.)112 21 vs. Indiana, 2003 (Sr.)103 10 vs. Bowling Green, 2000 (Fr.)
Tony Boles (10)Yds. Att. Opponent, Year (Class)213 33 vs. Wake Forest, 1988 (So.)184 32 vs. Minnesota, 1988 (So.)179 10 at Wisconsin, 1988 (So.)158 14 vs. Indiana, 1989 (Jr.)153 27 at Northwestern, 1988 (So.)148 22 at Iowa, 1988 (So.)129 33 vs. Miami (Fla.), 1988 (So.)115 9 at Illinois, 1989 (Jr.)103 19 at Ohio State, 1988 (So.)100 22 at Michigan State, 1989 (Jr.)
Ron Johnson (10)Yds. Att. Opponent, Year (Class)347 31 vs. Wisconsin, 1968 (Sr.)270 26 vs. Navy 1967 (Jr.)205 31 at Duke, 1968 (Sr.)167 42 vs. Northwestern, 1967 (Jr.)163 34 at Indiana, 1968 (Sr.)152 19 vs. Michigan State, 1968 (Sr.)134 24 at Northwestern, 1968 (Sr.)121 22 vs. Navy, 1968 (Sr.)108 17 at Minnesota, 1967 (Jr.)107 24 vs. Michigan State, 1967 (Jr.)
Ricky Powers (10)Yds. Att. Opponent, Year (Class)176 27 at Boston College, 1991 (So.)164 38 vs. Notre Dame, 1991 (So.)151 26 at Illinois, 1991 (So.)148 21 at Michigan State, 1991 (So.)128 27 at Ohio State, 1990 (Fr.)127 24 vs. Minnesota, 1990 (Fr.)118 23 vs. Purdue, 1991 (So.)113 23 vs. Illinois, 1990 (Fr.)112 14 vs. Mississippi*, 1991 (Fr.)106 12 at Wisconsin, 1990 (Fr.)*Gator Bowl
Lawrence Ricks (10)Yds. Att. Opponent, Year (Class)196 31 vs. Purdue, 1982 (Sr.)184 29 vs. California, 1980 (So.)177 31 at Illinois, 1982 (Sr.)153 24 vs. Wisconsin, 1982 (Sr.)135 18 vs. Minnesota, 1982 (Sr.)126 13 vs. Northwestern, 1981 (Jr.)124 22 vs. Indiana, 1982 (Sr.)123 23 at Indiana, 1980 (So.)120 18 at Iowa, 1982 (Sr.)110 27 at Ohio State, 1982 (Sr.)
Tom Harmon (9)Yds. Att. Opponent, Year (Class)206 19 vs. Yale, 1939 (Jr.)202 29 at Pennsylvania, 1939 (Jr.)142 28 vs. Pennsylvania, 1940 (Sr.)139 25 at Ohio State, 1940 (Sr.)131 16 at California, 1940 (Sr.)127 7 at Chicago, 1939 (Jr.)120 28 vs. Michigan State, 1940 (Sr.)112 18 vs. Iowa, 1939 (Jr.)109 21 at Harvard, 1940 (Sr.)
Chris Howard (9)Yds. Att. Opponent, Year (Class)127 12 at Minnesota, 1996 (Jr.)120 22 at Penn State, 1997 (Sr.)120 28 vs. Penn State, 1996 (Jr.)112 19 vs. Baylor, 1997 (Sr.)110 21 at. Michigan State, 1997 (Sr.)109 16 vs. UCLA, 1996 (Jr.)105 25 at Ohio State, 1996 (Jr.)100 24 vs. Michigan State, 1996 (Jr.)100 26 at Wisconsin, 1997 (Sr.)
Harlan Huckleby (9)Yds. Att. Opponent, Year (Class)157 18 vs. Northwestern, 1975 (Fr.)157 16 vs. Stanford, 1976 (So.)147 24 vs. Navy, 1977 (Jr.)146 31 at Michigan State, 1977 (Jr.)138 23 at Northwestern, 1978 (Sr.)131 19 vs. Wisconsin, 1976 (So.)128 24 at Illinois, 1977 (Jr.)126 23 vs. Michigan State, 1976 (So.)104 18 vs. Arizona, 1978 (Sr.)
Ed Shuttlesworth (7)Yds. Att. Opponent, Year (Class)151 20 vs. Tulane, 1972 (Jr.)125 28 at Purdue, 1971 (So.)116 27 vs. Ohio State, 1973 (Sr.)115 24 at UCLA, 1972 (Jr.)112 16 vs. Iowa, 1971 (So.)111 16 vs. Virginia, 1971 (So.)107 28 vs. Michigan State, 1972 (Jr.)
Leroy Hoard (6)Yds. Att. Opponent, Year (Class)158 23 at Ohio State, 1988 (So.)152 21 vs. Ohio State, 1989 (Jr.)142 19 vs. USC, 1989* (So.)137 29 vs. Illinois, 1988 (So.)128 7 vs. Indiana, 1988 (So.)108 17 vs. USC, 1990^ (Jr.)*Rose Bowl; ^Rose Bowl
Brandon Minor (6)Yds. Att. Opponent, Year (Class)157 21 Minnesota, 2007 (So.)155 23 at Purdue, 2008 (Jr.)154 19 vs. Purdue, 2009 (Sr.)117 23 at Penn State, 2008 (Jr.)108 12 Ball State, 2006 (Fr.)106 16 Notre Dame, 2009 (Sr.)
Stan Edwards (5)Yds. Att. Opponent, Year (Class)164 29 vs. Purdue, 1980 (Jr.)152 18 vs. Illinois, 1980 (Jr.)139 24 at Michigan State, 1979 (So.)126 24 vs. California, 1980 (Jr.)106 17 vs. Kansas, 1979 (So.)
RECORD BOOK
Jon Vaughn (5)Yds. Att. Opponent, Year (Class)288 32 vs. UCLA, 1990 (So.)201 21 at Notre Dame, 1990 (So.)162 26 vs. Michigan State, 1990 (So.)131 25 at Purdue, 1990 (So.)128 15 vs. Mississippi, 1991* (So.)*Gator Bowl
Fitzgerald Toussaint (5)Yds. Att. Opponent, Year (Class)192 27 at Illinois, 2011 (So.)170 20 vs. Purdue, 2011 (So.)120 20 vs. Ohio State, 2011 (So.)138 29 vs. Nebraska, 2011 (So.)108 11 vs. Minnesota, 2011 (So.)
B.J. Askew (4)Yds. Att. Opponent, Year (Class)149 32 vs. Michigan State, 2002 (Sr.)126 11 at Minnesota, 2002 (Sr.)122 27 at Penn State, 2001 (Jr.)112 15 vs. W. Michigan, 2001 (Jr.)
Carlos Brown (4)Yds. Att. Opponent, Year (Class)187 13 Eastern Michigan, 2009 (Sr.)132 13 Minnesota, 2007 (So.)115 23 Northwestern, 2008 (Jr.)113 25 at Illinois, 2007 (So.)
Russell Davis (4)Yds. Att. Opponent, Year (Class)167 21 at Purdue, 1977 (Jr.)134 25 vs. Purdue, 1978 (Sr.)116 7 vs. Stanford, 1976 (So.)110 19 vs. Texas A&M, 1977 (Jr.)
Chuck Heater (4) Yds. Att. Opponent, Year (Class)141 28 at Illinois, 1972 (So.)133 17 at Iowa, 1973 (Jr.)128 10 vs. Indiana, 1973 (Jr.)101 20 at Wisconsin, 1974 (Sr.)
Jesse Johnson (4)Yds. Att. Opponent, Year (Class)168 22 at Iowa, 1991 (So.)121 23 vs. Illinois, 1992 (Jr.)118 20 at Purdue, 1992 (Jr.)104 21 at Illinois, 1991 (So.)
Bob Nussbaumer (4)Yds. Att. Opponent, Year (Class)165 15 vs. Purdue, 1944 (Jr.)147 14 vs. Northwestern, 1944 (Jr.)117 17 at Marquette, 1944 (Jr.)113 12 vs. Wisconsin, 1943 (So.)
Rick Rogers (4)Yds. Att. Opponent, Year (Class)139 27 vs. Northwestern, 1984 (Sr.)124 19 vs. Washington St. 1983 (Jr.)124 20 vs. Northwestern, 1983 (Jr.)
125 26 vs. Iowa, 1983 (Jr.)
Steve Smith (4)Yds. Att. Opponent, Year (Class)147 4 at Minnesota, 1983 (Sr.)130 14 vs. Indiana, 1983 (Sr.)126 12 vs. Purdue, 1983 (Sr.)116 15 vs. Illinois, 1981 (So.)
Carl Ward (4)Yds. Att. Opponent, Year (Class)139 19 at Illinois, 1965 (Jr.)131 20 vs. Illinois, 1966 (Sr.)108 14 vs. Minnesota, 1964 (So.)104 14 vs. Ohio State, 1965 (Jr.)
Bob Wiese (4)Yds. Att. Opponent, Year (Class)138 30 vs. Ohio State, 1943 (So.)119 21 vs. Northwestern, 1944 (Jr.)114 N/A at Notre Dame, 1942 (So.) 100 18 vs. Indiana, 1943 (So.)
Bill Daley (3)Yds. Att. Opponent, Year (Class)216 26 at Northwestern, 1943 (Jr.)197 22 at Illinois, 1943 (Jr.)135 24 vs. Notre Dame, 1943 (Jr.)
Tom Kuzma (3)Yds. Att. Opponent, Year (Class)162 30 vs. Ohio State, 1941 (So.)150 14 at Columbia, 1941 (So.)121 21 at Illinois, 1941 (So.)
Jim Pace (3)Yds. Att. Opponent, Year (Class)164 22 vs. Ohio State, 1957 (Sr.)128 15 vs. Indiana, 1957 (Sr.)120 15 vs. Illinois, 1956 (Jr.)
Bob Perryman (3)Yds. Att. Opponent, Year (Class)110 13 vs. BYU, 1984* (So.)107 14 at Hawaii, 1986 (Sr.)101 11 at Indiana, 1986 (Sr.)*Holiday Bowl
Dave Raimey (3)Yds. Att. Opponent, Year (Class)116 15 vs. Duke, 1961 (Jr.)114 12 vs. Duke, 1960 (So.)102 22 vs. Iowa, 1961 (Jr.)
Clarence Williams (3)Yds. Att. Opponent, Year (Class)133 25 vs. Boston College, 1996 (So.)121 22 vs. Wisconsin, 1998 (Sr.)114 13 vs. Notre Dame, 1998 (Sr.)
Mel Anthony (2)Yds. Att. Opponent, Year (Class)123 13 vs. Oregon State, 1965* (Sr.)121 20 at Iowa, 1964 (Sr.)* Rose Bowl
Wes Bradford (2)
Yds. Att. Opponent, Year (Class)177 13 vs. Minnesota, 1951 (Jr.)105 15 vs. Indiana, 1950 (So.)
Tony Branoff (2)Yds. Att. Opponent, Year (Class)113 17 vs. Ohio State, 1953 (So.)103 17 at Illinois, 1955 (Sr.)
Gil Chapman (2)Yds. Att. Opponent, Year (Class)117 20 at Michigan State, 1973 (Jr.)103 16 vs. Illinois, 1973 (Jr.)
Bob Chappuis (2)Yds. Att. Opponent, Year (Class)123 20 vs. Iowa, 1946 (So.)118 19 vs. Wisconsin, 1946 (So.)
Glenn Doughty (2)Yds. Att. Opponent, Year (Class)192 29 vs. Washington, 1969 (So.)138 15 vs. Vanderbilt, 1969 (So.)
Don Dufek (2)Yds. Att. Opponent, Year (Class)113 23 vs. California, 1951* (Sr.)110 15 vs. Northwestern, 1950 (Sr.)*Rose Bowl
Dave Fisher (2)Yds. Att. Opponent, Year (Class)120 20 vs. Purdue, 1966 (Sr.)106 20 vs. Wisconsin, 1965 (Jr.)
Sam McGuffie (2)Yds. Att. Opponent, Year (Class)131 25 at Notre Dame, 2008 (Fr.)105 25 vs. Toledo, 2008 (Fr.)
Don Moorhead (2)Yds. Att. Opponent, Year (Class)128 18 vs. Washington, 1969 (Jr.)103 11 vs. Vanderbilt, 1969 (Jr.)
Bob Ptacek (2)Yds. Att. Opponent, Year (Class)117 27 vs. Illinois, 1958 (Sr.)104 9 vs. Indiana, 1956 (So.)
Kerry Smith (2)Yds. Att. Opponent, Year (Class)113 11 vs. Minnesota, 1982 (Jr.)107 22 at Wisconsin, 1983 (Sr.)
Vincent Smith (2)Yds. Att. Opponent, Year (Class)166 17 vs. Delaware State, 2009 (Fr.)118 9 Eastern Michigan, 2011 (Jr.)
Bob Timberlake (2)Yds. Att. Opponent, Year (Class)137 24 vs. Iowa, 1963 (Jr.) 113 18 vs. Purdue, 1964 (Sr.)
Jack Weisenberger (2)Yds. Att. Opponent, Year (Class)118 N/A at Northwestern, 1947 (Sr.)100 N/A vs. Ohio State, 1947 (Sr.)
RUSHING RECORDS122
Dennis Brown (1)Yds. Att. Opponent, Year (Class)127 30 vs. Indiana, 1967 (Jr.)
Ralph Chubb (1)Yds. Att. Opponent, Year (Class)134 21 at Pennsylvania, 1944 (Fr.)
Walter Cross (1)Yds. Att. Opponent, Year (Class)104 10 vs. Syracuse, 1998 (Fr.)
Ed Davis (1)Yds. Att. Opponent, Year (Class)105 11 vs. Houston, 1992 (Fr.)
Gene Derricotte (1)Yds. Att. Opponent, Year (Class)101 17 vs. Purdue, 1944 (Fr.)
Jim Detwiler (1)Yds. Att. Opponent, Year (Class)140 20 at Ohio State, 1966 (Sr.)
Justin Fargas (1)Yds. Att. Opponent, Year (Class) 120 31 at Northwestern, 1998 (Fr.)
Preston Henry (1)Yds. Att. Opponent, Year (Class) 113 13 at Washington, 1970 (Jr.)
John Herrnstein (1)Yds. Att. Opponent, Year (Class)144 26 vs. USC, 1958 (Sr.)
Elroy Hirsch (1)Yds. Att. Opponent, Year (Class)109 14 vs. Minnesota, 1943 (Jr.)
Jerome Jackson (1)Yds. Att. Opponent, Year (Class)105 24 at Northwestern, 2005 (Jr.)
Alan Jefferson (1)Yds. Att. Opponent, Year (Class)118 9 vs. Washington St., 1987 (So.)
Ted Kress (1)Yds. Att. Opponent, Year (Class)218 20 at Northwestern, 1952 (Jr.)
Rick Leach (1)Yds. Att. Opponent, Year (Class)114 10 vs. Minnesota, 1976 (So.)
Max Martin (1)Yds. Att. Opponent, Year (Class)117 26 vs. Eastern Michigan, 2005 (So.)
Bennie McRae (1)
Yds. Att. Opponent, Year (Class)118 10 at Illinois, 1961 (Sr.)
Chuck Ortmann (1)Yds. Att. Opponent, Year (Class)115 16 vs. Minnesota, 1949 (Jr.)
Donald Peterson (1)Yds. Att. Opponent, Year (Class) 104 27 at Illinois, 1951 (Sr.)
Michael Shaw (1)Yds. Att. Opponent, Year (Class)126 12 Massachusetts, 2010 (Jr.)
Roosevelt Smith (1)Yds. Att. Opponent, Year (Class)157 25 vs. Wisconsin, 1977 (So.)
Michael Taylor (1)Yds. Att. Opponent, Year (Class)144 14 vs. Northwestern, 1987 (So.)
David Underwood (1)Yds. Att. Opponent, Year (Class)108 11 vs. Houston, 2003 (Jr.)
Bob Westfall (1)Yds. Att. Opponent, Year (Class)126 26 at Illinois, 1941 (Sr.)
Gerald White (1)Yds. Att. Opponent, Year (Class)110 29 vs. Ohio State, 1985 (Jr.)
Thomas Wilcher (1)Yds. Att. Opponent, Year (Class)106 16 at South Carolina, 1985 (Jr.)
Tracy Williams (1)Yds. Att. Opponent, Year (Class)132 13 at Wisconsin, 1988 (So.)
123RECORD BOOKPASSING RECORDS
Passing
Game1. Tom Brady ................................................56 at Ohio State, Nov. 21, 19982. John Navarre...........................................55 at Oregon, Sept. 20, 20033. Chad Henne ............................................54 at Ohio State, Nov. 20, 20044. Scott Dreisbach .....................................52 Virginia, Aug. 26, 19955. John Navarre...........................................49 at Iowa, Oct. 4, 2003 Chad Henne ............................................49 Minnesota, Oct. 9, 20047. Dick Vidmer .............................................47 at Michigan State, Oct. 8, 1966 John Navarre...........................................47 vs. Ohio State, Nov. 24, 2001 John Navarre...........................................47 at Minnesota, Oct. 10, 200310. Brian Griese .............................................46 at Penn State, Nov. 18, 1995 Tom Brady ................................................46 vs. Alabama, Nov. 1, 2000 John Navarre...........................................46 at Ohio State, Nov. 23, 2002 John Navarre...........................................46 vs. Southern California, Jan. 1, 2004
Season 1. John Navarre 456 2003 2. John Navarre 448 2002 3. Chad Henne 399 2004 4. John Navarre 385 2001 5. Chad Henne 382 2005 6. Tom Brady 350 1998 7. Tom Brady 341 1999 8. Chad Henne 328 2006 9. Brian Griese 307 1997 10. Todd Collins 296 1993 11. Denard Robinson 291 2010 12. Todd Collins 288 1994 13. Tate Forcier 281 200914. Chad Henne 278 2007 15. Jim Harbaugh 277 1986 16. Scott Dreisbach 269 1996 17. Elvis Grbac 266 1990 18. Elvis Grbac 254 199119. Brian Griese 238 1995 20. Drew Henson 237 2000 Denard Robinson 237 2011
Career 1. Chad Henne 1,387 2004-07 2. John Navarre 1,366 2000-03 3. Elvis Grbac 835 1989-92 4. Todd Collins 711 1991-94 Tom Brady 711 1996-99 6. Steve Smith 648 1980-83 7. Jim Harbaugh 620 1983-86 8. Brian Griese 606 1994-97 9. Denard Robinson 559 2009- 10. Rick Leach 537 1975-78 11. Don Moorhead 425 1968-7012. Dennis Brown 388 1966-6813. Scott Dreisbach 380 1995-98 14. Drew Henson 374 1998-00 15. Dick Vidmer 367 1965-67 16. Tate Forcier 365 2009-1017. John Wangler 346 1976-8018. Chuck Ortmann 333 1948-50
Game1. Tom Brady ................................................34 vs. Alabama, Jan. 1, 20002. John Navarre...........................................33 at Minnesota, Oct. 10, 2003 Chad Henne ............................................33 Minnesota, Oct. 9, 20043. Tom Brady ................................................31 at Ohio State, Nov. 21, 19984. Tom Brady ................................................30 at Michigan State, Oct. 9, 19995. Todd Collins ............................................29 Oklahoma State, Sept. 19, 19926. John Navarre...........................................28 at Oregon, Sept. 20, 20037. Scott Dreisbach .....................................27 Virginia, Aug. 26, 1995 John Navarre...........................................27 Penn State, Oct. 12, 2002 John Navarre...........................................27 vs. Southern California, Jan. 1, 2004 Chad Henne ............................................27 at Ohio State, Nov. 20, 2004 Denard Robinson .........................27 vs. Mississippi State, Jan. 1, 2011
Most Attempted
Most Completed
Season1. John Navarre 270 20032. John Navarre 248 20023. Chad Henne 240 20044. Chad Henne 223 20055. Tom Brady 214 1998
Tom Brady 214 19997. John Navarre 207 20018. Chad Henne 203 20069. Brian Griese 193 1997
10. Todd Collins 189 199311. Todd Collins 186 199412. Denard Robinson 182 2010 13. Jim Harbaugh 180 198614. Elvis Grbac 165 1991 Tate Forcier 165 200916. Chad Henne 162 200717. Elvis Grbac 155 1990 18. Scott Dreisbach 149 1996 19. Drew Henson 146 2000 20. Jim Harbaugh 145 1985
Career1. Chad Henne 828 2004-07
2. John Navarre 765 2000-03 3. Elvis Grbac 522 1989-92 4. Todd Collins 457 1991-94 5. Tom Brady 443 1996-99 6. Jim Harbaugh 387 1983-86 7. Brian Griese 355 1994-97 8. Denard Robinson 329 2009- 9. Steve Smith 324 1980-83 10. Rick Leach 250 1975-7811. Tate Forcier 219 2009-10 12. Drew Henson 214 1998-00 13. Scott Dreisbach 208 1995-98 14. John Wangler 197 1976-80 15. Don Moorhead 196 1968-7016. Dennis Brown 194 1966-68 17. Dick Vidmer 181 1965-67
Highest Completion %Game (Min. 10 attempts)
1. Tate Forcier ......................100.0 (12) Bowling Green, Sept. 25, 20102. Jim Harbaugh ............................ 92.3 (13) Purdue, Nov. 9, 19853. Elvis Grbac .................................. 90.9 (22) Notre Dame, Sept. 14, 19914. Bob Chandler ............................. 90.0 (10) Navy, Oct. 5, 1963 Tom Brady ................................... 90.0 (10) at Hawaii, Nov. 28, 1998
Game (Min. 20 attempts)1. Elvis Grbac .................................. 90.9 (22)
Notre Dame, Sept. 14, 19912. Denard Robinson .............. 86.3 (22) Connecticut, Sept. 4, 20103. Todd Collins ............................... 85.7 (21) Purdue, Nov. 6, 19934. Elvis Grbac .................................. 81.0 (21) Notre Dame, Sept. 16, 1989 Chad Henne ............................... 81.0 (21) at Indiana, Oct. 2, 20046. Jim Harbaugh ............................ 80.0 (20) Maryland, Sept. 28, 1985 Elvis Grbac .................................. 80.0 (20) at Illinois, Nov. 16, 1991
Season (Min. 100 attempts) 1. Todd Collins 65.3 1992 2. Jim Harbaugh 65.0 1986 Elvis Grbac 65.0 1991 4. Elvis Grbac 64.8 1992 5. Todd Collins 64.6 1994 6. Jim Harbaugh 63.9 1985 Todd Collins 63.9 1993 8. Elvis Grbac 62.9 1989 Brian Griese 62.9 1997 10. Tom Brady 62.8 1999
Career (Min. 200 attempts) 1. Todd Collins 64.3 1991-94 2. Elvis Grbac 62.5 1989-92 3. Jim Harbaugh 62.4 1983-86 4. Tom Brady 62.3 1996-99 5. Chad Henne 59.7 2004-07 6. Michael Taylor 59.3 1986-89 7. Denard Robinson 58.9 2009- 8. Brian Griese 58.6 1994-97 9. Drew Henson 57.2 1998-00 10. John Wangler 56.9 1976-80
Highest Efficiency RatingSeason (Min. 100 attempts)
1. Bob Chappuis 173.3 1947 2. John Wangler 162.0 1979 3. Elvis Grbac 161.7 1991 4. Michael Taylor 161.2 1989 5. Drew Henson 159.4 2000 6. Jim Harbaugh 157.9 1985 7. Jim Harbaugh 151.7 1986 8. Rick Leach 151.0 1976 9. Elvis Grbac 150.2 1992 10. Denard Robinson 149.6 2010 11. Todd Collins 149.3 1993
Career (Min. 200 attempts) 1. Elvis Grbac 148.1 1989-92 2. Jim Harbaugh 145.6 1983-86 3. Todd Collins 145.0 1991-94 4. John Wangler 143.6 1976-80 5. Denard Robinson 143.3 2009- 6. Michael Taylor 141.6 1986-89 7. Bob Chappuis 140.4 1942-47 8. Tom Brady 136.4 1996-99 9. Drew Henson 135.7 1998-00 10. Chad Henne 135.6 2004-07
Elvis Grbac Chad HenneTom Brady
RUSHING RECORDS124 124RECORD BOOK
250-Yard Passing GamesName Att. Comp. Yards Opponent DateJohn Navarre 49 26 389 at Iowa Oct. 4, 2003Tom Brady 56 31 375 at Ohio State Nov. 21, 1998Chad Henne 39 25 373 vs. Florida (Capital One) Jan. 1, 2008Scott Dreisbach 52 27 372 Virginia Aug. 26, 1995Tom Brady 46 34 369 vs. Alabama (Orange) Jan. 1, 2000John Navarre 55 28 360 at Oregon Sept. 20, 2003John Navarre 47 33 353 at Minnesota Oct. 10, 2003Todd Collins 27 15 352 Minnesota Nov. 12, 1994Denard Robinson 24 11 338 Notre Dame Sept. 10, 2011Denard Robinson 26 17 337 at Northwestern Oct. 8, 2011Chad Henne 49 33 328 Minnesota Oct. 9, 2004Chad Henne 54 27 328 at Ohio State Nov. 20, 2004Brian Griese 46 24 323 Penn State Nov. 18, 1995John Navarre 36 21 319 vs. Florida (Outback) Jan. 1, 2003Chad Henne 21 17 316 at Indiana Oct. 2, 2004Drew Henson 35 23 312 at Northwestern Nov. 4, 2000Jim Harbaugh 24 15 310 Wisconsin Oct. 4, 1986Chad Henne 26 41 309 vs. USC (Rose) Jan. 1, 2007Tom Brady 38 23 307 Illinois Oct. 23, 1999Denard Robinson 20 10 305 Illinois Nov. 6, 2010Drew Henson 25 14 303 at Ohio State Nov. 18, 2000Jim Harbaugh 24 10 300 Indiana Oct. 25, 1986Elvis Grbac 25 16 296 vs. Mississippi (Gator) Jan. 1, 1991Drew Henson 20 15 294 vs. Auburn (Citrus) Jan. 1, 2001Scott Dreisbach 28 19 292 Boston College Sept. 21, 1996John Navarre 31 22 288 at Northwestern Nov. 15, 2003Brian Griese 37 21 287 vs. Alabama (Outback) Jan. 1, 1997Todd Collins 23 14 286 Illinois Oct. 23, 1993Todd Collins 42 29 285 Oklahoma State Sept. 19, 1992Tom Brady 41 30 285 at Michigan State Oct. 9, 1999Chad Henne 24 17 284 at Minnesota Sept. 30, 2006Jim Harbaugh 23 17 283 Indiana Oct. 26, 1985Tom Brady 27 19 282 at Minnesota Oct. 31, 1998
Most Yards Gained
Game1. John Navarre........................................ 389 at Iowa, Oct. 4, 20032. Tom Brady ............................................. 375 at Ohio State, Nov. 21, 19983. Scott Dreisbach .................................. 372 Virginia, Aug. 26, 19954. Tom Brady ............................................. 369 vs. Alabama, Jan. 1, 20005. John Navarre........................................ 360 at Oregon, Sept. 20, 20036. John Navarre........................................ 353 at Minnesota, Oct. 10, 20037. Todd Collins ......................................... 352 Minnesota, Nov. 12, 1994
Season 1. John Navarre 3,331 2003 2. John Navarre 2,905 2002 3. Chad Henne 2,743 2004 4. Jim Harbaugh 2,729 1986 5. Tom Brady 2,636 1998 6. Tom Brady 2,586 1999 7. Denard Robinson 2,570 2010 8. Chad Henne 2,526 2005 9. Todd Collins 2,518 1994 10. Todd Collins 2,509 1993 11. Chad Henne 2,508 2006 12. John Navarre 2,435 2001 13. Brian Griese 2,293 199714. Drew Henson 2,146 2000 15. Elvis Grbac 2,085 199116. Denard Robinson 2,056 2011 17. Tate Forcier 2,050 2009 18. Scott Dreisbach 2,025 1996
Career1. Chad Henne 9,715 2004-07
2. John Navarre 9,254 2000-03 3. Elvis Grbac 6,460 1989-92 4. Todd Collins 5,858 1991-94 5. Jim Harbaugh 5,449 1983-86 6. Tom Brady 5,351 1996-99 7. Steve Smith 4,860 1980-83 8. Denard Robinson 4,814 2009- 9. Brian Griese 4,383 1994-97 10. Rick Leach 4,284 1975-78 11. John Wangler 2,994 1976-80 12. Drew Henson 2,946 1998-00 13. Scott Dreisbach 2,920 1995-97 14. Tate Forcier 2,647 2009-10 15. Don Moorhead 2,550 1968-70 16. Dennis Brown 2,534 1966-68 17. Dick Vidmer 2,400 1965-67 18. Dennis Franklin 2,285 1972-74
John Navarre
Brian Griese Todd Collins Scott Dreisbach
Name Att. Comp. Yards Opponent DateElvis Grbac 29 21 278 Illinois Nov. 14, 1992John Navarre 32 21 278 Ohio State Nov. 22, 2003Denard Robinson 16 10 277 at Indiana Oct. 2, 2010Todd Collins 29 19 274 Washington State Sept. 4, 1993Chad Henne 35 24 273 Michigan State Oct. 30, 2004Brian Griese 19 14 271 Minnesota Oct. 28, 1995John Navarre 35 17 271 at Purdue Oct. 19, 2002John Navarre 46 27 271 vs. USC (Rose) Jan. 1, 2004Chad Henne 43 21 270 vs. Nebraska (Alamo) Dec. 28, 2005John Navarre 38 22 268 Washington Aug. 31, 2002Todd Collins 34 20 267 Houston Sept. 25, 1993Tom Brady 36 23 267 at Notre Dame Sept. 5, 1998Chad Henne 35 21 267 at Ohio State Nov. 18, 2006John Navarre 19 15 265 Bowling Green Sept. 2, 2000John Navarre 37 22 264 at Illinois Sept. 28, 2002Chad Henne 28 21 264 Purdue Oct. 13, 2007Jim Harbaugh 29 19 261 Ohio State Nov. 22, 1986Chris Zurbrugg 30 21 259 Purdue Nov. 3, 1984Tom Brady 36 17 259 at Penn State Nov. 13, 1999Dick Vidmer 18 12 258 Oregon State Sept. 17, 1966Todd Collins 24 17 258 Boston College Sept. 3, 1994Todd Collins 24 17 258 Colorado Sept. 24, 1994Brian Griese 28 21 258 Colorado Sept. 13, 1997Chad Henne 34 16 258 at Wisconsin Sept. 24, 2005Drew Henson 27 15 257 Wisconsin Sept. 30, 2000Tate Forcier 23 13 257 at Illinois Oct. 31, 2009Drew Henson 35 26 256 at Purdue Oct. 7, 2000Chad Henne 35 26 256 at Michigan State Oct. 1, 2005Brian Griese 26 19 254 Wisconsin Nov. 15, 1997Denard Robinson 41 27 254 Mississippi State (Gator) Jan. 1, 2011Todd Collins 37 22 251 Notre Dame Sept. 11, 1993Brian Griese 30 18 251 Washington State (Rose) Jan. 1, 1998Tom Brady 25 15 250 Purdue Oct. 2, 1999Steven Threet 35 18 250 Illinois Oct. 4, 2008
Tom Brady
125RECORD BOOKPASSING RECORDS
Game1. Steve Smith ............................................... 4 Purdue, Nov. 5, 1983 Chris Zurbrugg ......................................... 4 at Purdue, Nov. 3, 1984 Michael Taylor .......................................... 4 at Minnesota, Nov. 18, 1989 Elvis Grbac ................................................. 4 vs. Mississippi, Jan. 1, 1991 Elvis Grbac ................................................. 4 Florida State, Aug. 28, 1991 Todd Collins .............................................. 4 Houston, Sept. 26, 1992 Elvis Grbac ................................................. 4 Minnesota, Oct. 24, 1992 Brian Griese ............................................... 4 Minnesota, Oct. 28, 1995 Scott Dreisbach ....................................... 4 Michigan State, Nov. 2, 1996 Tom Brady .................................................. 4 vs. Alabama, Jan. 1, 2000 John Navarre............................................. 4 Bowling Green, Sept. 2, 2000 Drew Henson ............................................ 4 at Northwestern, Nov. 4, 2000 John Navarre............................................. 4 Western Michigan, Sept. 14, 2002 John Navarre............................................. 4 at Illinois, Sept. 28, 2002 Chad Henne .............................................. 4 Michigan State, Oct. 30, 2004 Chad Henne .............................................. 4 vs. Texas (Rose Bowl), Jan. 1, 2005 Chad Henne .............................................. 4 at Michigan State, Nov. 3, 2007 Denard Robinson ...........................4 vs. Notre Dame, Sept. 10, 2011
Season1. Elvis Grbac 25 1991
Chad Henne 25 20043. John Navarre 24 20034. Chad Henne 23 20055. Chad Henne 22 20066. Elvis Grbac 21 1990
John Navarre 21 20028. Tom Brady 20 19999. John Navarre 19 2001
10. Jim Harbaugh 18 1985 Drew Henson 18 2000 Denard Robinson 18 2010 Denard Robinson 18 2011 13. Rick Leach 17 1978 Elvis Grbac 17 1992 Todd Collins 17 1993 Brian Griese 17 1997 Chad Henne 17 2007
Career 1. Chad Henne 87 2004-07 2. John Navarre 72 2000-03 3. Elvis Grbac 71 1989-92 4. Rick Leach 48 1975-78 5. Steve Smith 42 1980-83 6. Denard Robinson 38 2009- 7. Todd Collins 37 1991-94 8. Tom Brady 35 1996-99 9. Brian Griese 33 1994-97 10. Jim Harbaugh 31 1983-86
Most Touchdown Passes
Average Yards Per Completion
Game (Min. 5 completions)1. Rick Leach ............................................ 36.3
Purdue, Nov. 8, 19752. John Wangler ...................................... 33.8
vs. North Carolina, Dec. 28, 19793. Denard Robinson ......................30.7
Notre Dame, Sept. 10, 20114. Denard Robinson ......................30.5
Illinois, Nov. 6, 20105. Jim Harbaugh ..................................... 30.0
at Indiana, Oct. 25, 1986
Game (Min. 10 completions)1. Denard Robinson ......................30.7 Notre Dame, Sept. 10, 2011 1. ........ 2. Denard Robinson ......................30.5 Illinois, Nov. 6, 20103. Jim Harbaugh ..................................... 30.0 at Indiana, Oct. 25, 19864. Todd Collins ........................................ 23.5 Minnesota, Nov. 12, 19945. John Wangler ...................................... 21.9 Wisconsin, Nov. 2, 1979
Season (Min. 60 completions)
1. Bob Chappuis 18.8 19472. John Wangler 18.3 19793. Steve Smith 17.1 19814. Rick Leach 16.4 19785. Demetrius Brown 15.6 19876. Denard Robinson 15.5 2011
7. Jim Harbaugh 15.2 19868. Rick Leach 15.0 19779. Steve Smith 14.7 1982
10. Drew Henson 14.7 200011. Michael Taylor 14.6 1989
Career (Min. 120 completions)
1. Rick Leach 17.1 1975-78 2. Bob Chappuis 15.9 1942-47 3. Demetrius Brown 15.8 1986-88 4. Chuck Ortmann 15.5 1948-50 5. John Wangler 15.2 1976-80 6. Steve Smith 15.0 1980-83 7. Dennis Franklin 14.9 1972-74 8. Denard Robinson 14.6 2009- 9. Jim Harbaugh 14.1 1983-86 10. Scott Dreisbach 14.0 1995-97
Average Yards Per GameSeason (Min. 10 games)
1. John Navarre 256.2 2003 2. Chad Henne 228.6 2004 3. John Navarre 223.5 2002 4. Tom Brady 215.5 1999 5. Chad Henne 210.5 2005 6. Jim Harbaugh 209.9 1986 7. Todd Collins 209.8 1994 8. Todd Collins 209.1 1993 9. John Navarre 202.9 2001 10. Tom Brady 202.8 1998 11. Denard Robinson 197.7 2010 12. Chad Henne 193.8 2007 13. Chad Henne 192.9 2006 14. Brian Griese 191.1 1997 15. Scott Dreisbach 184.1 1996
Career (Min. 20 games)1. John Navarre 215.2 2000-03
2. Chad Henne 206.7 2004-07 3. Jim Harbaugh 175.8 1983-86 4. Tom Brady 172.6 1996-99 5. Todd Collins 158.3 1991-94 6. Brian Griese 156.5 1994-97 7. Elvis Grbac 153.8 1989-92 8. Denard Robinson 130.1 2009- 9. Steve Smith 127.9 1980-8310. Dick Vidmer 111.0 1965-67
Dick Vidmer
Elvis Grbac John Navarre
RUSHING RECORDS126 126RECORD BOOK
Lowest Interception PercentageSeason (Min. 100 attempts)
1. John Navarre 1.56 20022. Wally Gabler 1.60 19653. Dennis Franklin 1.63 19724. Michael Taylor 1.64 19885. Drew Henson 1.68 20006. Tom Brady 1.75 19997. Brian Griese 1.95 19978. Chad Henne 2.09 20059. John Navarre 2.19 2003
10. Elvis Grbac 2.36 1991 Todd Collins 2.36 1993
Career (Min. 200 attempts)1. Drew Henson 1.87 1998-00
2. John Navarre 2.27 2000-03 3. Michael Taylor 2.55 1986-89 4. Chad Henne 2.67 2004-07 Tom Brady 2.67 1996-99 6. Todd Collins 2.81 1991-94 7. Brian Griese 2.97 1994-97 8. Scott Dreisbach 3.17 1994-97 9. Don Moorhead 3.53 1968-70 10. Jim Harbaugh 3.55 1983-86
Most 150-Yard Passing GamesSeason
1. John Navarre 12 20032. Jim Harbaugh 11 1986
Todd Collins 11 1994 John Navarre 11 2002 Chad Henne 11 20055. Todd Collins 10 1993
Brian Griese 10 1997 Tom Brady 10 1999 John Navarre 10 2001 Chad Henne 10 2004 Denard Robinson 10 2010
Career1. Chad Henne 38 2004-07
2. John Navarre 34 2000-03 3. Elvis Grbac 23 1989-92 Todd Collins 23 1991-94 5. Jim Harbaugh 19 1983-86 6. Tom Brady 18 1996-99 7. Steve Smith 17 1980-83 Denard Robinson 17 2009- 9. Brian Griese 15 1994-9710. Scott Dreisbach 11 1995-97
Most 200-Yard Passing GamesSeason
1. John Navarre 10 20032. John Navarre 9 20023. Jim Harbaugh 8 1986
Tom Brady 8 1998 John Navarre 8 2001 Chad Henne 8 20057. Tom Brady 7 1999
Drew Henson 7 2000 Chad Henne 7 2004 Denard Robinson 7 2010 11. Todd Collins 6 1993 Todd Collins 6 1994 Scott Dreisbach 6 1996 Chad Henne 6 2006
Career1. John Navarre 28 2000-03
2. Chad Henne 27 2004-07 3. Tom Brady 15 1996-99 4. Todd Collins 14 1991-94 5. Jim Harbaugh 12 1983-86 6. Elvis Grbac 9 1989-92 Denard Robinson 9 2009- 8. Brian Griese 8 1994-97 9. Scott Dreisbach 7 1995-97 Drew Henson 7 1998-00
Season1. Rick Leach 12.38 19762. Bob Chappuis 11.82 19473. Rick Leach 10.76 19784. Elvis Grbac 9.84 19915. Michael Taylor 9.09 19896. Rick Leach 8.62 19777. Elvis Grbac 8.54 19928. Jim Harbaugh 7.93 19859 Elvis Grbac 7.89 1990
10. Dennis Franklin 7.69 1974
Highest Touchdown Percentage
Career1. Rick Leach 8.9 1975-78
2. Bob Chappuis 8.6 1942-47 3. Elvis Grbac 8.5 1989-92 4. Tom Harmon 7.3 1938-40 5. John Wangler 7.2 1976-80 6. Denard Robinson 6.8 2009- 7. Demetrius Brown 6.7 1986-88 8. Steve Smith 6.5 1980-83 9. Drew Henson 6.4 1998-00 10. Chad Henne 6.3 2004-07
Game1. Demetrius Brown .................................... 7 at Michigan State, Oct. 10, 19872. Stan Noskin ............................................... 5 Wisconsin, Oct. 31, 1959
Season 1. Demetrius Brown 16 1987 2. Stan Noskin 15 1959 3. Denard Robinson 14 2011 4. Steve Smith 13 1982 John Navarre 13 2001 6. Rick Leach 12 1975 Elvis Grbac 12 1992 Tom Brady 12 1998 Chad Henne 12 2004 10. Tom Harmon 11 1940 Dave Glinka 11 1960 Steve Smith 11 1981 Jim Harbaugh 11 1986 Denard Robinson 11 2010
Career 1. Chad Henne 37 2004-07 2. Rick Leach 35 1975-78 3. Steve Smith 32 1980-83 4. Elvis Grbac 31 1989-92 John Navarre 31 2000-03 6. Denard Robinson 29 2009- 7. Jim Harbaugh 22 1983-86 8. Stan Noskin 21 1957-59 9. Tom Harmon 20 1938-40 Dick Vidmer 20 1965-67 Todd Collins 20 1991-9412. Tom Brady 19 1996-99
Most Interceptions
Michael Taylor Drew Henson
Rick Leach
127RECORD BOOKRECEIVING RECORDS
Receiving
Game1. Marquise Walker ....................................15 at Washington, Sept. 8, 2001 Marquise Walker ....................................15 Ohio State, Nov. 24, 20013. Braylon Edwards ....................................13 at Oregon, Sept. 20, 20034. Brad Myers ...............................................12 at Ohio State, Nov. 22, 1958 Tai Streets .................................................12 at Northwestern, Oct. 5, 1996
Season 1. Braylon Edwards 97 2004 2. Marquise Walker 86 2001 3. Braylon Edwards 85 2003 4. Jason Avant 82 2005 5. Jack Clancy 76 1966 6. Mario Manningham 72 2007 Roy Roundtree 72 2010 8. David Terrell 71 1999 9. Tai Streets 67 1998 David Terrell 67 2000 Braylon Edwards 67 2002 Adrian Arrington 67 2007
Career1. Braylon Edwards 252 2001-04
2. Marquise Walker 176 1998-01 3. Jason Avant 169 2002-05 4. Anthony Carter 161 1979-82 5. Steve Breaston 156 2003-06 6. David Terrell 152 1998-00 7. Tai Streets 144 1995-98 8. Amani Toomer 143 1992-95 9. Mario Manningham 137 2005-07 10. Desmond Howard 134 1989-91 11. Jack Clancy 132 1963-66
Game1. Roy Roundtree ...........................246 Illinois, Nov. 6, 20102. Jack Clancy ........................................... 197 Oregon State, Sept. 17, 19663. Tai Streets .............................................. 192 at Minnesota, Oct. 31, 19984. Braylon Edwards ................................. 189 Michigan State, Oct. 30, 20045. Derrick Alexander .............................. 188 Illinois, Oct. 23, 1993
Receptions
Receiving YardsSeason
1. Braylon Edwards 1,330 2004 2. Mario Manningham 1,174 2007 3. Marquise Walker 1,143 2001 4. Braylon Edwards 1,138 2003 5. David Terrell 1,130 2000 6. Amani Toomer 1,096 1994 7. Jack Clancy 1,077 1966 8. David Terrell 1,038 1999 9. Tai Streets 1,035 1998 Braylon Edwards 1,035 2002 11. Desmond Howard 1,025 1990
Career1. Braylon Edwards 3,541 2001-04
2. Anthony Carter 3,076 1979-82 3. Amani Toomer 2,657 1992-95 4. David Terrell 2,317 1998-00 5. Mario Manningham 2,310 2005-07 6. Tai Streets 2,284 1995-98 7. Marquise Walker 2,269 1998-01 8. Jason Avant 2,247 2002-05 9. Greg McMurtry 2,163 1986-89 10. Desmond Howard 2,146 1989-91 11. Mercury Hayes 2,144 1992-95
Touchdown Receptions
Game1. Derrick Alexander ................................... 4 Minnesota, Oct. 24, 19922. Ron Kramer ............................................... 3 Missouri, Sept. 24, 1955 Greg McMurtry ........................................ 3 at Minnesota, Nov. 18, 1989 Desmond Howard .................................. 3 at Boston College, Sept. 7, 1991 Desmond Howard .................................. 3 Indiana, Oct. 19, 1991 Derrick Alexander ................................... 3 at Northwestern, Nov. 7, 1992 David Terrell .............................................. 3 vs. Alabama, Jan. 1, 2000 David Terrell .............................................. 3 at Northwestern, Nov. 4, 2000 Braylon Edwards ...................................... 3 Michigan State, Oct. 30, 2004 Braylon Edwards ...................................... 3 vs. Texas (Rose Bowl), Jan. 1, 2005
Season 1. Desmond Howard 19 1991 2. Braylon Edwards 15 2004 3. Anthony Carter 14 1980 David Terrell 14 2000 Braylon Edwards 14 2003 6. Mario Manningham 12 2007 7. Desmond Howard 11 1990 Derrick Alexander 11 1992 Tai Streets 11 1998 Marquise Walker 11 2001 11. Braylon Edwards 10 2002
Career1. Braylon Edwards 39 2001-04
2. Anthony Carter 37 1979-82 3. Desmond Howard 32 1989-91 4. Mario Manningham 27 2005-07 5. David Terrell 23 1998-00 6. Derrick Alexander 22 1989-93 7. Tai Streets 19 1995-98 8. Amani Toomer 18 1992-95 9. Marquise Walker 17 2000-01 10. Dick Rifenburg 16 1944-48 Adrian Arrington 16 2004-07
Consecutive Games with a Reception
1. Braylon Edwards 382. Jason Avant 353. Marquise Walker 324. Mercury Hayes 305. Amani Toomer 26
Adrian Arrington 267. David Terrell 258. Desmond Howard 249. Anthony Carter 20
10. Tai Streets 19 Roy Roundtree 1912. Steve Breaston 16
Consecutive Games with Touchdown Reception
1. Desmond Howard 13 Minnesota 1990-at Illinois 19912. Anthony Carter 9
South Carolina-Washington, 19803. David Terrell 8
Alabama, 1999-Indiana, 20004. Marquise Walker 7
Washington-Michigan State, 20015. Mario Manningham 6
at Northwestern-Wisconsin, 20076. Anthony Carter 4
at Northwestern-Purdue, 1982 Braylon Edwards 4 Purdue-Ohio State, 2003 Braylon Edwards 4 Utah-Purdue, 2002 Braylon Edwards 4 San Diego State-Minnesota, 2004 Jason Avant 4 Michigan State 2004-N. Illinois 2005 Mario Manningham 4 Notre Dame-Michigan State, 2006
Consecutive 100-Yard Receiving Games
1. Mario Manningham 6 at Northwestern-Wisconsin, 20072. Braylon Edwards 4
Michigan State-USC, 2003 Braylon Edwards 4 at Notre Dame-Indiana, 20044. Desmond Howard 3
Minnesota-Northwestern, 1991 Anthony Carter 3 Minnesota-Purdue, 1981 Marcus Knight 3 Purdue-Illinois, 1999 Mario Manningham 3 Notre Dame-Minnesota, 20068. Anthony Carter 2
Minnesota-Illinois, 1980 Anthony Carter 2 Illinois-Purdue, 1982 Tai Streets 2 Indiana-Minnesota, 1998 Marquise Walker 2 Ohio State-Tennessee, 2001 Braylon Edwards 2 Utah-Illinois, 2002 Braylon Edwards 2 Ohio State-Florida, 2002 Anthony Carter 2 UCLA-Michigan State, 1982 (Did not play against Indiana) Braylon Edwards 2 Ohio State-Texas, 2004 Roy Roundtree 2 Bowling Green-Indiana, 2010
Anthony Carter Braylon EdwardsDerrick Alexander
RUSHING RECORDS128 128RECORD BOOK
Average Yards Per Reception
Season (Min. 20 catches) 1. Jim Smith 28.3 1975 2. Jim Smith 27.5 1976 3. Greg McMurtry 23.1 1986 4. Greg McMurtry 22.6 1987 5. Dick Rifenburg 22.3 1948 6. Ralph Clayton 21.8 1978 7. Marcus Knight 20.4 1999 8. Amani Toomer 20.3 1994 9. Ralph Clayton 19.9 1977 Junior Hemingway 19.9 2011
Career (Min. 50 catches) 1. John Kolesar 23.4 1985-88 2. Jim Smith 23.1 1973-76 3. Ralph Clayton 20.8 1976-79 4. Greg McMurtry 19.5 1986-89 5. Anthony Carter 19.1 1979-82 6. Paul Jokisch 18.8 1984-86 7. Amani Toomer 18.6 1992-95 8. Junior Hemingway 18.3 2007- 9. Lowell Perry 17.8 1950-52 10. Mercury Hayes 17.3 1992-95
Season Receptions 1. Bennie Joppru 53 2002 2. Jim Mandich 50 1969 3. Jim Mandich 43 1968 4. Sim Nelson 41 1983 Jay Riemersma 41 1995 6. Sim Nelson 40 1984 7. Eric Kattus 38 1985 Tony McGee 38 1992 9. Craig Dunaway 35 1982 10. Doug Marsh 33 1979 Jerame Tuman 33 1996 Jay Riemersma 33 1994
Season Receiving Yards 1. Jim Mandich 662 1969 2. Doug Marsh 612 1979 3. Eric Kattus 582 1985 4. Bennie Joppru 579 2002 5. Jim Mandich 576 1968 6. Jerame Tuman 524 1996 7. Sim Nelson 494 1983 8. Craig Dunaway 488 1982 9. Tony McGee 467 1992 10. Sim Nelson 459 1984
Season Receiving Touchdowns 1. Eric Kattus 8 1985 2. Tony McGee 6 1992 Doug Marsh 6 1978 4. Jerame Tuman 5 1996 Jerame Tuman 5 1997 Bennie Joppru 5 2002 7. Jim Mandich 4 1969 Kevin Koger 4 2011 9. Jim Mandich 3 1968 Paul Seal 3 1972 Paul Seal 3 1973 Doug Marsh 3 1979 Craig Dunaway 3 1981 Craig Dunaway 3 1982 Sim Nelson 3 1983 Sim Nelson 3 1984 Derrick Walker 3 1989
Career Receptions1. Jack Clancy 132 1963-66
2. Jim Mandich 119 1967-69 3. Jerame Tuman 98 1995-98 4. Bennie Joppru 85 1999-2002 5. Sim Nelson 84 1982-84 6. Jay Riemersma 74 1992-95 7. Lowell Perry 71 1950-52 8. John Henderson 58 1963-64 9. Doug Marsh 57 1977-79 Tyler Ecker 57 2003-06 Kevin Koger 57 2008-11
Career Receiving Yards1. Jack Clancy 1,919 1963-66
2. Jim Mandich 1,508 1967-69 3. Jerame Tuman 1,279 1995-98 4. Lowell Perry 1,261 1950-52 5. Dick Rifenberg 1,006 1946-48 6. Sim Nelson 976 1982-84 7. Doug Marsh 947 1977-70 8. Ron Kramer 880 1954-56 9. Bennie Joppru 800 1999-2002 10. Craig Dunaway 775 1980-82
Season Receptions1. Chris Perry 44 2003
2. Gerald White 38 1986 Aaron Shea 38 1999 4. Chris Howard 37 1997 5. B.J. Askew 36 2002 5. Jamie Morris 33 1985 Jamie Morris 33 1986 Anthony Thomas 33 1999 9. Clarence Williams 27 1996 10. B.J. Askew 26 2001 Mike Hart 26 2004
Season Receiving Yards1. Gerald White 408 1986
2. Chris Perry 367 2003 3. Clarence Williams 361 1996 4. Aaron Shea 289 1999 5. Jamie Morris 287 1986 6. B.J. Askew 280 2002 7. Chris Howard 276 1997 8. Anthony Thomas 271 2000 9. B.J. Askew 257 2000 10. Mike Hart 237 2004
Season Receiving Touchdowns1. Gerald White 4 1985
2. Gerald White 3 1986 Aaron Shea 3 1999 B.J. Askew 3 2000 5. John Gabler 2 1967 B.J. Askew 2 2001 Chris Perry 2 2003 Vincent Smith 2 2009 Vincent Smith 2 2010 VIncent Smith 2 2011
Career Receptions1. Jamie Morris 99 1984-86
2. Anthony Thomas 88 1997-2000 3. B.J. Askew 83 1999-2002 4. Clarence Williams 68 1995-98 5. Mike Hart 67 2004-07 6. Chris Perry 66 2000-03 7. Gerald White 64 1984-86 8. Chris Howard 60 1994-97 9. Tyrone Wheatley 51 1991-94 10. Butch Woolfolk 38 1978-81
Career Receiving Yards1. B.J. Askew 777 1999-20022. Jamie Morris 756 1984-86
3. Chris Perry 572 2000-03 4. Gerald White 564 1984-86 5. Mike Hart 566 2004-07 6. Tyrone Wheatley 510 1991-94 7. Chris Howard 429 1994-97 8. Stanley Edwards 380 1977-81 9. Vincent Smith 354 2009- 10. Ron Johnson 345 1966-68
Running Back Receiving Records (Since 1967)Tight End Receiving Records (Since 1967)
Jack Clancy David TerrellJim Mandich
129RECORD BOOK
Player Rec. Yards Opponent DateRoy Roundtree 9 246 Illinois Nov. 6, 2010Jack Clancy 10 197 Oregon State Sept. 17, 1966Tai Streets 6 192 at Minnesota Oct. 31, 1998Braylon Edwards 11 189 Michigan State Oct. 30, 2004Derrick Alexander 7 188 Illinois Oct. 23, 1993Jim Smith 5 184 Purdue Nov. 8, 1975Mercury Hayes 7 179 Virginia Aug. 26, 1995Amani Toomer 7 179 Boston College Sept. 3, 1994Jack Clancy 11 179 Illinois Nov. 5, 1966Paul Staroba 6 178 at Wisconsin Oct. 31, 1970Amani Toomer 5 177 Minnesota Oct. 28, 1995Jason Avant 7 175 at Iowa Oct. 4, 2003Braylon Edwards 11 172 at Ohio State Nov. 20, 2004Tom Maentz 5 169 Iowa Oct. 29, 1955Desmond Howard 6 167 Mississippi Jan. 1, 1991Lowell Perry 5 165 Indiana Oct. 13, 1951Greg McMurtry 7 165 at Minnesota Nov. 18, 1989Ken Higgins 8 165 at Wisconsin Oct. 4, 1986Braylon Edwards 8 165 at Indiana Oct. 2, 2004Junior Hemingway 3 165 Notre Dame Sept. 10, 2011Mario Manningham 5 162 Minnesota Oct. 27, 2007Marquise Walker 15 160 Ohio State Nov. 24, 2001Marquise Walker 15 159 at Washington Sept. 8, 2001Amani Toomer 7 157 Penn State Oct. 15, 1994Jim Mandich 10 156 Purdue Oct. 11, 1969Anthony Carter 6 156 Illinois Nov. 7, 1981Desmond Howard 6 155 at Minnesota Oct. 25, 1991Anthony Carter 8 154 at Minnesota Oct. 31, 1981Adrian Arrington 9 153 vs. Florida (Capital One) Jan. 1, 2008Marquise Walker 9 150 at Michigan State Nov. 3, 2001David Terrell 10 150 vs. Alabama Jan. 1, 2000Tai Streets 12 150 at Northwestern Oct. 5, 1996Braylon Edwards 6 150 Iowa Sept. 25, 2004John Kolesar 4 148 Purdue Nov. 9, 1985Amani Toomer 6 147 Minnesota Nov. 12, 1994Jim Smith 4 147 Navy Sept. 25, 1976Mario Manningham 8 147 Purdue Oct. 13, 2007Dave Raimey 6 144 Purdue Oct. 21, 1961Braylon Edwards 13 144 at Oregon Sept. 20, 2003Jim Smith 5 143 Stanford Sept. 20, 1975Anthony Carter 9 142 at Minnesota Oct. 18, 1980Anthony Carter 4 141 North Carolina Dec. 28, 1979Desmond Howard 8 140 Michigan State Oct. 13, 1990Bump Elliott 2 138 Pittsburgh Oct. 11, 1947Mario Manningham 4 137 at Notre Dame Sept. 16, 2006David Terrell 4 136 vs. Auburn Jan. 1, 2001Marcus Knight 5 136 Purdue Oct. 2, 1999Amani Toomer 5 135 Texas A&M Dec. 28, 1995Marcus Knight 7 134 Illinois Oct. 23, 1999Marquise Walker 7 134 Purdue Oct. 13, 2001Marquise Walker 9 134 at Northwestern Nov. 4, 2000Junior Hemingway 9 134 Iowa Oct. 16, 2010Anthony Carter 8 133 Purdue Nov. 15, 1980Desmond Howard 6 133 at Notre Dame Sept. 15, 1990David Terrell 6 133 at Penn State Nov. 13, 1999Mercury Hayes 6 132 at Penn State Nov. 18, 1995Mario Manningham 5 131 at Minnesota Sept. 30, 2006Derrick Alexander 7 130 Minnesota Oct. 24, 1992Marquise Walker 7 130 Wisconsin Sept. 30, 2000Braylon Edwards 7 130 Ohio State Nov. 22, 2003Braylon Edwards 8 130 San Diego State Sept. 18, 2004Paul Jokisch 6 130 at Illinois Nov. 2, 1985Tai Streets 7 129 vs. Arkansas Jan. 1, 1999Braylon Edwards 12 129 at Notre Dame Sept. 11, 2004Mario Manningham 8 129 at Michigan State Nov. 3, 2007Junior Hemingway 3 219 at Indiana Oct. 2, 2010Martavious Odoms 7 129 Illinois Oct. 4, 2008Amani Toomer 8 128 at Penn State Nov. 18, 1995Anthony Carter 6 127 UCLA Dec. 31, 1981Mercury Hayes 6 127 Houston Sept. 25, 1993Dick Rifenburg 3 127 Iowa Pre-Flight Sept. 16, 1944Jim Smith 6 127 Illinois Nov. 13, 1976Tai Streets 4 127 Washington State Jan. 1, 1998Jason Avant 9 127 Northern Illinois Sept. 3, 2005Greg McMurtry 5 126 Maryland Sept. 30, 1989Jerame Tuman 5 126 Colorado Sept. 13, 1997Marcus Knight 5 126 at Notre Dame Sept. 5, 1998Roy Roundtree 5 126 at Indiana Oct. 2, 2010Roy Roundtree 10 126 Purdue Nov. 7, 2009Jack Clancy 8 125 Purdue Oct. 16, 1965Jim Mandich 4 125 Michigan State Oct. 12, 1968Anthony Carter 2 125 Ohio State Nov. 17, 1979Anthony Carter 5 125 at Illinois Nov. 6, 1982Marcus Knight 5 125 at Michigan State Oct. 9, 1999Ronald Bellamy 5 124 Michigan State Nov. 2, 2002Junior Hemingway 5 124 at Northwestern Oct. 8, 2011Mario Manningham 10 123 at Northwestern Sept. 29, 2007Anthony Carter 8 123 UCLA Sept. 25, 1982Eric Kattus 5 123 Indiana Oct. 26, 1985Anthony Carter 5 123 Michigan State Oct. 9, 1982
RECEIVING RECORDS
100-Yard Receivers (Since 1943)Player Rec Yds Opponent DateAnthony Carter 3 123 Purdue Nov. 13, 1982Ralph Clayton 5 122 at Northwestern Nov. 11, 1978Chris Perry 11 122 at Minnesota Oct. 10, 2003Anthony Carter 5 121 Illinois Oct. 25, 1980Doug Marsh 3 121 at California Sept. 29, 1979Darryl Stonum 3 121 Massachusetts Sept. 18, 2010Paul Jokisch 5 119 at Minnesota Nov. 16, 1985Roy Roundtree 9 118 Bowling Green Sept. 25, 2010Jim Berline 6 118 at Wisconsin Nov. 18, 1967Lowell Perry 5 118 Minnesota Oct. 27, 1951Tai Streets 9 118 at Ohio State Nov. 21, 1998Tony McGee 6 117 Washington Jan. 1, 1993Desmond Howard 9 117 at Indiana Oct. 27, 1990Tai Streets 8 117 Indiana Oct. 24, 1998Mario Manningham 8 117 Oregon Sept. 8, 2007David Terrell 9 117 at Northwestern Nov. 4, 2000Marcus Knight 7 116 at Ohio State Nov. 21, 1998David Terrell 6 116 at Illinois Sept. 23, 2000Roy Roundtree 9 116 Ohio State Nov. 21, 2009Paul Jokisch 5 115 at South Carolina Sept. 21, 1985Steve Breaston 7 115 vs. USC (Rose) Jan. 1, 2007David Terrell 8 115 Notre Dame Sept. 4, 1999Brad Myers 12 115 at Ohio State Nov. 22, 1958Dick Rifenburg 4 114 at Purdue Oct. 9, 1948Clarence Williams 6 114 Alabama Jan. 1, 1997Derrick Alexander 7 114 Illinois Nov. 14, 1992Braylon Edwards 7 114 at Iowa Oct. 4, 2003Roy Roundtree 7 114 Wisconsin Nov. 20, 2010Mario Manningham 7 113 Wisconsin Sept. 23, 2006Mario Manningham 3 113 at Wisconsin Nov. 10, 2007Amani Toomer 6 112 at Wisconsin Oct. 30, 1993Amani Toomer 3 112 at Northwestern Nov. 7, 1992Bump Elliott 3 112 Minnesota Oct. 25, 1947Braylon Edwards 9 112 at Northwestern Nov. 15, 2003Gene Topp 7 111 Iowa Oct. 10, 1953Doug Marsh 3 110 Wisconsin Nov. 3, 1979Anthony Carter 5 110 UCLA Jan. 1, 1983Steve Smith 7 110 Michigan State Oct. 9, 1965David Terrell 7 110 at Syracuse Sept. 18, 1999Braylon Edwards 4 110 vs. Florida (Outback) Jan. 1, 2003Ron Kramer 7 109 Missouri Sept. 24, 1955John Kolesar 4 109 Ohio State Nov. 23, 1985Steve Breaston 6 109 at Oregon Sept. 20, 2003Braylon Edwards 9 109 Utah Sept. 21, 2002Braylon Edwards 10 109 vs. Texas (Rose Bowl) Jan. 1, 2005Mario Manningham 9 109 at Illinois Oct. 20, 2007Tai Streets 5 108 at Wisconsin Nov. 15, 1997Marquise Walker 6 108 Western Michigan Sept. 22, 2001Desmond Howard 7 108 Purdue Nov. 2, 1991Chris Perry 6 108 vs. Florida (Outback) Jan. 1, 2003Jason Avant 7 108 at Wisconsin Sept. 24, 2005Mercury Hayes 6 107 Miami (Ohio) Sept. 30, 1995Carl Ward 5 107 Purdue Oct. 15, 1966Braylon Edwards 10 107 at Ohio State Nov. 23, 2002Braylon Edwards 10 107 vs. Southern Calif. (Rose) Jan. 1, 2004Mario Manningham 4 106 at Wisconsin Sept. 24, 2005Mercury Hayes 8 105 Washington State Sept. 4, 1993Jim Mandich 8 105 at Michigan State Oct. 18, 1969Jason Avant 7 105 at Iowa Oct. 22, 2005John Kolesar 3 104 Washington State Sept. 19, 1987Jack Clancy 4 104 Wisconsin Oct. 30, 1965Bob Nussbaumer 2 104 Purdue Nov. 17, 1945Junior Hemingway 6 104 Illinois Nov. 6, 2010John Henderson 6 103 Navy Oct. 5, 1963Derrick Alexander 7 103 Oklahoma State Sept. 19, 1992Jerry Imsland 6 103 at Duke Sept. 28, 1968Anthony Carter 2 103 at Purdue Nov. 14, 1981Braylon Edwards 7 103 at Michigan State Nov. 1, 2003Steve Breaston 3 103 at Indiana Nov. 11, 2006Junior Hemingway 5 103 Western Michigan Sept. 5, 2009Desmond Howard 4 102 Northwestern Nov. 9, 1991Triando Markray 3 102 Ohio State Nov. 19, 1983Adrian Arrington 6 102 Eastern Michigan Oct. 6, 2007Desmond Howard 8 101 at Michigan State Oct. 12, 1991John Gabler 10 101 Indiana Oct. 21, 1967Jerame Tuman 3 101 at Minnesota Oct. 26, 1996Tai Streets 8 101 at Notre Dame Sept. 5, 1998David Terrell 6 101 Indiana Oct. 14, 2000Braylon Edwards 4 101 at Illinois Sept. 28, 2002Ronald Bellamy 8 101 at Ohio State Nov. 23, 2002Adrian Arrington 7 101 at Wisconsin Nov. 10, 2007John Kolesar 3 100 Michigan State Oct. 11, 1986Leo Koceski 3 100 at Minnesota Oct. 23, 1948Marquise Walker 4 100 vs. Auburn Jan. 1, 2001Marquise Walker 5 100 vs. Tennessee Jan. 1, 2002David Terrell 6 100 at Indiana Oct. 30, 1999
RUSHING RECORDS130
Braylon Edwards (17)Yards Rec. Opponent, Year (Class)189 11 Michigan State, 2004 (Sr.)172 11 at Ohio State, 2004 (Sr.)165 8 at Indiana, 2004 (Sr.)150 6 vs. Iowa, 2004 (Sr.)144 13 at Oregon, 2003 (Jr.)130 7 Ohio State, 2003 (Jr.)130 8 San Diego State, 2004 (Sr.)129 12 at Notre Dame, 2004 (Sr.)114 7 at Iowa, 2003 (Jr.)112 9 at Northwestern, 2003 (Jr.)110 4 vs. Florida*, 2003 (So.)109 9 Utah, 2002 (So.)109 10 vs. Texas^, 2004 (Sr.)107 10 at Ohio State, 2002 (So.)107 10 vs. USC^, 2003 (Jr.)103 7 at Michigan St., 2003 (Sr.)101 4 at Illinois, 2002 (So.)* Outback Bowl / ^ Rose Bowl
Anthony Carter (14)Yards Rec. Opponent, Year (Class)156 6 Illinois, 1981 (Jr.)154 8 at Minnesota, 1981 (Jr.)142 9 at Minnesota, 1980 (So.)141 4 North Carolina, 1979 (Fr.)133 8 Purdue, 1980 (So.)127 6 UCLA, 1981 (Jr.)125 2 Ohio State, 1979 (Fr.)125 5 at Illinois, 1982 (Sr.)123 8 UCLA, 1982 (Sr.)123 5 Michigan State, 1982 (Sr.)123 3 Purdue, 1982 (Sr.)121 5 Illinois, 1980 (So.)110 5 UCLA, 1983 (Sr.)103 2 at Purdue, 1981 (Jr.)
Mario Manningham (11)Yards Rec. Opponent, Year (Class)162 5 Minnesota, 2007 (Jr.)147 8 Purdue, 2007 (Jr.)137 4 at Notre Dame, 2006 (So.)131 5 at Minnesota, 2006 (So.)129 8 at Michigan State, 2007 (Jr.)123 10 at Northwestern, 2007 (Jr.)117 8 Oregon, 2007 (Jr.)113 7 Wisconsin, 2006 (So.)113 3 at Wisconsin, 2007 (Jr.)109 9 at Illinois, 2007 (Jr.)106 4 at Wisconsin, 2005 (Fr.)
David Terrell (9)Yards Rec. Opponent, Year (Class)150 10 vs. Alabama*, 2000 (So.)136 4 vs. Auburn^, 2001 (Jr.)133 6 at Penn State, 1999 (So.)117 9 at Northwestern, 2000 (Jr.)116 6 at Illinois, 2000 (Jr.)115 8 Notre Dame, 1999 (So.)110 7 at Syracuse, 1999 (So.)101 6 Indiana, 2000 (Jr.)100 6 at Indiana, 1999 (So.)* Orange Bowl
Marquise Walker (9)Yards Rec. Opponent, Year (Class)160 15 Ohio State, 2001 (Sr.)159 15 at Washington, 2001 (Sr.)150 9 at Michigan St., 2001 (Sr.)134 7 Purdue, 2001 (Sr.)134 9 at Northwestern, 2000 (Jr.)130 7 Wisconsin, 2000 (Jr.)108 6 W. Michigan, 2001 (Sr.)100 4 vs. Auburn*, 2001 (Jr.)100 5 vs. Tennessee*, 2002 (Sr.)* Florida Citrus Bowl
Desmond Howard (8)Yards Rec. Opponent, Year (Class)167 6 Mississippi, 1991 (Jr.)155 6 at Minnesota, 1991 (Sr.)140 8 Michigan State, 1990 (Jr.)133 6 at Notre Dame, 1990 (Jr.)117 9 at Indiana, 1990 (Jr.)108 7 Purdue, 1991 (Sr.)
130RECORD BOOK
100-Yard Receiving Leaders102 4 Northwestern, 1991 (Sr.)101 8 at Michigan St., 1991 (Sr.)
Tai Streets (8)Yards Rec. Opponent, Year (Class)192 6 at Minnesota, 1998 (Sr.)150 12 at Northwestern, 1996 (So.)129 7 vs. Arkansas, 1999 (Sr.)127 4 Washington State, 1998 (Jr.)118 9 at Ohio State, 1998 (Sr.)117 8 Indiana, 1998 (Sr.)108 5 Wisconsin, 1997 (Jr.)101 8 at Notre Dame, 1998 (Sr.)
Amani Toomer (8)Yards Rec. Opponent, Year (Class)179 7 Boston College, 1994 (Jr.)177 5 Minnesota, 1995 (Sr.)157 7 Penn State 1994 (Jr.)147 6 Minnesota, 1994 (Jr.)135 5 Texas A&M, 1995 (Jr.)128 8 at Penn State, 1995 (Sr.)112 6 at Wisconsin, 1993 (So.)112 3 at Northwestern, 1992 (Fr.)
Junior Hemingway (6)Yards Rec. Opponent, Year (Class)165 3 Notre Dame, 2011 (Sr.)134 9 Iowa, 2010 (Jr.)129 3 at Indiana, 2010 (Jr.)124 5 at Northwestern, 2011 (Sr.)104 6 Illinois, 2010 (Jr.)103 5 W. Michigan, 2009 (So.)
Roy Roundtree (6)Yards Rec. Opponent, Year (Class)246 9 Illinois, 2010 (So.)126 5 at Indiana, 2010 (So.)126 10 Purdue, 2009 (Fr.)118 9 Bowling Green, 2010 (So.)116 9 Ohio State, 2009 (Fr.)114 7 Wisconsin, 2010 (So.)
Mercury Hayes (5)Yards Rec. Opponent, Year (Class)179 7 Virginia, 1995 (Sr.)132 6 at Penn State, 1995 (Sr.)127 6 Houston, 1993 (So.)107 6 Miami (Ohio), 1995 (Sr.)105 8 Washington St., 1993 (So.)
Marcus Knight (5)Yards Rec. Opponent, Year (Class)136 5 Purdue, 1999 (Sr.)134 7 Illinois, 1999 (Sr.)126 5 at Notre Dame, 1998 (Jr.)125 5 at Michigan St., 1999 (Sr.)116 7 at Ohio State, 1998 (Jr.)
Jack Clancy (4)Yards Rec. Opponent, Year (Class)197 10 Oregon State, 1966 (Sr.)179 11 Illinois, 1966 (Sr.)125 8 Purdue, 1965 (Jr.)104 4 Wisconsin, 1965 (Jr.)
Derrick Alexander (4)Yards Rec. Opponent, Year (Class)188 7 Illinois, 1993 (Sr.)130 7 Minnesota, 1992 (Jr.)114 7 Illinois, 1992 (Jr.)103 7 Oklahoma State, 1992 (Jr.)
Jason Avant (4)Yards Rec. Opponent, Year (Class)175 7 at Iowa, 2003 (So.)127 9 Northern Illinois, 2005 (Sr.)108 7 at Wisconsin, 2005 (Sr.)105 7 at Iowa, 2005 (Sr.)
John Kolesar (4)Yards Rec. Opponent, Year (Class)148 4 Purdue, 1985 (Fr.)109 4 Ohio State, 1985 (Fr.)104 3 Washington State, 1987 (Jr.)100 3 Michigan State, 1986 (So.)
Jim Smith (4)Yards Rec. Opponent, Year (Class)184 5 Purdue, 1975 (Jr.)147 4 Navy, 1976 (Sr.)143 5 Stanford, 1975 (Jr.)127 6 Illinois, 1976 (Sr.)
Adrian Arrington (3)Yards Rec. Opponent, Year (Class)153 9 vs. Florida*, 2007 (Sr.)102 6 Eastern Michigan, 2007 (Sr.)101 7 at Wisconsin, 2007 (Sr.)* Capital One Bowl
Steve Breaston (3)Yards Rec. Opponent, Year (Class)115 7 vs. USC, 2006 (Sr.)109 6 at Oregon, 2003 (Fr.)103 3 at Indiana, 2006 (Sr.)
Paul Jokisch (3)Yards Rec. Opponent, Year (Class)130 6 at Illinois, 1985 (Sr.)119 5 at Minnesota, 1985 (Sr.)115 5 at S. Carolina, 1985 (Sr.)
Jim Mandich (3)Yards Rec. Opponent, Year (Class)156 10 Purdue, 1969 (Sr.)125 4 Michigan State, 1968 (Jr.)105 8 Michigan State, 1969 (Sr.)
Ronald Bellamy (2)Yards Rec. Opponent, Year (Class)124 5 Michigan State, 2002 (Sr.)101 8 at Ohio State, 2002 (Sr.)
Bump Elliott (2)Yards Rec. Opponent, Year (Class)138 2 Pittsburgh, 1947 (Jr.)112 3 Minnesota, 1947 (Jr.)
Doug Marsh (2)Yards Rec. Opponent, Year (Class)121 3 at California, 1979 (Sr.)110 3 Wisconsin, 1979 (Sr.)
Greg McMurtry (2)Yards Rec. Opponent, Year (Class)165 7 at Minnesota, 1989 (Sr.)126 5 Maryland, 1989 (Sr.)
Chris Perry (2)Yards Rec. Opponent, Year (Class)122 7 at Minnesota, 2003 (Sr.)110 4 vs. Florida*, 2003 (Jr.)* Outback Bowl
Lowell Perry (2)Yards Rec. Opponent, Year (Class)165 5 Indiana, 1951 (Jr.)118 5 Minnesota, 1951 (Jr.)
Dick Rifenburg (2)Yards Rec. Opponent, Year (Class)127 3 Iowa Pre-Flight, 1944 (Fr.)114 4 at Purdue, 1948 (Sr.)
Jerame Tuman (2)Yards Rec. Opponent, Year (Class)126 5 Colorado, 1997 (Jr.)101 3 at Minnesota, 1996 (So.)
Jim Berline (1)Yards Rec. Opponent, Year (Class)118 6 at Wisconsin, 1967 (Sr.)
Ralph Clayton (1)Yards Rec. Opponent, Year (Class)122 5 at Northwestern, 1978 (Jr.)
John Gabler (1)Yards Rec. Opponent, Year (Class)101 10 Indiana, 1967 (So.)
John Henderson (1)Yards Rec. Opponent, Year (Class)103 6 Navy, 1963 (Jr.)
Ken Higgins (1)Yards Rec. Opponent, Year (Class)165 8 at Wisconsin, 1986 (Sr.)
Jerry Imsland (1)Yards Rec. Opponent, Year (Class)103 6 at Duke, 1968 (Jr.)
Eric Kattus (1)Yards Rec. Opponent, Year (Class)123 5 Indiana, 1985 (Sr.)
Leo Koceski (1)Yards Rec. Opponent, Year (Class)100 3 at Minnesota, 1948 (So.)
Ron Kramer (1)Yards Rec. Opponent, Year (Class)109 7 Missouri, 1955 (Jr.)
Tom Maentz (1)Yards Rec. Opponent, Year (Class)169 5 Iowa, 1955 (Jr.)
Triando Markray (1)Yards Rec. Opponent, Year (Class)102 3 Ohio State, 1983 (So.)
Tony McGee (1)Yards Rec. Opponent, Year (Class)117 6 Washington, 1993 (Sr.)
Brad Myers (1)Yards Rec. Opponent, Year (Class)115 12 at Ohio State, 1958 (Jr.)
Bob Nussbaumer (1)Yards Rec. Opponent, Year (Class)104 2 Purdue, 1945 (Sr.)
Martavious Odoms (1)Yards Rec. Opponent, Year (Class)129 7 Illinois, 2008 (Fr.)
Dave Raimey (1)Yards Rec. Opponent, Year (Class)144 6 Purdue, 1961 (Jr.)
Steve Smith (1)Yards Rec. Opponent, Year (Class)110 7 Michigan State, 1965 (Sr.)
Paul Staroba (1)Yards Rec. Opponent, Year (Class)178 6 at Wisconsin, 1970 (Sr.)
Darryl Stonum (1)Yards Rec. Opponent, Year (Class)121 3 Massachusetts, 2010 (Jr.)
Gene Topp (1)Yards Rec. Opponent, Year (Class)111 7 Iowa, 1953 (Sr.)
Carl Ward (1)Yards Rec. Opponent, Year (Class)107 5 Purdue, 1966 (Sr.)
Clarence Williams (1)Yards Rec. Opponent, Year (Class)114 6 Alabama, 1997 (So.)
131RECORD BOOKOFFENSIVE RECORDS
Total Offense
Average Gain Per PlaySeason (Min. 200 plays)
1. Drew Henson 7.93 20002. Denard Robinson 7.81 2010
3. Jim Harbaugh 7.63 19864. Elvis Grbac 7.43 19925. Todd Collins 7.36 19936. Rick Leach 7.36 19767. Todd Collins 7.26 19948. Denard Robinson 7.23 2011
8. Elvis Grbac 7.16 19919. Bob Chappuis 7.09 1947
10. Jim Harbaugh 6.91 1985
Career (Min. 400 plays)1. Denard Robinson 7.35 2009-2. Todd Collins 7.02 1991-94
3. Jim Harbaugh 6.89 1983-86 4. Elvis Grbac 6.80 1989-92 5. Brian Griese 6.68 1994-97 6. Steve Smith 6.62 1980-83 7. John Wangler 6.54 1976-80 8. Scott Dreisbach 6.45 1995-97 9. Tom Brady 6.40 1996-99 10. Rick Leach 6.25 1975-78
Average Yards Per GameSeason (Min. 10 games)
1. Denard Robinson 328.6 2010 2. Denard Robinson 268.3 2011 2. John Navarre 249.2 2003 3. John Navarre 222.2 2002 4. Jim Harbaugh 219.0 1986 5. Chad Henne 217.0 2004 6. Chad Henne 212.6 2005 7. Tom Brady 211.6 1999 8. Todd Collins 206.3 1994 9. Brian Griese 204.8 1997 10. Todd Collins 202.3 1993
Career (Min. 20 games)1. Denard Robinson 217.0 2009-
2. John Navarre 208.3 2000-03 3. Chad Henne 197.9 2004-07 4. Jim Harbaugh 186.6 1983-86 5. Steve Smith 172.5 1980-83 6. Tom Brady 167.1 1996-99 7. Todd Collins 154.1 1991-94 8. Brian Griese 153.6 1994-97 9. Elvis Grbac 148.1 1989-92 10. Tom Harmon 143.3 1938-40
Career1. Chad Henne 1,567 2004-07
2. John Navarre 1,515 2000-03 3. Denard Robinson 1,092 2009- 4. Rick Leach 1,034 1975-78 5. Steve Smith 990 1980-83 6. Anthony Thomas 924 1997-00 7. Elvis Grbac 915 1989-92 8. Jim Harbaugh 837 1983-86 9. Todd Collins 812 1991-94 10. Jamie Morris 809 1984-87 Tom Brady 809 1996-9912. Brian Griese 731 1994-97 13. Butch Woolfolk 719 1978-81 14. Don Moorhead 708 1968-70 15. Tyrone Wheatley 688 1991-94 16. Dennis Brown 652 1966-68 17. Dennis Franklin 642 1972-74
Season1. Denard Robinson 547 2010
2. John Navarre 505 2003 3. John Navarre 488 2002 4. Chad Henne 454 2004 5. Denard Robinson 445 2011 6. Chad Henne 436 2005 7. John Navarre 434 2001 8. Tom Brady 409 1998 9. Tate Forcier 399 2009 10. Don Moorhead 380 1969 11. Tom Brady 378 1999 12. Chad Henne 375 2006 13. Jim Harbaugh 371 1986 14. Brian Griese 369 199715. Dennis Brown 344 1968 Steve Smith 344 1981 17. Todd Collins 341 1994 18. Todd Collins 330 1993 19. Scott Dreisbach 329 199620. Steve Smith 323 1982
Game1. Denard Robinson .........................68 at Notre Dame, Sept. 11, 20102. Tom Brady ................................................65 at Ohio State, Nov. 21, 19983. Dennis Brown .........................................61 Indiana, Oct. 21, 1967 John Navarre...........................................61 at Oregon, Sept. 20, 20035. Don Moorhead ......................................60 at Michigan State, Oct. 18, 19696. Scott Dreisbach .....................................59 Virginia, Aug. 26, 19957. John Navarre...........................................58 vs. Southern California, Jan. 1, 20048. John Navarre...........................................55 Ohio State, Nov. 24, 2001 Chad Henne ............................................55 at Ohio State, Nov. 20, 200410. John Navarre...........................................54 at Iowa, Oct. 4, 2003
Most Plays
Most Yards Gained
Game1. Denard Robinson .......................502 at Notre Dame, Sept. 11, 20102. Denard Robinson .......................494 at Indiana, Oct. 2, 20103. Denard Robinson .......................454 at Northwestern, Oct. 8, 20114. Denard Robinson .......................446 Notre Dame, Sept. 10, 20115. Denard Robinson .......................383 Connecticut, Sept. 4, 20106. Denard Robinson .......................381 at Penn State, Oct. 30, 20107. John Navarre........................................ 368 at Iowa, Oct. 4, 20038. Denard Robinson .......................367 Illinois, Nov. 6, 20109. Denard Robinson .......................360 Wisconsin, Nov. 20, 201010. Scott Dreisbach .................................. 358 Virginia, Aug. 26, 1995
Season1. Denard Robinson 4,272 2010
2. John Navarre 3,276 20033. Denard Robinson 3,219 2011
4. John Navarre 2,889 20025. Jim Harbaugh 2,847 19866. Chad Henne 2,606 20047. Chad Henne 2,551 20058. Tom Brady 2,539 19999. Tom Brady 2,528 1998
10. Todd Collins 2,475 199411. Todd Collins 2,428 199312. Chad Henne 2,425 200613. Steve Smith 2,335 198114. John Navarre 2,317 200115. Tate Forcier 2,290 200916. Scott Dreisbach 2,121 199617. Jim Harbaugh 2,115 198518. Steve Smith 2,087 198319. Steve Smith 2,080 198220. Brian Griese 2,049 1997
Career1. Chad Henne 9,300 2004-07
2. John Navarre 9,031 2000-03 3. Denard Robinson 8,030 2009- 4. Steve Smith 6,554 1980-83 5. Rick Leach 6,460 1975-78 6. Elvis Grbac 6,221 1989-92 7. Jim Harbaugh 5,745 1983-86 8. Todd Collins 5,702 1991-94 9. Tom Brady 5,180 1996-99 10. Anthony Thomas 4,472 1997-00 11. Jamie Morris 4,393 1984-87 12. Brian Griese 4,302 1994-97 13. Tyrone Wheatley 4,178 1991-9414. Butch Woolfolk 3,861 1978-8115. Don Moorhead 3,641 1968-70 16. Dennis Franklin 3,511 1972-74 17. Bob Chappuis 3,487 1942-47 erage Gain Per Play
Rick Leach Don MoorheadJim Harbaugh Steve Smith
RUSHING RECORDS132 132RECORD BOOK
Combined Rushing/Receiving
Most Yards Gained
Most Plays
All-PurposeMost Plays
Most Yards Gained
Game1. Chris Perry ...............................................53 at Michigan State, Nov. 1, 20032. Anthony Thomas ...................................45 at Indiana, Oct. 30, 19993. Mike Hart .................................................44 Penn State, Sept. 22, 20074. Mike Hart .................................................43 at Illinois, Oct. 16, 20045. Ron Johnson ...........................................42 Northwestern, Nov. 4, 19676. Mike Hart .................................................41 Minnesota, Oct. 9, 20047. Butch Woolfolk .......................................39 at Michigan State, Oct. 10, 1981 Ricky Powers ...........................................39 Notre Dame, Sept. 14, 1991
Season1. Chris Perry 383 20032. Anthony Thomas 336 20003. Mike Hart 335 20064. Anthony Thomas 334 19996. T. Biakabutuka 308 1995
Mike Hart 308 20047. Jamie Morris 301 19878. Chris Perry 281 20029. Gordon Bell 280 1975
10. Lawrence Ricks 275 198211. Tony Boles 274 198812. Mike Hart 273 2007
Career1. Mike Hart 1,082 2004-07
2. Anthony Thomas 1,012 1997-00 3. Jamie Morris 908 1984-87 4. Chris Perry 877 2000-03 5. Butch Woolfolk 756 1978-81 6. Tyrone Wheatley 739 1991-94 7. Billy Taylor 596 1969-71 8. Rob Lytle 571 1973-76 9. Lawrence Ricks 558 1979-82 10. Ricky Powers 552 1990-93 11. Gordon Bell 545 1973-75 12. Russell Davis 544 1975-78 13. Ed Shuttlesworth 534 1971-73 Clarence Williams 534 1995-98 15. Harlan Huckleby 519 1975-78
Game1. Ron Johnson ........................................ 347 Wisconsin, Nov. 16, 19682. Tshimanga Biakabutuka .................. 313 Ohio State, Nov. 25, 19953. Ron Johnson ........................................ 289 Navy, Oct. 7, 19674. Jon Vaughn .......................................... 288 UCLA, Sept. 22, 19905. Denard Robinson .......................258 Notre Dame, Sept. 11, 20106. Mike Hart .............................................. 257 at Illinois, Oct. 16, 2004
Season1. Chris Perry 2,041 20032. Anthony Thomas 2,004 20003. T. Biakabutuka 1,868 19954. Jamie Morris 1,825 19875. Denard Robinson 1,702 2010
6. Mike Hart 1,692 20047. Mike Hart 1,687 20068. Ron Johnson 1,557 19689. Rob Lytle 1,550 1976
10. Butch Woolfolk 1,514 198111. Tyrone Wheatley 1,502 199212. Jon Vaughn 1,487 199013. Tony Boles 1,478 198814. Gordon Bell 1,472 1975
Career1. Mike Hart 5,624 2004-07
2. Anthony Thomas 5,273 1997-00 3. Jamie Morris 5,149 1984-87 4. Tyrone Wheatley 4,688 1991-94 5. Chris Perry 4,269 2000-03 6. Butch Woolfolk 4,126 1978-81 7. Rob Lytle 3,475 1973-76 8. Anthony Carter 3,289 1979-82 9. Denard Robinson 3,216 2009- 10. Billy Taylor 3,170 1969-71 11. Gordon Bell 3,003 1973-7512. T. Biakabutuka 2,933 1993-95 13. Lawrence Ricks 2,863 1979-8214. Ron Johnson 2,785 1966-68 15. Harlan Huckleby 2,781 1975-78 16. Russell Davis 2,776 1975-78
Game1. Chris Perry ...............................................53 at Michigan State, Nov. 1, 20032. Anthony Thomas ...................................46 at Indiana, Oct. 30, 19993. Ron Johnson ...........................................44 Northwestern, Nov. 4, 19674. Mike Hart .................................................43 at Illinois, Oct. 16, 20045. Mike Hart .................................................41 Minnesota, Oct. 9, 20046. Tony Boles ................................................40 Miami (Fla.), Sept. 17, 1988
Season 1. Chris Perry 383 2003 2. Anthony Thomas 345 1999 3. Anthony Thomas 336 2000 4. Mike Hart 335 2006 5. Jamie Morris 309 1987 T. Biakabutuka 309 1995 7. Mike Hart 308 2004 8. Gordon Bell 293 1975 9. Tony Boles 288 1988 10. Chris Perry 282 2002 11. Ron Johnson 278 1968 12. Lawrence Ricks 275 1982 13. Mike Hart 273 2007 14. Butch Woolfolk 262 1981
Career 1. Mike Hart 1,082 2004-07 2. Anthony Thomas 1,043 1997-00 3. Jamie Morris 960 1984-87 4. Chris Perry 882 2000-03 5. Tyrone Wheatley 771 1991-94 6. Butch Woolfolk 756 1978-81 7. Billy Taylor 605 1969-71 8. Rob Lytle 579 1973-76 9. Clarence Williams 564 1995-98 10. Gordon Bell 561 1973-75 Lawrence Ricks 561 1979-82 12. Ron Johnson 554 1966-68 13. Ricky Powers 553 1990-93 14. Russell Davis 544 1975-78 15. Ed Shuttlesworth 534 1971-73
Game1. Ron Johnson ........................................ 387 Wisconsin, Nov. 16, 19682. Bennie McRae...................................... 383 Purdue, Oct. 21, 19613. Ron Johnson ........................................ 346 Navy, Oct. 7, 674. Tshimanga Biakabutuka .................. 326 Ohio State, Nov. 25, 19955. Tyrone Wheatley ................................ 318 Notre Dame, Sept. 11, 19936. Steve Breaston .................................... 315 vs. Texas (Rose Bowl), Jan. 1, 2005 Martavious Odoms ....................315 vs. Illinois, Oct. 4, 2008
Season 1. Chris Perry 2,041 2003 2. Anthony Thomas 2,004 2000 3. Jamie Morris 1,972 1987 4. T. Biakabutuka 1,881 1995 5. Desmond Howard 1,859 1991 6. Tony Boles 1,816 1988 7. Tyrone Wheatley 1,784 1992 8. Gordon Bell 1,714 1975 9. Ron Johnson 1,704 1968 10. Denard Robinson 1,702 2010 11. Jamie Morris 1,693 1986 12. Mike Hart 1,692 2004 13. Mike Hart 1,687 2006 14. Ron Johnson 1,682 1967
Career 1. Jamie Morris 6,201 1984-87 2. Anthony Thomas 6,000 1997-00 3. Anthony Carter 5,799 1979-82 4. Mike Hart 5,624 2004-07 5. Steve Breaston 5,609 2003-06 6. Tyrone Wheatley 5,358 1991-94 7. Chris Perry 4,364 2000-03 8. Butch Woolfolk 4,126 1978-81 9. Desmond Howard 3,943 1989-91 10. Rob Lytle 3,615 1973-76 11. Mercury Hayes 3,511 1992-95 12. Ron Johnson 3,472 1966-6813. Billy Taylor 3,360 1969-71 14. Gordon Bell 3,335 1973-75 15. Amani Toomer 3,311 1992-95
Chris Perry
Jamie Morris
133RECORD BOOKSPECIAL TEAMS RECORDS
Punting
Game1. Chuck Ortmann .....................................24 at Ohio State, Nov. 25, 19502. Tom Harmon ...........................................12 Pennsylvania, Oct. 26, 1940 Zoltan Mesko ..........................................12 Ohio State, Nov. 17, 20074. Bill Billings................................................11 Michigan State, Sept. 29, 1951 Stan Kemp ...............................................11 at Michigan State, Oct. 8, 1966 Jason Vinson ...........................................11 Ohio State, Nov. 22, 19977. 7 times, last Eddie Azcona .................10 vs. Washington, Jan. 1, 1992
Season 1. Zoltan Mesko 80 2008 2. Hayden Epstein 71 2001 3. Zoltan Mesko 70 2007 4. Adam Finley 69 2002 5. Bill Billings 66 1951 Mark Werner 66 1968 7. Adam Finley 64 2004 8. Monte Robbins 62 1984 9. Barry Dotzauer 60 1971 10. Jason Vinson 57 1997 11. Jason Vinson 56 1998 John Anderson 56 1977 Don Bracken 56 1980
Career1. Zoltan Mesko 252 2006-09
2. Don Bracken 203 1980-83 3. Monte Robbins 200 1984-87 3. Adam Finley 190 2001-04 5. John Anderson 180 1974-77 6. Barry Dotzauer 167 1971-73 Hayden Epstein 167 1998-01 8. Stan Kemp 146 1964-66 9. Chris Stapleton 132 1989-93 10. Mark Werner 120 1968-69
Highest Average Per PuntGame (Min. 3 punts)
1. Don Bracken ....................................... 56.3Northwestern, Oct. 24, 1981
2. Zoltan Mesko ...................................... 53.8at Iowa, Oct. 10, 2009
3. Darrell Harper ..................................... 53.3Oregon State, Oct. 10, 1959
4. Monte Robbins .................................. 52.3 at Michigan State, Oct. 10, 19875. Monte Robbins .................................. 52.0 Washington, Sept. 15, 1984
Season (Min. 30 punts)1. Zoltan Mesko 44.46 2009
2. Will Hagerup 43.64 2010 3. Monte Robbins 43.63 1984 3. Monte Robbins 43.62 1986 4. Monte Robbins 43.51 1987 5. Don Bracken 43.34 1981 6. Adam Finley 43.00 2004 7. Zoltan Mesko 42.95 2008 8. Don Bracken 42.67 1980 9. Adam Finley 42.20 2002 10. Zoltan Mesko 41.58 2006 11. Paul Staroba 41.48 1970 12. Chris Stapleton 41.47 1993 13. John Anderson 41.47 1976 14. Zoltan Mesko 41.09 2007 15. John Anderson 40.52 1977 16. Hayden Epstein 40.44 2000 17. Monte Robbins 40.35 1985
Career (Min. 75 punts)1. Monte Robbins 42.8 1984-87
2. Zoltan Mesko 42.5 2006-09 3. Adam Finley 41.9 2001-04 4. Don Bracken 40.8 1980-83 5. Chris Stapleton 40.3 1989-93 6. Hayden Epstein 39.9 1998-01 7. John Anderson 39.5 1974-77 8. Barry Dotzauer 39.2 1971-73 9. Bob Wiese 39.0 1942-46 10. Wally Teninga 38.7 1945-49 11. Jason Vinson 38.7 1995-98 12. Mark Werner 37.9 1968-69
Most Punts
Most Yards Punting
Game1. Chuck Ortmann .................................. 723 at Ohio State, Nov. 25, 19502. Zoltan Mesko ....................................... 551 Ohio State, Nov. 17, 20073. Tom Harmon ........................................ 442 Pennsylvania, Oct. 26, 19404. Stan Kemp ............................................ 440 at Michigan State, Oct. 8, 19665. Paul Staroba ......................................... 401 Arizona, Sept. 19, 19706. Hayden Epstein ................................... 400 at UCLA, Sept. 16, 2000
Season 1. Zoltan Mesko 3,436 2008 2. Adam Finley 2,909 2002 3. Zoltan Mesko 2,876 2007 4. Hayden Epstein 2,760 2001 5. Adam Finley 2,751 2004 6. Monte Robbins 2,705 1984 7. Mark Werner 2,438 1968 8. Barry Dotzauer 2,416 1971 9. Don Bracken 2,389 1980 10. Zoltan Mesko 2,312 2009
Career1. Zoltan Mesko 10,703 2006-09
2. Monte Robbins 8,562 1984-87 3. Don Bracken 8,273 1980-83 4. Adam Finley 7,953 2001-04 5. John Anderson 7,108 1974-77 6. Hayden Epstein 6,657 1998-01 7. Barry Dotzauer 6,554 1971-73 8. Stan Kemp 5,467 1964-66 9. Chris Stapleton 5,322 1989-93 10. Mark Werner 4,553 1968-69 11. Jason Vinson 4,376 1995-96
Adam Finley Monte RobbinsChuck Ortmann Hayden Epstein
RUSHING RECORDS134 134RECORD BOOK
Field GoalsHighest Field Goal Percentage
Season (Min. 10 attempts)1. J.D. Carlson 92.9 (14) 19892. K.C. Lopata 91.7 (12) 20073. Bob Bergeron 88.2 (17) 19834. Garrett Rivas 85.0 (20) 20065. Remy Hamilton 83.3 (30) 19946. Bob Bergeron 81.3 (16) 19847. Ali Haji-Sheikh 80.0 (15) 1982
Mike Gillette 80.0 (15) 19879. Garrett Rivas 79.2 (24) 2004
10. Jeff Del Verne 78.6 (14) 199911. Jay Feely 77.3 (22) 199812. Remy Hamilton 75.0 (24) 1996 Garrett Rivas 75.0 (12) 200314. Kraig Baker 73.7 (19) 199715. Jason Olesnavage 73.3 (15) 2009
Career (Min. 15 attempts)1. Bob Bergeron 82.9 (35) 1981-84
2. Garrett Rivas 78.0 (82) 2003-06 3. K.C. Lopata 77.8 (27) 2007-08 4. Jay Feely 76.9 (26) 1995-98 5. Remy Hamilton 76.8 (82) 1993-96 6. Jeff Del Verne 75.0 (20) 1999-00 7. Mike Gillette 70.4 (81) 1985-88 8. Bob Wood 69.2 (26) 1975-76 9. J.D. Carlson 68.4 (57) 1989-91 10. Kraig Baker 68.2 (22) 1994-98 11. Pat Moons 66.7 (18) 1985-86 12. Hayden Epstein 61.9 (42) 1998-01 13. Ali Haji-Sheikh 59.6 (52) 1979-8214. Brendan Gibbons 57.9 (19) 2010- 15. Peter Elezovic 57.7 (26) 1990-93
Consecutive F.G. Made 14 Remy Hamilton 1996 9 K.C. Lopata 2007
40-Yard Field GoalsSeason
7 Ali Haji-Sheikh 1982 6 Jay Feely 1998 5 Remy Hamilton 1996 5 J.D. Carlson 1989 4 Mike Gillette 1987 4 Mike Gillette 1988 4 Bob Bergeron 1983 4 Bob Bergeron 1984 4 Hayden Epstein 2001 4 Garrett Rivas 2004 4 Jason Olesnavage 2009
Career 13 Mike Gillette 1985-88 13 Garrett Rivas 2003-06 11 J.D. Carlson 1989-91 11 Ali Haji-Sheikh 1979-82 10 Remy Hamilton 1993-96 8 Bob Bergeron 1981-84 8 Hayden Epstein 1998-01 7 Jay Feely 1995-98 6 Bob Wood 1975-76
50-Yard Field GoalsCareer
4 Hayden Epstein 1998-01 3 Bob Bergeron 1987-84 2 Mike Gillette 1985-88 2 J.D. Carlson 1989-91 2 Mike Lantry 1972-74 2 Jay Feely 1995-98
Most Field Goals Scored
Most Field Goals Attempted
Game1. Mike Gillette .............................................. 5 Minnesota, Nov. 5, 1988 J.D. Carlson ................................................ 5 Illinois, Nov. 10, 1990 K.C. Lopata ................................................. 5 at Minnesota, Nov. 8, 20084. J.D. Carlson ................................................ 4 at UCLA, Sept. 23, 1989 Bob Bergeron ........................................... 4 Illinois, Oct. 27, 1984 Bob Wood .................................................. 4 Stanford, Sept. 20, 1975 Remy Hamilton ........................................ 4 at Notre Dame, Sept. 10, 1994 Remy Hamilton ........................................ 4 Michigan State, Oct. 8, 1994 Remy Hamilton ........................................ 4 at Illinois, Oct. 22, 1994 Jeff Del Verne............................................ 4 Notre Dame, Sept. 4, 1999 Garrett Rivas ............................................. 4 at Notre Dame, Sept. 11, 2004
Season 1. Remy Hamilton 25 1994 2. Remy Hamilton 19 1995 Garrett Rivas 19 2004 Garrett Rivas 19 2005 5. Remy Hamilton 18 1996 Mike Gillette 18 1988 7. Jay Feely 17 1998 Garrett Rivas 17 2006 9. Mike Gillette 16 1985 J.D. Carlson 16 199011. Bob Bergeron 15 198312. Kraig Baker 14 1997 13. Bob Bergeron 13 1984 J.D. Carlson 13 1989 Hayden Epstein 13 2001
Career 1. Garrett Rivas 64 2003-06
2. Remy Hamilton 63 1993-96 3. Mike Gillette 57 1985-88 4. J.D. Carlson 39 1989-91 5. Ali Haji-Sheikh 31 1979-82 6. Bob Bergeron 29 1981-84 7. Hayden Epstein 26 1998-01 8. Mike Lantry 21 1972-74 K.C. Lopata 21 2007-0810. Jay Feely 20 1995-98 11. Bob Wood 18 1975-7612. Peter Elezovic 15 1990-93 Kraig Baker 15 1994-97 Jeff Del Verne 15 1999-0015. Dana Coin 13 1969-71
Game1. Tim Killian .................................................. 5 Ohio State, Nov. 22, 1969 Bob Wood .................................................. 5 Stanford, Sept. 20, 1975 Bob Bergeron ........................................... 5 Illinois, Oct. 27, 1984 Mike Gillette .............................................. 5 Miami (Fla.), Sept. 17, 1988 Mike Gillette .............................................. 5 Minnesota, Nov. 5, 1988 J.D. Carlson ................................................ 5 Illinois, Nov. 10, 1990 Remy Hamilton ........................................ 5 at Notre Dame, Sept. 10, 1994 Remy Hamilton ........................................ 5 at Illinois, Oct. 22, 1994 Jeff Del Verne............................................ 5 Notre Dame, Sept. 4, 1999 Garrett Rivas ............................................. 5 at Purdue, Oct. 23, 2004 K.C. Lopata ................................................. 5 at Minnesota, Nov. 8, 2008
Season 1. Remy Hamilton 30 19942. Mike Gillette 27 1988
Remy Hamilton 27 19954. J.D. Carlson 26 1990
Garrett Rivas 26 20056. Remy Hamilton 24 1996
Garrett Rivas 24 20048. Mike Gillette 23 19859. Jay Feely 21 1998
10. Mike Lantry 20 1974 Hayden Epstein 20 2001 Garrett Rivas 20 200613. Kraig Baker 19 199714. J.D. Carlson 18 199115. Ali Haji-Sheikh 17 1980 Bob Bergeron 17 1983
Career 1. Remy Hamilton 82 1993-96
Garrett Rivas 82 2003-06 3. Mike Gillette 81 1985-88 4. J.D. Carlson 57 1989-91 5. Ali Haji-Sheikh 52 1979-82 6. Mike Lantry 47 1972-74 7. Hayden Epstein 42 1998-01 8. Bob Bergeron 35 1981-84 9. Dana Coin 27 1969-71 K.C. Lopata 27 2007-08 11. Bob Wood 26 1975-76 Peter Elezovic 26 1990-93 Jay Feely 26 1995-98 14. Tim Killian 25 1968-70 Gregg Willner 25 1977-78
Mike Gillette Bob Bergeron Remy Hamilton
135RECORD BOOKSPECIAL TEAMS RECORDS
Kick Scoring
Game1. Ali-Haji Sheikh ........................................10 Illinois, Nov. 7, 19812. Jim Brieske ................................................. 9 Pittsburgh, Oct. 11, 1947 Dana Coin .................................................. 9 Iowa, Nov. 6, 1971 Bob Wood .................................................. 9 Navy, Sept. 25, 1976 Gregg Willner ............................................ 9 Northwestern, Nov. 5, 1977 Mike Gillette .............................................. 9 Illinois, Nov. 1, 1986
Most Point-After-Touchdowns Scored
Season 1. Dana Coin 55 1971 Bob Wood 55 1976 3. Jim Brieske 52 1947 J.D. Carlson 52 1991 Peter Elezovic 52 1992 Brendan Gibbons 52 2011 7. Garrett Rivas 50 2003 8. Gregg Willner 47 1978 J.D. Carlson 47 1990 10. Mike Lantry 42 1973 Gregg Willner 42 1977 Garrett Rivas 42 2006 Seth Broekhuizen 42 2010
Career 1. Garrett Rivas 162 2003-06 2. J.D. Carlson 137 1989-91 3. Mike Gillette 130 1985-88 4. Ali Haji-Sheikh 117 1979-82 5. Mike Lantry 113 1972-74 6. Jim Brieske 107 1942-47 7. Gregg Willner 94 1977-78 8. Peter Elezovic 92 1990-93 9. Remy Hamilton 91 1993-96 10. Bob Wood 87 1975-76
Most Point-After-Touchdowns Attempted
Season 1. Bob Wood 57 1976 Jim Brieske 57 1947 3. Dana Coin 55 1971 Peter Elezovic 55 1992 5. Brendan Gibbons 53 2011 6. J.D. Carlson 52 1991 7. Garrett Rivas 51 2003 8. Gregg Willner 48 1978 9. J.D. Carlson 47 1990 10. Gregg Willner 44 1977 Garrett Rivas 44 2006
Career 1. Garrett Rivas 171 2003-06 2. J.D. Carlson 139 1989-91 3. Mike Gillette 133 1985-88 4. Jim Brieske 120 1942-47 Mike Lantry 120 1972-74 Ali Haji-Sheikh 120 1979-82 7. Gregg Willner 97 1977-78 Remy Hamilton 97 1993-96 9. Peter Elezovic 96 1990-93 10. Bob Wood 92 1975-76
Most Point-After-Touchdown, No Misses
Game1. Ali-Haji Sheikh ........................................10 Illinois, Nov. 7, 1981
Most Consecutive Point After Touchdowns
Career 1. J.D. Carlson 126 1988-91 2. Ali Haji-Sheikh 76 1979-82 3. Mike Gillette 66 1985-88 4. Dana Coin 55 1969-71 5. Brendan Gibbons 50 2010-
Highest PAT Conversion Percentage
Season (Min. 25 attempts) 1. Dana Coin 100.0 (55) 1971 J.D. Carlson 100.0 (52) 1991 J.D. Carlson 100.0 (47) 1990 Ali Haji-Sheikh 100.0 (41) 1982 Ali Haji-Sheikh 100.0 (35) 1981 Rick Sygar 100.0 (32) 1966 Hayden Epstein 100.0 (37) 2001 Mike Gillette 100.0 (26) 1986 8. Brendan Gibbons 98.1 (53) 2011 9. Garrett Rivas 98.0 (51) 2003 10. Gregg Willner 97.9 (48) 1978 11. Mike Lantry 97.7 (43) 1973 12. Jay Feely 97.6 (41) 1998
Career (Min. 50 attempts) 1. J.D. Carlson 98.6 (139) 1989-91 2. Rick Sygar 98.1 (53) 1964-66 3. Mike Gillette 97.7 (133) 1985-88 4. Ali Haji-Sheikh 97.5 (120) 1979-82 5. Dana Coin 97.2 (72) 1969-71 7. Brendan Gibbons 97.1 (67) 2010- 6. Gregg Willner 96.9 (97) 1977-78 8. Hayden Epstein 96.6 (88) 1998-01 9. Peter Elezovic 95.8 (96) 1990-93 10. Garrett Rivas 94.7 (171) 2003-06 11. Bob Wood 94.6 (92) 1975-7612. Mike Lantry 94.2 (120) 1972-74 13. Remy Hamilton 93.8 (97) 1993-96
Ali-Haji Sheikh Garrett Rivas J.D. Carlson
Famous Michigan Field Goals (Since 1914)
Date Qtr/Time Opponent Distance Kicker ResultOct. 17, 1914 4th at Michigan State 25 Splawn Michigan wins, 3-0Nov. 20,1920 2nd at Minnesota 30 Steketee Michigan wins, 3-0Oct. 29, 1921 2nd at Illinois Steketee Michigan wins, 3-0Oct. 21, 1922 1st at Ohio State 11 Goebel 1st points scored in Ohio StadiumOct. 13, 1923 2nd Vanderbilt 11 Blott M wins 3-0, halts V and 21-g UB strk.Oct. 24, 1925 2nd at Illinois 15 Friedman M wins 3-0 to avenge 1924 lossNov. 3, 1928 1st Illinois 25 Gembis 1st Michigan field goal in ‘M’ StadiumNov. 17, 1928 N/A Michigan State 21 Hughes Michigan wins, 3-0Nov. 19, 1932 2nd at Minnesota 15 Newman M wins 3-0 to become BT and Natl C.Sept. 23, 1967 4th/0:11 Duke 27 Titas Michigan wins, 10-7Nov. 13, 1971 4th/0:26 at Purdue 25 Coin Michigan wins, 20-17Nov. 18, 1972 4th/1:00 Purdue 30 Lantry Michigan wins, 9-6Sept. 22, 1973 2nd/14:51 Stanford 50 Lantry 1st 50-yd FG in Michigan historySept. 20, 1975 4th/1:36 Stanford 42 Wood Michigan ties, 19-19Oct. 22, 1983 4th/0:08 Iowa 45 Bergeron Michigan wins 16-13Oct. 18, 1986 4th/0:00 Iowa 34 Gillette M wins battle of unbeatens, 20-17Sept. 23, 1989 4th/0:01 at UCLA 24 Carlson Michigan wins, 24-23Nov. 24, 1990 4th/0:00 at Ohio State 37 Carlson M wins, 16-13 to tie for Big Ten titleNov. 14, 1992 4th/0:16 Illinois 39 Elezovic 22-22 tie earns Rose Bowl berthSept. 10, 1994 4th/0:00 at Notre Dame 42 Hamilton Michigan wins, 26-24Aug. 31, 2002 4th/0:00 Washington 44 Brabbs Michigan wins, 31-29Oct. 10, 2003 4th, 0:47 at Minnesota 33 Rivas U-M scores 31 points in 4th to win 38-35Oct. 1, 2005 OT at Michigan State 35 Rivas U-M wins 34-31 in overtime
RUSHING RECORDS136 136RECORD BOOK
Total ReturnsGame
1. Steve Breaston .......................................11 vs. Nebraska (Alamo), Dec. 28, 20052. Julius Curry ..............................................10 Utah, Sept. 21, 20023. Gil Chapman ............................................. 8 Tulane, Sept. 30, 1972 Brian Carpenter........................................ 8 Notre Dame, Sept. 19, 1981 Todd Howard ............................................ 8 vs. Tennessee, Jan. 1, 20026. on 10 occasions Last: Martavious Odoms ................7 vs. Mississippi State, Jan. 1, 2011
Season1. Steve Breaston 54 20032. Steve Breaston 52 2004
Steve Breaston 52 20054. Steve Breaston 50 20065. Charles Woodson 44 19976. Jim Smith 40 1976 7. Anthony Carter 39 1980
Evan Cooper 39 1983 Darryl Stonum 39 2009 10. Anthony Carter 37 1979
Career1. Steve Breaston 208 2003-06
2. Anthony Carter 144 1979-82 3. John Kolesar 80 1985-88 4. Tripp Welborne 76 1987-90 Mercury Hayes 76 1992-95 6. Gil Chapman 72 1972-74 7. Gene Derricotte 69 1944-48 Desmond Howard 69 1989-91 Derrick Alexander 69 1989-93 Charles Woodson 69 1995-97
Most Returns
Game1. Steve Breaston .................................... 223 vs. Texas (Rose Bowl), Jan. 1, 20052. Darryl Stonum ..................................... 218 vs. Indiana, Sept. 26, 2009 Steve Breaston .................................... 218 vs. Nebraska (Alamo), Dec. 28, 20054. Steve Breaston .................................... 185 vs. Minnesota, Oct. 8, 20055. Tom Harmon ........................................ 184 at California, Sept. 28, 1940
Season1. Steve Breaston 1,002 20052. Darryl Stonum 1,001 2009
3. Steve Breaston 981 2004 4. Steve Breaston 810 2003 5. Steve Breaston 799 2006 6. Desmond Howard 694 1991 7. Anthony Carter 650 1979 8. Anthony Carter 630 1982 9. Anthony Carter 602 1981 10. Jim Smith 601 1976
Career1. Steve Breaston 3,592 2003-06
2. Anthony Carter 2,510 1979-82 3. Desmond Howard 1,548 1989-91 4. Darryl Stonum 1,538 2008-10 5. Martavious Odoms 1,317 2008- 6. Mercury Hayes 1,168 1992-95 7. Derrick Alexander 1,165 1989-93 8. Gil Chapman 1,104 1972-74 9. Jamie Morris 1,052 1984-87 10. John Kolesar 977 1985-88
Most Yards Returned
Highest Average Yards Per Return
Game (Min. 3 returns)1. Tom Harmon ....................................... 46.0 at California, Sept. 28, 19402. Desmond Howard ............................ 45.0 Michigan State, Oct. 13, 19903. Dave Raimey ....................................... 41.3 Ohio State, Nov. 25, 19614. Thom Darden ..................................... 40.3 UCLA, Sept. 25, 19715. Terry Barr .............................................. 37.7 Army, Oct. 8, 1955 Anthony Carter .................................. 37.7 at Notre Dame, Sept. 18, 1982
Season (Min. 15 returns) 1. Seth Smith 26.00 1994 2. Desmond Howard 24.30 1990 3. Martavious Odoms 22.00 2011 4. Jamie Morris 21.33 1986 5. Desmond Howard 21.03 1991 6. Gene Derricotte 20.88 1947 7. Jim Pace 20.13 1956 8. Mercury Hayes 20.00 1994 9. Todd Howard 19.54 2001
Career (Min. 40 returns) 1. Desmond Howard 22.43 1989-91 2. Jamie Morris 20.23 1984-87 3. Martavious Odoms 19.37 2008- 4. Anthony Carter 17.43 1979-82 5. Tom Harmon 17.42 1938-40 6. George Hoey 17.33 1967-68 7. Ron Johnson 17.27 1966-68 Steve Breaston 17.27 2003-06 9. Derrick Alexander 16.88 1989-93 10. Dave Raimey 16.48 1960-62
Returns for Touchdowns (Since 1948) 53 Punt Return David Brown at Michigan State 1973Yards Type Player Opponent Year 51 Punt Return Barry Pierson Wisconsin 1969 51 Interception William Peterson Eastern Michigan 1998 50 Interception Mike Jolly Texas A&M 1977 50 Interception Lance Dottin at Boston College 1991 50 Interception Dan Parks at Northwestern 1968 50 Interception Julius Curry at Ohio State 2000 49 Punt Return Gil Chapman Tulane 1972 48 Punt Return Derrick Alexander at Penn State 1993 46 Interception Ian Gold vs. Arkansas 1999 44 Interception Marty Huff at Duke 1968 43 Interception Clarence Thompson North Carolina St. 1993 43 Interception Andre Weathers Ohio State 1997 43 Punt Return Marlin Jackson at Wisconsin 2001 42 Interception Gary Prahst at Michigan State 1958 41 Punt Return Marquise Walker Indiana 2000 40 Interception Bruce Elliott at Illinois 1969 40 Interception Tom Seabron Northwestern 1975 36 Interception Chuck Winters Miami (Ohio) 1995 34 Interception Bennie McRae Duke 1961 34 Interception Jacob Stewart at Minnesota 2003 33 Interception Gary Prahst at Northwestern 1958 32 Interception Harry Allis Indiana 1950 32 Interception Randy Logan Tulane 1972 32 Interception Anthony Jordan Eastern Michigan 1998 31 Punt Return Marty Huff Vanderbilt 1969 31 Interception Prescott Burgess at Notre Dame 2006 30 Interception Dominic Tedesco at Purdue 1977 29 Interception Calvin O’Neal Navy 1976 29 Fumble Recovery Brandon Herron Western Michigan 2011 28 Punt Return Anthony Williams at Illinois 1995 27 Interception Martin Davis Maryland 1990 27 Interception Garland Rivers Wisconsin 1985 26 Punt Return Ron Kramer Michigan State 1954 26 Interception James Whitley vs. Arkansas 1999 25 Interception Grant Mason Iowa 2004 23 Punt Return Harry Allis Northwestern 1950 23 Interception John Henderson Northwestern 1963 23 Interception Dave Devich Northwestern 1975 22 Interception Lance Dottin Wisconsin 1989 19 Interception Marlin Jackson at Notre Dame 2002 17 Punt Return Dwayne Ware at Purdue 1990 12 Interception Max Pollock Central Michigan 2006 10 Punt Return Dave Elliott Virginia 1971 7 Punt Return Dwayne Ware Iowa 1990 5 Fumble Recovery Lawrence Reid San Diego State 2004 2 Fumble Recovery Markus Curry Purdue 2003 2 Punt Return Brandon Graham Delaware State 2009 1 Punt Return Edward Hood at Michigan State 1985 0 Fumble Recovery Tony Branoff Illinois 1952 0 Punt Return Anton Momsen at Ohio State 1950 0 Fumble Recovery Dave Rather at Northwestern 1971 0 Punt Return Roy Manning at Iowa 2001
Yards Type Player Opponent Year 100 Kickoff Return Seth Smith Wisconsin 1994 99 Kickoff Return Tyrone Wheatley Houston 1992 99 Kickoff Return Dennis Fitzgerald at Michigan State 1960 95 Kickoff Return Desmond Howard Michigan State 1990 95 Kickoff Return Steve Breaston Minnesota 2005 94 Kickoff Return Darryl Stonum Notre Dame 2009 94 Interception Brandon Herron Western Michigan 2011 93 Punt Return Desmond Howard Ohio State 1991 93 Kickoff Return Desmond Howard at Boston College 1991 92 Interception Ken Tureaud UCLA 1961 92 Interception Thom Darden UCLA 1971 90 Kick Return Dave Raimey Ohio State 1961 88 Punt Return David Brown Colorado 1974 88 Interception Ernest Shazor Miami (Ohio) 2004 85 Kickoff Return Tony Boles Purdue 1989 84 Punt Return Gilvanni Johnson at Minnesota 1985 83 Punt Return Darrell Harper at Minnesota 1959 83 Punt Return Gil Chapman Oregon 1973 83 Punt Return David Brown Navy 1972 83 Fumble Recovery Leon Hall at Northwestern 2005 83 Punt Return Steve Breaston at Indiana 2006 83 Fumble Recovery Courtney Avery Minnesota 2011 82 Punt Return Terry Barr Army 1955 81 Interception Mike Rotunno Missouri 1955 80 Punt Return Derrick Alexander Michigan State 1992 79 Punt Return Derrick Alexander North Carolina St. 1993 78 Punt Return Anthony Carter Northwestern 1979 78 Punt Return Charles Woodson Ohio State 1997 78 Missed FG Return Jeremy LeSueur at Oregon 2003 76 Punt Return Leon Hall at Indiana 2004 75 Punt Return Lowell Perry Minnesota 1951 74 Punt Return Steve Breaston Illinois 2003 73 Kickoff Return Gil Chapman at Illinois 1972 72 Punt Return Amani Toomer at Illinois 1994 72 Punt Return Anthony Carter at Notre Dame 1982 70 Punt Return Derrick Alexander at Indiana 1992 69 Punt Return Steve Breaston Indiana 2003 68 Interception David Brown Minnesota 1972 67 Punt Return Tom Hendricks Michigan State 1954 67 Punt Return Steve Breaston Northwestern 2004 65 Punt Return Jim Pace Iowa 1957 64 Punt Return Dick Sygar Illinois 1966 62 Interception Jerry Hartman at Indiana 1968 60 Punt Return George Hoey at Illinois 1967 60 Interception Thom Darden Indiana 1971 60 Interception Jerry Zuver Michigan State 1976 60 Interception Jeremy LeSueur Indiana 2003 58 Fumble Recovery Cam Gordon Western Michigan 2011 56 Interception Mike Shatusky Georgia 1957 56 Punt Return Amani Toomer at Indiana 1995 54 Interception Keith Bostic at Northwestern 1982 54 Punt Return Dave Raimey at Illinois 1961 54 Fumble Return LaMarr Woodley at Notre Dame 2006
Most Touchdowns ReturnedGame
1. Tom Harmon ............................................. 2 at California, Sept. 28, 1940
Season1. Gene Derricotte 3 19472. 14 times 2 2003
Last: Jeremy LeSueur Steve Breaston
Career1. Steve Breaston 5 2003-06
2. Gene Derricotte 4 1944-48 Dave Brown 4 1972-74 Derrick Alexander 4 1989-93 5. Tom Harmon 3 1938-40 Gil Chapman 3 1972-74 Desmond Howard 3 1989-91
137RECORD BOOKSPECIAL TEAMS RECORDS
Kickoff ReturnsHighest Average Yards Per
Kickoff ReturnGame (Min. 2 returns)
1. Gil Chapman ....................................... 62.5at Illinois, Oct. 21, 1972Seth Smith ........................................... 62.5Wisconsin, Oct. 29, 1994
3. Tony Boles ............................................ 52.5Purdue, Nov. 4, 1989
4. Anthony Carter .................................. 49.0 at Notre Dame, Sept. 20, 19805. Grant Mason ....................................... 45.3 at Indiana, Oct. 2, 2004
Season (Min. 10 returns)1. Dave Raimey 30.8 19612. Desmond Howard 29.6 19903. Anthony Carter 28.5 19804. Tony Boles 28.2 19895. Steve Breaston 28.1 20056. Derrick Alexander 27.8 19907. Desmond Howard 27.5 19918. Anthony Carter 27.1 19819. Seth Smith 26.0 1994
10. Anthony Carter 25.7 1982 Darryl Stonum 25.7 2009
Career (Min. 20 returns)1. Desmond Howard 26.9 1989-91
2. Anthony Carter 26.3 1979-82 3. Tony Boles 25.6 1987-89 4. Darryl Stonum 24.8 2008-10 5. Gil Chapman 24.7 1972-74 6. Steve Breaston 24.6 2003-06 7. Dave Raimey 24.1 1960-62 8. Derrick Alexander 23.4 1989-93 9. Anthony Thomas 23.2 1997-00 10. Walter Cross 22.1 1998-00 Jeremy LeSueur 22.1 2000-0312. Martavious Odoms 22.0 2008-
Most Kickoffs Returned for Touchdown
Season1. Desmond Howard 1 1990
Desmond Howard 1 1991 John Garrells 1 1906 Tom Harmon 1 1940 Chuck Ortmann 1 1949 Dennis Fitzgerald 1 1960 Dave Raimey 1 1961 Gil Chapman 1 1972 Tony Boles 1 1989 Tyrone Wheatley 1 1992 Seth Smith 1 1994 Steve Breaston 1 2005 Darryl Stonum 1 2009
Career1. Desmond Howard 2 1989-91
Season1. Darryl Stonum 39 2009
2. Steve Breaston 28 2004 3. Ron Johnson 26 1967 Jeremy LeSueur 26 2002 5. Steve Breaston 23 2005 6. Todd Howard 22 2001 7. Steve Breaston 21 2006 8. Boubacar Cissoko 20 2008 Martavious Odoms 20 2008 10. Anthony Carter 19 1979 Seth Smith 19 1994 12. Mercury Hayes 18 1995 13. Desmond Howard 17 199014. Jamie Morris 16 1984 Mercury Hayes 16 1994 Justin Fargas 16 1998 Carlos Brown 16 2007 Martavious Odoms 16 201117. Jim Smith 15 1976 Anthony Carter 15 1980 Anthony Carter 15 1981 Jamie Morris 15 1986 Desmond Howard 15 1991
Career1. Steve Breaston 81 2003-06
2. Anthony Carter 63 1979-82 3. Darryl Stonum 62 2008-10 4. Mercury Hayes 53 1992-95 5. Jamie Morris 52 1984-87 6. Martavious Odoms 51 2008-11 7. Desmond Howard 45 1989-91 8. Ron Johnson 40 1966-68 9. Jeremy LeSueur 35 2000-03 10. Tyrone Wheatley 31 1991-94 Anthony Thomas 31 1997-00 12. Clarence Williams 30 1995-98 13. Derrick Alexander 27 1989-93 Walter Cross 27 1998-00
Game1. Steve Breaston .................................... 221 vs. Texas (Rose Bowl), Jan. 1, 20052. Darryl Stonum............................218 vs. Indiana, Sept. 26, 20093. Steve Breaston .................................... 186 Minnesota, Oct. 8, 20054. Martavious Odoms ....................183 vs. Illinois, Oct. 4, 20085. Martavious Odoms ....................163 vs. Mississippi State, Jan. 1, 20116. Darryl Stonum............................158 vs. Purdue, Nov. 7, 20097. Steve Breaston .................................... 146 vs. Nebraska (Alamo), Dec. 28, 20058. Grant Mason ........................................ 136 at Indiana, Oct. 2, 20049. Desmond Howard ............................. 135 Michigan State, Oct. 13, 1990
Most Yards Returned
Season1. Darryl Stonum 1,001 2009
2. Steve Breaston 689 2004 3. Steve Breaston 646 2005 4. Jeremy LeSueur 583 2002 5. Desmond Howard 504 1990 6. Ron Johnson 498 1967 7. Seth Smith 472 1994 8. Todd Howard 469 2001 9. Steve Breaston 467 2006 Boubacar Cissoko 467 2008 11. Martavious Odoms 461 2008 12. Anthony Carter 427 1980 13. Anthony Carter 413 1979 14. Desmond Howard 412 1991 15. Anthony Carter 406 1981
Career1. Steve Breaston 1,993 2003-06
2. Anthony Carter 1,606 1979-82 3. Darryl Stonum 1,538 2008-10 4. Desmond Howard 1,211 1989-91 5. Martavious Odoms 1,123 2008-11 6. Jamie Morris 1,052 1984-87 7. Mercury Hayes 999 1992-95 8. Jeremy LeSueur 772 2000-03 9. Anthony Thomas 720 1997-99 10. Ron Johnson 687 1966-68 11. Tyrone Wheatley 673 1991-94 12. Gil Chapman 640 1972-74
Most ReturnsGame
1. Todd Howard ............................................ 8 vs. Tennessee, Jan. 1, 20022. Martavious Odoms ........................7 vs. Illinois, Oct. 4, 2008 Darryl Stonum................................7 vs. Indiana, Sept. 26, 2009 Martavious Odoms ........................7 vs. Mississippi State, Jan. 1, 20115. Jeremy LeSueur ....................................... 6 vs. Iowa, Oct. 26, 2002 Steve Breaston ......................................... 6 vs. Texas (Rose Bowl), Jan. 1, 2005 Darryl Stonum................................6 at Wisconsin, Nov. 14, 2009 Drew Dileo ......................................6 at Ohio State, Nov. 27, 20109. 10 Times ..................................................... 5 Last: Vincent Smith vs. Notre Dame, Sept. 10, 2011
Kickoff Returns for Touchdown (Since 1948)
Yards Player Opponent Date100 .............Seth Smith ................................Wisconsin ............................Oct. 29, 199499 ................Tyrone Wheatley .....................Houston ...............................Sept. 26, 199299 ................Dennis Fitzgerald ...................at Michigan State .............Oct. 1, 196095 ................Desmond Howard ..................Michigan State ..................Oct. 13, 199095 ................Steve Breaston ........................Minnesota ...........................Oct. 8, 200594 ........... Darryl Stonum.................. Notre Dame ................. Sept. 12, 200993 ................Desmond Howard ..................at Boston College .............Sept. 7, 199190 ................Dave Raimey ............................Ohio State ...........................Nov. 25, 196185 ................Tony Boles .................................Purdue ..................................Nov. 4, 198973 ................Gil Chapman ............................at Illinois ..............................Oct. 21, 1972Anthony Carter Steve Breaston
RUSHING RECORDS138 138RECORD BOOK
Punt ReturnsMost Returns
Most Yards Returned
Game1. Steve Breaston ......................................... 9 Wisconsin, Sept. 23, 20062. Brian Carpenter........................................ 8 Notre Dame, Sept. 19, 1981 Julius Curry ................................................ 8 Utah, Sept. 21, 20024. Tom Kuzma ................................................ 7 Iowa, Oct. 4, 1941 Gil Chapman ............................................. 7 Tulane, Sept. 30, 1972 Jim Smith ................................................... 7 at Ohio State, Nov. 20, 1976 Anthony Carter ........................................ 7 vs. UCLA, Dec. 31, 1981 Evan Cooper.............................................. 7 Northwestern, Oct. 15, 1983 Julius Curry ................................................ 7 Illinois, Sept. 29, 2001 Marquise Walker ...................................... 7 Purdue, Oct. 13, 2001
Season1. Steve Breaston 45 20032. Charles Woodson 33 19973. Tripp Welborne 32 19894. Evan Cooper 31 1983
Tripp Welborne 31 19906. Steve Breaston 29 2005
Steve Breaston 29 20068. Mike Jolly 28 1978
Julius Curry 28 2002 Greg Mathews 28 200711. Ronald Bellamy 27 200012. Bruce Elliott 26 1971 Jim Smith 26 1975 Derrick Alexander 26 1992
Career1. Steve Breaston 127 2003-06
2. Anthony Carter 79 1979-82 3. Tripp Welborne 67 1987-90 4. Gene Derricotte 55 1944-48 John Kolesar 55 1985-88 6. Jim Smith 51 1973-76 7. Dave Brown 48 1972-74 Julius Curry 48 1999-2002 9. Charles Woodson 44 1995-97 10. Wally Teninga 43 1945-49 Amani Toomer 43 1992-95
Game1. George Hoey ........................................ 140 at Minnesota, Oct. 28, 19672. Marquise Walker ................................. 127 Purdue, Oct. 13, 20013. Tripp Welborne ................................... 117 at Indiana, Oct. 27, 19904. Steve Breaston .................................... 116 Wisconsin, Sept. 23, 20065. Steve Breaston .................................... 112 Northwestern, Nov. 13, 2004
Season 1. Steve Breaston 619 2003 2. Tripp Welborne 455 1990 3. Gene Derricotte 396 1947 4. Derrick Alexander 371 1992 5. Steve Breaston 356 2005 6. Evan Cooper 344 1983 7. Steve Breaston 332 2006 8. Jim Smith 313 1976 9. Julius Curry 302 2002 10. Charles Woodson 301 1997
Career1. Steve Breaston 1,599 2003-06
2. Anthony Carter 904 1979-82 3. Tripp Welborne 773 1987-90 4. Gene Derricotte 751 1944-48 5. George Hoey 537 1967-68 6. Derrick Alexander 534 1989-93 7. Dave Brown 531 1972-74 8. Jim Smith 523 1973-76 9. Julius Curry 522 1999-2002 10. Wally Teninga 504 1945-49
Punt Returns for Touchdown (Since 1948)
Yards Player Opponent Date93...................Desmond Howard................... Ohio State ........................................ Nov. 23, 199188...................David Brown ............................. Colorado .......................................... Sept. 21, 197484...................Gilvanni Johnson..................... at Minnesota .................................. Nov. 16, 198583...................Darrell Harper ........................... at Minnesota .................................. Oct. 24, 195983...................Gil Chapman ............................. Oregon.............................................. Oct. 6, 197383...................David Brown ............................. Navy ................................................... Oct. 7, 197283...................Steve Breaston ......................... at Indiana ......................................... Nov. 11, 200682...................Terry Barr .................................... Army .................................................. Oct. 8, 195580...................Derrick Alexander ................... Michigan State ............................... Oct. 10, 199279...................Derrick Alexander ................... North Carolina State .................... Jan. 1, 199478...................Anthony Carter ........................ Northwestern ................................. Sept. 8, 197978...................Charles Woodson .................... Ohio State ........................................ Nov. 22, 199776...................Leon Hall .................................... at Indiana ......................................... Oct. 2, 200475...................Lowell Perry ............................... Minnesota ....................................... Oct. 27, 195174...................Steve Breaston ......................... Illinois ................................................ Oct. 18, 200373 ..............Martavious Odoms ............at Purdue ................................ Nov. 1, 200872...................Amani Toomer .......................... at Illinois ........................................... Oct. 22, 199472...................Anthony Carter ........................ at Notre Dame ............................... Sept. 18, 198270...................Derrick Alexander ................... at Indiana ......................................... Oct. 17, 199269...................Steve Breaston ......................... Indiana .............................................. Sept. 27, 200367...................Tom Hendricks ......................... Michigan State ............................... Nov. 13, 195467...................Steve Breaston ......................... Northwestern ................................. Nov. 13, 200465...................Jim Pace ...................................... Iowa ................................................... Nov. 2, 195764...................Dick Sygar .................................. Illinois ................................................ Nov. 5, 196660...................George Hoey ............................. at Illinois ........................................... Nov. 11, 196757...................Rick Sygar ................................... Minnesota ....................................... Oct. 22, 196656...................Amani Toomer .......................... at Indiana ......................................... Oct. 21, 199554...................Dave Raimey ............................. at Illinois ........................................... Nov. 11, 196153...................David Brown ............................. at Michigan State .......................... Oct. 13, 197351...................Barry Pierson ............................. Wisconsin ......................................... Nov. 1, 196949...................Gil Chapman ............................. Tulane ............................................... Sept. 30, 197248...................Derrick Alexander ................... at Penn State .................................. Oct. 16, 199343...................Marlin Jackson.......................... at Wisconsin .................................... Nov. 17, 200141...................Marquise Walker ...................... Indiana .............................................. Oct. 14, 200031...................Marty Huff .................................. Vanderbilt ........................................ Sept. 20, 196928...................Anthony Williams .................... at Illinois ........................................... Sept. 2, 199526...................Ron Kramer ................................ Michigan State ............................... Nov. 13, 195423...................Harry Allis ................................... Northwestern ................................. Nov. 18, 195017...................Dwayne Ware ............................ at Purdue ......................................... Nov. 3, 199010...................Dave Elliott ................................ Virginia .............................................. Sept. 18, 19717 .....................Dwayne Ware ............................ Iowa ................................................... Oct. 20, 19901 .....................Edward Hood ............................ at Michigan State .......................... Oct. 12, 19852 .....................Brandon Graham ..................... Delaware State............................... Oct. 17, 20090 .....................Anton Momsen ........................ at Ohio State ................................... Nov. 25, 19500 .....................Roy Manning ............................ at Iowa .............................................. Oct. 27, 2000
Most Punts Returned for Touchdown
Season1. Gene Derricotte 3 19472. Rick Sygar 2 1966
Dwayne Ware 2 1990 Derrick Alexander 2 1992 Derrick Alexander 2 1993 Steve Breaston 2 2003
Career1. Gene Derricotte 4 1944-48
Derrick Alexander 4 1989-93 Steve Breaston 4 2003-04 4. Dave Brown 3 1972-74 5. Rick Sygar 2 1964-66 Gil Chapman 2 1972-74 Anthony Carter 2 1979-82 Dwayne Ware 2 1989-92 Amani Toomer 2 1992-95
Desmond Howard struck the Heisman pose after setting a school record with his 93-yard punt return against Ohio State in 1991.
Highest Average Yards Per Punt Return
Game (Min. 2 returns)1. George Hoey ....................................... 49.5
Navy, Oct. 5, 19682. Darrell Harper ..................................... 48.0
at Minnesota, Oct. 24, 19593. Terry Barr .............................................. 47.0
Army, Oct. 8, 19554. Gil Chapman ....................................... 46.0
Oregon, Oct. 6, 19735. Barry Pierson ....................................... 41.5
Missouri, Oct. 1, 1969
Season (Min. 15 returns)1. Desmond Howard 15.7 19912. Terry Barr 14.8 19553. Tripp Welborne 14.7 19904. Derrick Alexander 14.3 19925. Anthony Carter 14.2 19826. Barry Pierson 14.0 19697. Gene Derricotte 13.9 19468. Steve Breaston 13.8 20039. Anthony Carter 13.3 1979
10. Jim Smith 12.5 197611. Steve Breaston 12.3 2005
Career (Min. 30 returns)1. George Hoey 17.3 1967-68
2. Gene Derricotte 13.7 1944-48 3. Derrick Alexander 12.7 1989-93 4. Steve Breaston 12.6 2003-06 5. Wally Teninga 11.7 1945-49 6. Tripp Welborne 11.5 1987-90 7. Rick Sygar 11.3 1964-66 8. Anthony Carter 11.2 1979-82 9. Dave Brown 11.1 1972-74 10. Julius Curry 11.0 1999-2002
139RECORD BOOKDEFENSIVE RECORDS
TacklesMost Double Digit
Tackle GamesSeason (since 1965)
1. Ron Simpkins 10 19772. Ron Simpkins 9 1978
Mike Boren 9 19814. Tom Kee 8 1972
Calvin O’Neal 8 1976 Steve Morrison 8 19947. Calvin O’Neal 7 1975
Sam Sword 7 1998 Paul Girgash 7 198110. Dennis Morgan 6 1967 Mike Taylor 6 1971 Dave Devich 6 1975 Curtis Greer 6 1979 Ron Simpkins 6 1979 Andy Cannavino 6 1979 Andy Cannavino 6 1980 Mike Boren 6 1982 Andy Moeller 6 1986 Jarrett Irons 6 1995 Jordan Kovacs 6 2010
Career (since 1970)1. Ron Simpkins 25 1976-79
2. Erick Anderson 19 1988-91 Jarrett Irons 19 1993-96 4. Mike Boren 17 1980-83 5. Calvin O’Neal 16 1974-76 Sam Sword 16 1995-98 7. Andy Cannavino 15 1977-80 Steve Morrison 15 1990-94 9. Paul Girgash 14 1979-82 Mike Mallory 14 1982-85 11. Andy Moeller 12 1983-86 12. Tom Kee 10 1970-72 Jordan Kovacs 10 2009-
Game (since 1966)1. Calvin O’Neal ..........................................24 at Purdue, Nov. 6, 19762. Tom Stincic ..............................................23 at Ohio State, Nov. 23, 1968 Steve Morrison .......................................23 Illinois, Nov. 14, 19924. Dennis Morgan ......................................21 North Carolina, Oct. 1, 19665. Frank Nunley ...........................................20 Northwestern, Nov. 12, 1966 Ron Simpkins ..........................................20 Ohio State, Nov. 19, 1977
Season (since 1966)1. Ron Simpkins 174 19772. Mike Boren 171 19823. Ron Simpkins 168 1978
Andy Cannavino 168 19805. Paul Girgash 157 19826. Calvin O’Neal 153 19767. Mike Boren 152 19818. Calvin O’Neal 151 19758. Andy Cannavino 151 1979
10. Ron Simpkins 150 1979
Career (since 1966)1. Ron Simpkins 516 1976-79
2. Jarrett Irons 440 1993-96 3. Erick Anderson 428 1988-91 4. Paul Girgash 414 1979-82 5. Mike Mallory 396 1982-85 6. Andy Cannavino 385 1977-80 7. Calvin O’Neal 378 1974-76 8. Sam Sword 377 1995-98 9. Mike Boren 369 1980-8310. Steve Morrison 360 1990-94 11. Greg Morton 336 1974-76 12. Andy Moeller 326 1983-86 13. Mike Taylor 316 1969-71 14. Curtis Greer 313 1976-79 15. Steve Strinko 297 1972-74
Most Tackles
Calvin O’Neal Mike Boren Ron Simpkins
Steve Morrison Jarrett IronsErick AndersonSam Sword
RUSHING RECORDS140 140RECORD BOOK
Tackles for Loss
Most Tackles For Loss
Game (since 1978)1. Larry Foote ....................................... 7 (26) at Iowa, Oct. 27, 20012. Mark Messner .................................. 6 (26) Northwestern, Oct. 31, 1987 William Carr ...................................... 6 (34) Minnesota, Oct. 28, 1995 Larry Foote ....................................... 6 (15) at Washington, Sept. 8, 20015. Sam Sword ....................................... 5 (15) Minnesota, Nov. 1, 1997 Shantee Orr ...................................... 5 (28) at Michigan State, Nov. 3, 2001 Shawn Crable .................................. 5 (15) at Northwestern, Sept. 29, 2007 Brandon Graham ............................ 5 (42) Ohio State, Nov. 21, 20099. Obi Ezeh .........................................4.5 (12) Illinois, Oct. 4, 200810. Curtis Greer ...................................... 4 (21) Kansas, Sept. 22, 1979 Jeff Akers ........................................... 4 (18) at Iowa, Oct. 19, 1985 Mike Hammerstein ........................ 4 (24) Notre Dame, Sept. 14, 1985 Mark Messner .................................. 4 (21) Minnesota, Nov. 5, 1988 Trent Zenkewicz ............................. 4 (24) at Ohio State, Nov. 19, 1994 Jason Horn........................................ 4 (25) at Boston College, Sept. 16, 1995 David Bowens.................................. 4 (21) at Minnesota, Oct. 26, 1996 Glen Steele ....................................... 4 (15) Colorado, Sept. 13, 1997 Glen Steele ....................................... 4 (15) at Purdue, Nov. 9, 1996 William Carr ...................................... 4 (14) Penn State, Nov. 16, 1996 James Hall ......................................... 4 (27) vs. Arkansas, Jan. 1, 1999 Eric Wilson ........................................ 4 (15) vs. Auburn, Jan. 1, 2001 Ernest Shazor ................................... 4 (17) Minnesota, Oct. 9, 2004
LaMarr Woodley ................................4 (7) vs. Texas (Rose Bowl), Jan. 1, 2005 LaMarr Woodley ............................. 4 (12) Penn State, Oct. 15, 2005 Rondell Biggs................................... 4 (12) Vanderbilt, Sept. 2, 2006 David Harris ...................................... 4 (25) at Ball State, Nov. 4, 2006 Shawn Crable .................................. 4 (16) Notre Dame, Sept. 15, 2007 Brandon Graham ............................ 4 (28) at Wisconsin, Nov. 14, 2009
Season (since 1978) 1. Shawn Crable 28.5 2007 2. Mark Messner 26 1988 Larry Foote 26 2001 Brandon Graham 26 2009 5. Mike Hammerstein 23 1985 Curtis Greer 23 1979 7. William Carr 21 1995 8. Mark Messner 20 1987 Brandon Graham 20 2008 10. Jason Horn 18 1995 11. Victor Hobson 17 2002 12. LaMarr Woodley 16.5 2006 13. Henry Hill 16 1968 Trent Zenkewicz 16 1994 David Bowens 16 1996 James Hall 16 1998 LaMarr Woodley 16 2004 LaMarr Woodley 16 2005 David Harris 16 2006 20. Greg Morton 15 1975 Robert Thompson 15 1980 Robert Thompson 15 1982 Glen Steele 15 1996 William Carr 15 1996
Career (since 1978) 1. Mark Messner 70 1985-88 2. Brandon Graham 56 2006-09 3. LaMarr Woodley 52.5 2003-06 4. Curtis Greer 48 1976-79 5. Victor Hobson 47 1999-02 6. Glen Steele 45 1994-97 7. Larry Foote 44 1998-01 8. Shawn Crable 43 2004-07 9. James Hall 40 1996-99 10. Jason Horn 39 1992-95 William Carr 39 1993-96 Sam Sword 39 1995-9813. Chris Hutchinson 38 1989-92 Robert Thompson 38 1979-8215. Mike Hammerstein 37 1981-8516. Henry Hill 35 1968-7017. Trent Zenkewicz 34 1992-95 18. Greg Morton 33 1974-76 Dhani Jones 33 1996-99
Tackles for Loss YardsSeason (since 1978)
1. LaMarr Woodley 131 2006 2. Brandon Graham 127 2009 3. Jason Horn 122 1995 4. Mark Messner 120 1985 5. Mike Hammerstein 112 1985 6. Curtis Greer 107 1979 7. Chris Hutchinson 103 1992 8. James Hall 101 1998 9. Mark Messner 100 1988 10. Brandon Graham 97 2008 11. Phil Seymour 91 1970 12. Larry Foote 90 2001 13. David Bowens 89 1996 14. Mike Evans 85 1989 Shawn Crable 85 2007 16. Mark Messner 84 1987
Career (since 1978) 1. Mark Messner 376 1985-88 2. LaMarr Woodley 286 2003-06 3. Brandon Graham 281 2006-09 4. Jason Horn 236 1992-95 5. Curtis Greer 234 1976-79 6. Chris Hutchinson 221 1989-92 James Hall 221 1996-99 8. Glen Steele 199 1995-97 9. Robert Thompson 184 1979-82 10. Mike Hammerstein 176 1981-8511. Trent Zenkewicz 170 1992-95 12. Ron Simpkins 168 1976-79 13. Shawn Crable 153 2004-07 14. Larry Foote 150 1998-01 15. Mike Evans 149 1988-91
Larry Foote Shawn Crable Glen Steele Victor Hobson
140RECORD BOOK
141RECORD BOOK
Most Sacks
Game (since 1978)1. Mark Messner .................................. 5 (25) Northwestern, Oct. 31, 19872. Brandon Graham .........................3.5 (23) Notre Dame, Sept. 15, 20073. Robert Thompson .......................... 3 (21) UCLA, Sept. 25, 1982 Mike Hammerstein ........................ 3 (23) Wisconsin, Sept. 22, 1984 Mike Hammerstein ........................ 3 (22) Notre Dame, Sept. 14, 1985 Bobby Abrams ................................ 3 (20) Maryland, Sept. 30, 1989 Chris Hutchinson ............................ 3 (26) Maryland, Sept. 29, 1990 Brian Townsend .............................. 3 (21) Indiana, Oct. 19, 1991 Chris Hutchinson ............................ 3 (31) at Indiana, Oct. 17, 1992 Jason Horn........................................ 3 (22) at Boston College, Sept. 16, 1995 William Carr ...................................... 3 (23) Minnesota, Oct. 28, 1995 David Bowens.................................. 3 (24) Illinois, Aug. 31, 1996 David Bowens.................................. 3 (20) at Minnesota, Oct. 26, 1996 Dan Rumishek ................................. 3 (23) at Penn State, Oct. 6, 2001 Larry Foote ....................................... 3 (16) at Iowa, Oct. 27, 2001 Shantee Orr ...................................... 3 (21) at Michigan State, Nov. 3, 2001 Shawn Crable .................................. 3 (10) Notre Dame, Sept. 15, 2007 Brandon Graham ............................ 3 (13) Wisconsin, Sept. 27, 2008 Brandon Graham ............................ 3 (22) Michigan State, Oct. 25, 2008
Season (since 1980) 1. David Bowens 12 1996 LaMarr Woodley 12 2006 2. Mark Messner 11 1985 Chris Hutchinson 11 1992 Jason Horn 11 1995 James Hall 11 1998 6. Brandon Graham 10.5 2009 7. Mark Messner 10 1987 Brandon Graham 10 2008 9. Robert Thompson 9 1980 Robert Thompson 9 1982 Mike Hammerstein 9 1985 12. Brandon Graham 8.5 200713. Mark Messner 8 1988 Mike Evans 8 1990 Martin Davis 8 1990 Sylvester Stanley 8 1993 Glen Steele 8 1995 19. Shawn Crable 7.5 2007
Career (since 1980) 1. Mark Messner 36 1985-88 2. Brandon Graham 29.5 2006-09 3. James Hall 25 1996-99 4. Chris Hutchinson 24 1989-92 Jason Horn 24 1992-95 Glen Steele 24 1995-97 LaMarr Woodley 24 2003-06 8. Tim Jamison 20 2005-08 9. Robert Thompson 19 1979-82 10. Mike Hammerstein 17 1981-85 Mike Evans 17 1988-91 12. Trent Zenkewicz 16 1992-95 David Bowens 16 1995-96 Shawn Crable 16 2004-07 15. Sylvester Stanley 15 1989-93
Mark Messner holds nearly all of Michigan’s records for sacks and tackles for loss.
Most Sack YardageSeason (since 1980)
1. LaMarr Woodley 119 2006 2. Chris Hutchinson 99 1992 3. Brandon Graham 98 2009 4. Jason Horn 96 1995 5. Mark Messner 92 1985 6. James Hall 89 1998 7. Mike Evans 85 1989 8. David Bowens 79 1996 9. Matt Dyson 72 1992 10. Robert Thompson 66 1982 11. Mark Messner 65 1987 12. Mark Messner 64 1986 Brandon Graham 64 2008 14. Sylvester Stanley 58 1993 15. LaMarr Woodley 57 2005
Career (since 1980) 1. Mark Messner 273 1985-88 2. LaMarr Woodley 224 2003-06 3. Brandon Graham 222 2006-09 4. James Hall 189 1996-99 5. Chris Hutchinson 188 1989-92 6. Jason Horn 184 1992-95 7. Glen Steele 145 1995-97 8. Mike Evans 138 1988-91 9. Robert Thompson 129 1979-82 10. David Bowens 117 1995-9611. Matt Dyson 114 1991-94 Trent Zenkewicz 114 1992-9513. Ryan Van Bergen 102 2008- Shawn Crable 102 2004-07 15. Mike Hammerstein 98 1981-85 16. Sylvester Stanley 96 1989-93
Sacks
Fumbles Forced
LaMarr Woodley
Most Fumbles Forced
Game 1. Jerry Hartman .......................................... 3 vs. Indiana, Oct. 21, 1967 2. Chuck Winters .......................................... 2 vs. Penn State, Nov. 18, 1995 Garland Rivers .......................................... 2 vs. Wisconsin, Sept. 22, 1984 ................. Carlton Rose ............................................. 2 vs. Purdue, Nov. 13, 1982 Calvin O’Neal ............................................ 2 vs. Michigan State, Oct. 11, 1975 Mike Taylor ................................................ 2 vs. Virginia, Sept. 18, 1971 Norman Heuer ......................................... 2 vs. Western Michigan, Sept. 7, 2002
Season 1. Mike Taylor 4 1971 LaMarr Woodley 4 2006 Shawn Crable 4 2007 4. Chuck Winters 3 1995 Henry Hill 3 1968 Tom Seabron 3 1977 LaMarr Woodley 3 2005 James Whitley 3 1999 Julius Curry 3 2000 Ian Gold 3 1999 Dave Elliot 3 1974 Victor Hobson 3 2000 Josh Williams 3 1999 Pete Newell 3 1969 Norman Heuer 3 2002 Roy Manning 3 2004 LaMarr Woodley 3 2004 Jerry Hartman 3 1967 Carlton Rose 3 1982 Brandon Graham 3 2007
Career 1. LaMarr Woodley 10 2003-06 2. Brandon Graham 7 2006-09 3. Henry Hill 6 1968-70 Mike Taylor 6 1969-71 Shawn Crable 6 2004-07 6. Ernest Shazor 5 2002-04 Marlin Jackson 5 2001-04 Jordan Kovacs 5 2009-11 9. Tom Seabron 4 1975-78 Jason Horn 4 1992-95 Dave Elliot 4 1971-74 Victor Hobson 4 1999-02 Jarrett Irons 4 1993-96 Mark Messner 4 1985-88 Carlton Rose 4 1980-83 Calvin O’Neal 4 1974-76 Josh Williams 4 1996-99 Cato June 4 1999-02 Pierre Woods 4 2002-05 Chuck Winters 4 1993-96 Jerry Hartman 4 1966-68 Julius Curry 4 1999-02 Stevie Brown 4 2006-09
DEFENSIVE RECORDS
RUSHING RECORDS142
Fumble Recoveries
Most Fumble Return Yards
Most Fumble Recoveries
Game1. Clarence Thompson ............................... 2 vs. Colorado, Sept. 24, 1994 John Milligan ............................................ 2 vs. Wisconsin, Oct. 3, 1987 Kevin Brooks ............................................. 2 vs. Brigham Young, Dec. 21, 1984 Cedric Coles .............................................. 2 vs. Minnesota, Oct. 18, 1980 Michael Harden ....................................... 2 vs. California, Sept. 29, 1979 Dominic Tedesco ..................................... 2 vs. Michigan State, Oct. 8, 1977 Dominic Tedesco ..................................... 2 vs. Texas A&M, Oct. 1, 1977 Richard Koschalk ..................................... 2 vs. Baylor, Sept. 27, 1975 Butch Carpenter ...................................... 2 vs. Purdue, Oct. 11, 1969 Frank Gusich ............................................. 2 vs. Michigan State, Oct. 18, 1969 Michael Keller ........................................... 2 vs. Minnesota, Oct. 23, 1971 Frederick Grambau ................................. 2 vs. Indiana, Nov. 4, 1972 Cecil Pryor .................................................. 2 vs. Illinois, Nov. 9, 1968 Tom Stincic ................................................ 2 vs. Duke, Sept. 23, 1967 Brandent Englemon ............................... 2 vs. Northern Illinois, Sept. 3, 2005 Cam Gordon ...................................2 at Purdue, Nov. 13, 2010 Jake Ryan........................................ 2 vs. San Diego State, Sept. 24, 2011
Season 1. Ron Simpkins 5 1977 2. Butch Carpenter 4 1969 Keith Bostic 4 1982 Michael Keller 4 1971 Dominic Tedesco 4 1977 Walt Williamson 4 1973 LaMarr Woodley 4 2006 Thomas Gordon 4 2011 9. Clarence Thompson 3 1994 Brian Townsend 3 1991 Dennis Morgan 3 1967 Dominic Tedesco 3 1976 Erick Anderson 3 1991 Carlton Rose 3 1983 Don Dufek 3 1975 Michael Harden 3 1979 Norman Heuer 3 2000 Alan Branch 3 2006 Ryan Van Bergen 3 201120. Julius Curry 2 2002 Randy Logan 2 1972 Frank Gusich 2 1969 David Folkertsma 2 1986 Cato June 2 1999 Brandent Englemon 2 2005 Leon Hall 2 2006 Donovan Warren 2 2007 Brandon Graham 2 2007 Stevie Brown 2 2007 Brandon Harrison 2 2008 Terrance Taylor 2 2008 Jonas Mouton 2 2010 Cam Gordon 2 2010 Jake Ryan 2 2011 Courtney Avery 2 2011
Career 1. Ron Simpkins 7 1976-79 Mike Hammerstein 7 1981-85 Dominic Tedesco 7 1975-77 4. Keith Bostic 6 1979-82 Butch Carpenter 6 1969-71 Brian Townsend 6 1988-91 7. Glen Steele 5 1994-97 Mark Messner 5 1985-88 James Grant 5 1986-89 Don Dufek 5 1973-75 Leon Hall 5 2003-06 LaMarr Woodley 5 2003-06 13. T.J. Osman 4 1987-90 Mike Mallory 4 1982-85 John Anderson 4 1975-77 Frederick Grambau 4 1969-72 Michael Keller 4 1969-71 Cecil Pryor 4 1967-69 Jarrett Irons 4 1993-96 John Milligan 4 1987-90 Robert Thompson 4 1979-82 Frank Gusich 4 1969-71 Terrance Taylor 4 2005-08 Ryan Van Bergen 4 2008- Thomas Gordon 4 2010-
Game1. Leon Hall ..................................................83 at Northwestern, Oct. 29, 20052. Courtney Avery ............................83 Minnesota, Oct. 1, 20113. Cam Gordon .................................58 at Purdue, Nov. 13, 20104. LaMarr Woodley ....................................54 at Notre Dame, Sept. 16, 20065. Tommy Hendricks .................................33 at Ohio State, Nov. 21, 19986. Brandon Herron ...........................29 vWestern Michigan, Sept. 3, 20117. Corwin Brown.........................................24 at Indiana, Oct. 17, 19928. Shawn Lazarus .......................................23 at Penn State, Oct. 6, 2001 Philip Brabbs ...........................................23 at Illinois, Sept. 28, 2002
Season 1. Leon Hall 83 2005 Courtney Avery 83 2011 3. Cam Gordon 58 2010 4. LaMarr Woodley 54 2006 5. Tommy Hendricks 33 1998 6. Brandon Herron 29 2011 7. Corwin Brown 24 1992 8. Shawn Lazarus 23 2001 Philip Brabbs 23 2002 10. Charles Woodson 8 1995 Obi Ezeh 8 2010
Career 1. Courtney Avery 83 2010- 2. Leon Hall 82 2003-05 3. Cam Gordon 58 2010- 4. LaMarr Woodley 54 2003-06 5. Tommy Hendricks 33 1996-98 6. Brandon Herron 29 2008-11 7. Corwin Brown 24 1989-92 8. Shawn Lazarus 23 1999-01 Philip Brabbs 23 2000-02 10. Charles Woodson 8 1995-96 Obi Ezeh 8 2007-10
Leon Hall set a school record with his 83-yard fumble return for a touchdown at Northwestern on Oct. 29, 2005.
LaMarr Woodley scooped up an Irish fumble and returned it 54 yards for a touchdown at Notre Dame on Sept. 16, 2006.
143RECORD BOOKDEFENSIVE RECORDS
InterceptionsGame
1. 10 times, last, Andy Moeller .......... 3 at Wisconsin, Oct. 4, 1986
Season 1. Tom Curtis 10 1968 2. Chuck Lentz 9 1949 3. Tom Curtis 8 1969 Charles Woodson 8 1997 5. Tom Curtis 7 1967 Barry Pierson 7 1969 7. Don Lund 6 1944 Gene Derricotte 6 1946 Don Oldham 6 1951 Jerry Zuver 6 1976 Tony Jackson 6 1981 Ivan Hicks 6 1985 Ty Law 6 1993 Todd Howard 6 2000
Career1. Tom Curtis 25 1967-69
2. Charles Woodson 18 1995-97 3. Wally Teninga 13 1945-49 4. Gene Derricotte 12 1944-48 Brad Cochran 12 1982-85 Leon Hall 12 2003-06 6. Rick Volk 11 1964-66 Thom Darden 11 1969-71 Vada Murray 11 1988-90 DeWayne Patmon 11 1997-00 10. Charlie Lentz 10 1948-49 Mike Jolly 10 1976-79 Keith Bostic 10 1979-82 Evan Cooper 10 1980-83 Lance Dottin 10 1988-91
Game1. Tom Harmon ...........................................95 Iowa, Oct. 14, 19392. Brandon Herron ...........................94 Western Michigan, Sept. 3, 20113. Don Oldham ...........................................92 Minnesota, Oct. 27, 1951 Ken Tureaud ............................................92 UCLA, Sept. 30, 1961 Thom Darden .........................................92 UCLA, Sept. 25, 19716. Ernest Shazor ..........................................88 Miami (Ohio), Sept. 4, 2004
Most Interceptions
Most Return YardsSeason
1. Tom Curtis 182 1968 2. Thom Darden 163 1971 3. Tom Curtis 156 1969 4. Tony Jackson 121 1981 5. Don Oldham 119 1951 Keith Bostic 119 1982 7. Jerry Zuver 110 1976 8. Tony Branoff 98 1953 9. Brandon Herron 94 2011 10. Tom Curtis 93 1967
Career1. Tom Curtis 431 1967-69
2. Thom Darden 224 1969-71 3. Dave Brown 202 1972-74 4. Don Oldham 181 1950-52 5. Bump Elliott 174 1946-47 6. Marcus Ray 169 1995-98 7. Marty Huff 159 1968-70 8. Mike Rotunno 152 1954-56 9. Tom Harmon 146 1938-40 10. Tony Jackson 141 1978-81
Most Interception Returns for Touchdown
Season 1. Thom Darden 2 1971
Career 1. Thom Darden 2 1969-71 Lance Dottin 2 1988-91
One of the highlights of Charles Woodson’s 1997 Heisman Trophy season was this spectacular one-handed interception at Michigan State. Woodson is U-M’s season leader in PBU’s and ranks second in career picks and PBU’s.
Tom Curtis ranks among the NCAA's all-time leaders with 25 career interceptions.
Interception Returns for Touchdown (Since 1948)Yards Player Opponent Date94 ..............Brandon Herron.................Western Michigan .................Sept. 3, 201192 ...................Ken Tureaud .............................. UCLA ..................................................Sept. 30, 196192 ...................Thom Darden ........................... UCLA ..................................................Sept. 25, 197188 ...................Ernest Shazor ............................ Miami (Ohio) ...................................Sept. 4, 200481 ...................Mike Rotunno ........................... Missouri ............................................Sept. 24, 195568 ...................David Brown ............................. Minnesota .......................................Oct. 28, 197262 ...................Jerry Hartman........................... at Indiana .........................................Oct. 19, 196860 ...................Thom Darden ........................... Indiana ..............................................Oct. 30, 197160 ...................Jerry Zuver ................................. Michigan State ...............................Oct. 9, 197660 ...................Jeremy LeSueur ....................... Indiana ..............................................Sept. 27, 200356 ...................Mike Shatusky .......................... Georgia .............................................Oct. 5, 195754 ...................Keith Bostic................................ at Northwestern ............................Oct. 23, 198251 ...................William Peterson...................... Eastern Michigan ..........................Sept. 19, 199850 ...................Mike Jolly ................................... Texas A&M .......................................Oct. 1, 197750 ...................Lance Dottin ............................. at Boston College .........................Sept. 7, 199150 ...................Dan Parks ................................... at Northwestern ............................Nov. 2, 196850 ...................Julius Curry ................................ at Ohio State ...................................Nov. 18, 200046 ................... Ian Gold ...................................... vs. Arkansas ....................................Jan. 1, 199944 ...................Marty Huff .................................. at Duke .............................................Sept. 28, 196843 ...................Clarence Thompson ............... North Carolina St. .........................Jan 1, 199443 ...................Andre Weathers ....................... Ohio State ........................................Nov. 22, 199742 ...................Gary Prahst ................................ at Michigan State ..........................Oct. 4, 195840 ...................Bruce Elliott ............................... at Illinois ...........................................Nov. 8, 196940 ...................Tom Seabron ............................. Northwestern .................................Oct. 18, 197540 ...................Donovan Warren ..................... at Iowa ..............................................Oct. 10, 200936 ...................Chuck Winters .......................... Miami (Ohio) ...................................Sept. 30, 199534 ...................Bennie McRae ........................... Duke ..................................................Nov. 4, 196134 ...................Jacob Stewart ........................... at Minnesota ..................................Oct. 10, 200333 ...................Gary Prahst ................................ at Northwestern ............................Oct. 18, 195831 ...................Prescott Burgess ...................... at Notre Dame ...............................Sept. 16, 200632 ...................Harry Allis ................................... Indiana ..............................................Nov. 11, 195032 ...................Randy Logan ............................. Tulane ...............................................Sept. 30, 197232 ...................Anthony Jordan ....................... Eastern Michigan ..........................Sept. 19, 199830 ...................Dominic Tedesco ..................... at Purdue .........................................Nov. 12, 197729 ...................Calvin O'Neal ............................ Navy ...................................................Sept. 25, 197627 ...................Martin Davis .............................. Maryland ..........................................Sept. 29, 199027 ...................Garland Rivers .......................... Wisconsin .........................................Oct. 5, 198526 ...................James Whitley .......................... vs. Arkansas ....................................Jan. 1, 199925 ...................Grant Mason ............................. Iowa ...................................................Sept. 25, 200425 ...................John Thompson ....................... Wisconsin .........................................Sept. 27, 200823 ...................John Henderson ...................... Northwestern .................................Nov. 2, 196323 ...................Dave Devich .............................. Northwestern .................................Oct. 18, 197522 ...................Lance Dottin ............................. Wisconsin .........................................Oct. 7, 198919 ...................Marlin Jackson.......................... at Notre Dame ...............................Sept. 14, 2002
RUSHING RECORDS144 144RECORD BOOK
Pass Breakups
Most Passes Broken Up
Game1. Marlin Jackson ......................................... 6 Washington, Aug. 31, 20022. Thom Darden ........................................... 5 Purdue, Oct. 11, 1969 James Whitley .......................................... 5 at Penn State, Nov. 13, 1999 Jamar Adams ............................................ 5 Penn State, Sept. 22, 20075. Marion Body ............................................. 4 vs. UCLA, Jan. 1, 1983 Charles Woodson .................................... 4 vs. Washington State, Jan. 1, 1998 Todd Howard ............................................ 4 vs. Purdue, Oct. 2, 1999 Todd Howard ............................................ 4 at Purdue, Oct. 7, 2000 Todd Howard ............................................ 4 at Michigan State, Nov. 3, 2001 Leon Hall .................................................... 4 at Illinois, Oct. 16, 2004
Season 1. Marlin Jackson 18 2002 Leon Hall 18 2006 2. Charles Woodson 15 1996 4. Marion Body 14 1982 Alfie Burch 14 1993 Todd Howard 14 1999 7. Todd Howard 13 2000 Todd Howard 13 2001 Jamar Adams 13 2007 10. Jeremy LeSueur 12 2003 Markus Curry 12 2003 12. Woodrow Hankins 11 1996 Donovan Warren 11 200914. Thom Darden 10 1970 Marion Body 10 1980 Jerry Burgei 10 1982 Leon Hall 10 2004 Morgan Trent 10 2007
Career1. Leon Hall 43 2003-06
2. Todd Howard 41 1998-01 3. Marlin Jackson 34 2001-04 4. Charles Woodson 30 1995-97 5. James Whitley 28 1997-00 6. Jeremy LeSueur 27 2000-03 7. Marion Body 26 1979-82 8. Markus Curry 25 2001-04 9. Jarrett Irons 24 1993-96 Morgan Trent 24 2005-0811. Thom Darden 23 1969-71 Donovan Warren 23 2007-0913. Jamar Adams 22 2004-0714. Ty Law 19 1992-9415. Dave Brown 18 1972-74 Dwight Hicks 18 1974-77 Larry Foote 18 1998-0118. Brad Cochran 17 1983-85 Alfie Burch 17 1990-9320. Mike Taylor 16 1969-71 Calvin O’Neal 16 1974-76 Mike Harden 16 1977-79
Ty LawMarlin Jackson Marion Body Charles Woodson
Leon Hall
145RECORD BOOK
ScoringGame
1. Ron Johnson ...........................................30 Wisconsin, Nov. 16, 19682. Tom Harmon ...........................................28 at California, Sept. 28, 19403. Tom Harmon ...........................................27 Iowa, Oct. 14, 19394. Garvie Craw .............................................24 at Illinois, Nov. 8, 1969 Fritz Seyferth...........................................24 Minnesota, Oct. 24, 1970 Ed Shuttlesworth ..................................24 Minnesota, Oct. 28, 1972 Rob Lytle ..................................................24 Indiana, Oct. 25, 1975 Desmond Howard ................................24 at Boston College, Sept. 7, 1991 Derrick Alexander .................................24 Minnesota, Oct. 24, 1992 Chris Howard ..........................................24 UCLA, 9-28-96 Anthony Thomas ...................................24 at Hawaii, 11-28-98 Chris Perry ...............................................24 vs. Florida, Jan. 1, 2003 Chris Perry ...............................................24 Notre Dame, Sept. 13, 2003
Season 1. Desmond Howard 138 1991 2. Chris Perry 120 2003 3. Tom Harmon 117 1940 4. Ron Johnson 116 1968 5. Anthony Thomas 114 2000 6. Tom Harmon 102 1939 Tyrone Wheatley 102 1992 Anthony Thomas 102 1999 9. Remy Hamilton 101 1994 10. Mike Gillette 97 1988 11. Denard Robinson 96 2011 Rob Lytle 96 1976 13. J.D. Carlson 95 1990 14. Garrett Rivas 94 2004 15. Garrett Rivas 93 200616. Remy Hamilton 91 1995 Jay Feely 91 1998 18. Jamie Morris 90 1987 Anthony Thomas 90 1998 Braylon Edwards 90 2004 Garrett Rivas 90 2005 22. Bob Timberlake 89 1964 23. Braylon Edwards 86 2003
Career 1. Garrett Rivas 354 2003-06 2. Anthony Thomas 336 1997-00 2. Tyrone Wheatley 324 1991-94 4. Mike Gillette 307 1985-88 5. Remy Hamilton 280 1993-96 6. Mike Hart 262 2004-07 7. J.D. Carlson 254 1988-91 8. Anthony Carter 244 1979-82 9. Chris Perry 240 2000-03 10. Tom Harmon 237 1938-40 11. Braylon Edwards 236 2001-0412. Desmond Howard 222 1989-9113. Denard Robinson 210 2009- Ali Haji-Sheikh 210 1979-8215. Rick Leach 204 1975-7816. Billy Taylor 194 1969-7117. Steve Smith 188 1980-8318. Mike Lantry 176 1972-7419. Gordon Bell 174 1973-75 Rob Lytle 174 1973-76 Butch Woolfolk 174 1978-81
Game1. Ron Johnson ............................................. 5 Wisconsin, Nov. 16, 19682. Tom Harmon ............................................. 4 Iowa, Oct. 14, 1939 Tom Harmon ............................................. 4 at California, Sept. 28, 1940 Garvie Craw ............................................... 4 at Illinois, Nov. 8, 1969 Fritz Seyferth............................................. 4 Minnesota, Oct. 24, 1970 Ed Shuttlesworth .................................... 4 Minnesota, Oct. 28, 1972 Rob Lytle .................................................... 4 Indiana, Oct. 25, 1975 Desmond Howard .................................. 4 at Boston College, Sept. 7, 1991 Derrick Alexander ................................... 4 Minnesota, Oct. 24, 1992 Chris Howard ............................................ 4 UCLA, Sept. 28, 1996 Anthony Thomas ..................................... 4 at Hawaii, Nov. 28, 1998 Chris Perry ................................................. 4 vs. Florida, Jan. 1, 2003 Chris Perry ................................................. 4 Notre Dame, Sept. 13, 2003
Most Points Scored
Most Touchdowns Scored
Season 1. Desmond Howard 23 1991 2. Chris Perry 20 2003 3. Ron Johnson 19 1968 Anthony Thomas 19 2000 5. Tyrone Wheatley 17 1992 Anthony Thomas 17 1999 7. Tom Harmon 16 1940 Rob Lytle 16 1976 Denard Robinson 16 2011 10. Jamie Morris 15 1987 Anthony Thomas 15 1998 Braylon Edwards 15 2004 13. Denard Robinson 14 2010 Tom Harmon 14 1939 Gordon Bell 14 1975 Anthony Carter 14 1980 Derrick Alexander 14 1992 Tyrone Wheatley 14 1993 Tyrone Wheatley 14 1994 David Terrell 14 2000 Chris Perry 14 2002 Mike Hart 14 2006 Mike Hart 14 2007
Career
1. Anthony Thomas 56 1997-00 2. Tyrone Wheatley 54 1991-94 3. Mike Hart 43 2004-07 4. Chris Perry 41 2000-03 5. Anthony Carter 40 1979-82 6. Braylon Edwards 39 2001-04 7. Desmond Howard 37 1989-91 8. Denard Robinson 35 2009- 9. Rick Leach 34 1975-78 10. Tom Harmon 33 1938-40 11. Billy Taylor 32 1969-71 12. Steve Smith 31 1980-8313. Gordon Bell 29 1973-75 Rob Lytle 29 1973-76 Butch Woolfolk 29 1978-8116. Jamie Morris 28 1984-8717. Ron Johnson 27 1966-68 18. Derrick Alexander 27 1989-93
Individual Touchdown Records (Includes Pre-Modern Era Games)
SeasonTD Name Year26 Al Herrnstein 190223 Desmond Howard 199121 Willie Heston 190420 Willie Heston 190120 Chris Perry 200319 Neil Snow 190119 Ron Johnson 196819 Anthony Thomas 200017 Tyrone Wheatley 199217 Anthony Thomas 199916 Denard Robinson 201116 Willie Heston 190316 Tom Harmon 194016 Rob Lytle 1976
GameTD Name Opponent Date7 Al Herrnstein Michigan Agriculture 19026 Al Herrnstein Beloit 19016 Willie Heston Kalamazoo 19046 Sam Davison Kentucky 19085 Neil Snow Stanford 19015 Al Herrnstein Buffalo 19015 Al Herrnstein Ohio State 19025 Willie Heston Beloit 19035 Tom Hammond Albion 19035 Herb Graver Ohio State 19035 Harry Hammond Kalamazoo 19045 John Curtis West Virginia 19045 Fred Norcross West Virginia 19045 Paul Magoffin Michigan Agriculture 19075 Archie Weston Mt. Union 19175 Ron Johnson Wisconsin 1968
CareerTD Name Years72 Willie Heston 1901-0456 Anthony Thomas 1997-0054 Tyrone Wheatley 1991-9343 Mike Hart 2004-0741 Chris Perry 2000-0340 Anthony Carter 1979-8239 Al Herrnstein 1898-0239 Braylon Edwards 2001-0437 Desmond Howard 1989-9135 Denard Robinson 2009-35 John Curtis 1903-0634 Tom Hammond 1903-0534 Rick Leach 1975-7833 Tom Harmon 1938-4032 Bill Taylor 1969-7131 Steve Smith 1980-8330 John Maulbetsch 1914-16
Desmond Howard
Tyrone Wheatley
First DownsMost First Downs
Michigan37 Northwestern ...................................1978
35 Mississippi .........................................1991 34 Delaware State .................................2009Both Teams 64 Northwestern ...................................2000 58 Illinois ..................................................2010 57 Northwestern ...................................1982 57 Illinois ..................................................1981Opponents 35 Indiana ................................................2010 34 Illinois ..................................................1982 31 Northwestern ...................................2000
Fewest First DownsMichigan
0 Ohio State ..........................................1950 2 at Ohio State .....................................1998Both Teams 3 Ohio State ..........................................1950 14 Pittsburgh ..........................................1941Opponents 1 Pittsburgh ..........................................1947
Most by RushingMichigan
29 Iowa .....................................................1969 29 Virginia ................................................1971Opponents 24 Ohio State ..........................................1968
Fewest by RushingMichigan
0 Ohio State ..........................................1950 2 Michigan State .................................1951 2 Michigan State .................................1965Opponents 0 Pittsburgh ..........................................1947 0 Indiana ................................................1949
Most by PassingMichigan
20 Northwestern ...................................2000 16 Wisconsin ...........................................1997 16 Illinois ..................................................2010 15 at Ohio State .....................................1998 15 vs. Alabama .......................................1999 15 vs. Florida ...........................................2002Opponents 23 Northwestern ...................................1982 22 Indiana ................................................2010
Fewest by PassingMichigan
0 Many games LAST: Northwestern ...................................1987Opponents 0 Many times LAST: Notre Dame ......................................1989
Most by PenaltyMichigan
6 Wisconsin ...........................................1982 6 Michigan State .................................2011Opponents 5 Ohio State ..........................................1966
RushingMost Attempts
Michigan85 Minnesota ..........................................1971
83 Virginia ................................................1971Both Teams 124 Michigan State .................................1969 123 UCLA ....................................................1972Opponents 79 Ohio State ..........................................1968
Fewest AttemptsMichigan
21 at Michigan State ............................1999 23 Michigan State .................................1993 23 vs. Alabama .......................................2000 24 Ohio State ..........................................2005Both Teams 51 Western Michigan (shortened) ..2011 57 at Michigan State ............................1999 59 Oregon State ....................................1986 59 Notre Dame ......................................2011
RECORD BOOK
Team Single Game RecordsOpponents
16 Northwestern ...................................1982 16 Oregon State ....................................1986 16 Houston ..............................................1992
Most Net YardsMichigan573 Northwestern ...................................1975
531 Stanford ..............................................1976Both Teams 664 Northwestern ...................................1975 647 Iowa .....................................................1969Opponents 424 Minnesota ..........................................2003 421 Ohio State ..........................................1968
Fewest Net YardsMichigan- 46 Minnesota ..........................................1962
- 38 Michigan State .................................1965Both Teams 43 Ohio State ..........................................1950 79 Minnesota ..........................................1962Opponents - 19 Oregon State ....................................1986 - 16 Michigan State .................................1942
Highest Average Yards per RushMichigan9.23 Iowa .....................................................1992 8.85 Stanford ..............................................1976Opponents 7.02 Army ....................................................1945
Lowest Average Yards per RushMichigan- 1.24 Minnesota ..........................................1962 - 1.15 Michigan State .................................1965Opponents - 1.19 Oregon State ....................................1986
Most Touchdowns RushingMichigan
9 Chicago...............................................1939 8 Iowa .....................................................1971 8 Indiana ................................................1975 8 Illinois ..................................................1986Opponents 7 Ohio State ..........................................1968
PassingMost Attempted
Michigan56 at Ohio State .....................................1998
55 at Oregon ...........................................2003 54 at Ohio State .....................................2004 53 at Michigan State ............................1999 52 Virginia ................................................1995Both Teams 93 Northwestern ...................................1982 89 at Michigan State ............................1999 86 at Oregon ...........................................2003 84 at Ohio State .....................................1998 83 Oregon State ....................................1986 83 at Iowa ................................................2003Opponents 71 Northwestern ...................................1982 64 Oregon State ....................................1986 64 Indiana ................................................2010
Fewest AttemptedMichigan
1 Illinois ..................................................1975 2 Michigan State .................................1955Both Teams 9 Michigan State .................................1955 10 Wisconsin ...........................................1943 10 Illinois ..................................................1944Opponents 1 Minnesota ..........................................1940 1 Army ....................................................1955
Most CompletedMichigan
36 at Michigan State ............................1999 35 vs. Alabama .......................................2000 34 at Minnesota .....................................2003 31 at Ohio State .....................................1998 29 Oklahoma State ...............................1992
Both Teams 59 Northwestern ...................................1982 58 Purdue ................................................2000 57 at Michigan State ............................1999 54 Oregon State ....................................1986Opponents 45 Northwestern ...................................1982 45 Indiana ................................................2010 39 Oregon State ....................................1986
Fewest CompletedMichigan
0 6 Times LAST: Ohio State ..........................................1976Both Teams 0 Illinois ..................................................1944 1 Ohio State ..........................................1944 1 Illinois ..................................................1950Opponents 0 9 games LAST: Ohio State ..........................................1973
Highest Completion Pct (Min 10 att)Michigan90.9 Notre Dame ......................................1991 85.7 Illinois ..................................................1986 85.7 Purdue ................................................1993Opponents 87.5 Navy .....................................................1963
Lowest Completion Pct. (Min 10 att)Michigan
0.0 Illinois (0-11) ....................................1950 10.0 Oklahoma (1-10) ............................1976Opponents 00.0 Michigan State (0-10) ....................1972
Most Net YardsMichigan419 Illinois ..................................................2010396 at Michigan State ............................1999
389 at Iowa ................................................2003 389 at Minnesota .....................................2003 375 at Ohio State .....................................1998Both Teams 796 at Michigan State ............................1999 757 at Indiana ...........................................2010 748 Minnesota ..........................................1994 705 at Ohio State .....................................1998 700 vs. USC (Rose) ...................................2006Opponents 480 Indiana ................................................2010 436 Northwestern ...................................1982 406 Tennessee ..........................................2002 400 at Michigan State ............................1999 394 Auburn ................................................2001
Fewest Net YardsMichigan
0 6 Times LAST: Ohio State ..........................................1976Both Teams 0 Illinois ..................................................1944 6 Illinois ..................................................1950Opponents -1 Virginia ................................................1971
Highest Avg. Yds per Comp. (Min 5)Michigan36.3 Purdue ................................................1975 31.5 Stanford ..............................................1947Opponents 28.6 Ohio State ..........................................1961
Lowest Avg. Yds per Comp. (Min 5)Michigan
4.8 Michigan State .................................1951 5.7 Michigan State .................................1962Opponents 3.9 South Carolina .................................1985
Highest Avg. Yards per Att. (Min 10)Michigan18.9 Illinois ..................................................1986 18.3 Michigan State .................................1947Opponents 20.0 Ohio State ..........................................1961
Lowest Avg. Yards per Att. (Min 10)Michigan
0.0 Illinois ..................................................19500.7 Army ....................................................1949
Opponents- 0.1 Virginia ................................................1971
Most Touchdown PassesMichigan
5 Cornell .................................................1952 5 Minnesota ..........................................1989 5 Houston ..............................................1992 5 Illinois ..................................................2010Both Teams 8 Florida State ......................................1991 8 Illinois ..................................................2010 7 Notre Dame ......................................2011 6 Purdue ................................................1984 6 Miami, FL ............................................1988 6 Purdue ................................................1989 6 Michigan State .................................1991 6 Houston ..............................................1992 6 Minnesota ..........................................1994 6 Western Michigan...........................2002 6 Illinois ..................................................2002 6 Nebraska (Alamo Bowl) ................2005 6 USC (Rose Bowl) ..............................2006Opponent 4 Purdue ................................................1962 4 Purdue ................................................1989 4 Florida State ......................................1991 4 USC (Rose Bowl) ..............................2006
Total OffenseMost Plays
Michigan 107 Minnesota ..........................................1968 96 Indiana ................................................1968 94 Minnesota ..........................................2004 92 Illinois ..................................................2010Both Teams 183 Indiana ................................................1968 180 Illinois ..................................................2010 174 Northwestern ...................................1968 171 Northwestern ...................................2000Opponents 98 Indiana ................................................2010 91 Maryland ............................................1990 90 Michigan State .................................1968 90 Northwestern ...................................2000 88 Purdue ................................................2000 88 Illinois ..................................................2010
Fewest PlaysMichigan 39 Western Michigan (shortened) ..2011 40 Ohio State ..........................................1955Both Teams 95 Western Michigan (shortened) ..2011 102 Illinois ..................................................1938 102 Iowa .....................................................1946Opponents 33 California ............................................1940
Most Net YardsMichigan 727 Delaware State .................................2009 721 Bowling Green .................................2010 715 Mississippi .........................................1991 676 Illinois ..................................................2010 673 Iowa .....................................................1969Both Teams 1237 Illinois ..................................................2010 1189 Northwestern ...................................2000 1142 Indiana ................................................20101139 Illinois ..................................................1981 1051 Minnesota ..........................................1994Opponents 654 Northwestern ...................................2000 624 Oregon ................................................2007 568 Indiana ................................................2010 561 Illinois ..................................................2010 558 Wisconsin ...........................................2010
Fewest Net YardsMichigan 6 Michigan State .................................1951 27 Ohio State ..........................................1950Both Teams 68 Ohio State ..........................................1950 285 Minnesota ..........................................1962Opponents 10 Michigan State .................................1942
Highest Average Yards per PlayMichigan 9.05 Minnesota ..........................................1996 9.00 Minnesota ..........................................1989 8.96 Northwestern ...................................1991
Opponents8.4 Ohio State ..........................................1961
Lowest Average Yards per PlayMichigan0.12 Michigan State .................................1951 0.59 Ohio State ..........................................1950Opponents 0.71 Ohio State ..........................................1950
PuntingMost Punts
Michigan24 Ohio State ..........................................1950
14 Illinois ..................................................1950Both Teams 45 Ohio State ..........................................1950 26 Iowa .....................................................1941Opponents 21 Ohio State ..........................................1950 15 Chicago...............................................1938
Fewest PuntsMichigan
0 Western Michigan...........................1943 0 Northwestern ...................................1978 0 Delaware State .................................2009Both Teams 3 Michigan State .................................1957 3 Ohio State ..........................................1959 3 Ohio State ..........................................1961 3 California ............................................1980 3 Washington .......................................1983 3 Indiana ................................................1991Opponents 0 Michigan State .................................1962 0 Notre Dame ......................................1986
Most YardsMichigan723 Ohio State ..........................................1950
446 Illinois ..................................................1950Opponents 685 Ohio State ..........................................1950 486 Navy .....................................................1971
Fewest YardsMichigan
0 Western Michigan...........................1943 0 Northwestern ...................................1978 0 Delaware State .................................2009Opponents 0 Michigan State .................................1962 0 Notre Dame ......................................1986
Most Punts Blocked byMichigan
4 Ohio State ..........................................1950 2 Five games LAST: Minnesota ..........................................1993Both Teams 5 Ohio State ..........................................1950Opponent 2 Illinois ..................................................1952 2 Purdue ................................................1989
Highest Net Yds Per Punt(Min 3 punts)
Michigan56.3 Northwestern ...................................1981 53.3 Oregon State ....................................1959Opponents 53.3 Indiana ................................................1987
Lowest Net Yds Per Punt(Min 3 punts)
Michigan17.0 Pittsburgh ..........................................1947 20.3 Northwestern ...................................1965Opponents 19.5 Purdue ................................................1983
Punt ReturnsMost Punts Returned
Michigan11 Pittsburgh ..........................................1947
10 Chicago...............................................1938Both Teams 16 Illinois ..................................................1938 15 Chicago...............................................1938Opponents 8 Michigan State .................................1938 8 Ohio State ..........................................1938
Most Yards ReturnedMichigan196 Pittsburgh ..........................................1947
143 California ............................................1940
TEAM SINGLE GAME RECORDSBoth Teams196 Pittsburgh ..........................................1947
181 Ohio State ..........................................1971Opponents 166 Ohio State ..........................................1971
Fewest Yards ReturnedMichigan
-14 Wisconsin ...........................................1980 -7 Washington .......................................1969Both Teams -10 Wisconsin ...........................................1980 -9 Illinois ..................................................1976Opponents -9 Purdue ................................................1995 -7 Minnesota ..........................................1971
Highest Avg. Yds Per Return(Min. 3 rtns)
Michigan40.3 Minnesota ..........................................1959 35.0 Navy .....................................................1968Opponents 35.3 Michigan State .................................1995 33.2 Ohio State ..........................................1971
Lowest Avg. Yds Per Return(Min. 3 rtns)
Michigan- 1.0 Wisconsin ...........................................1968 -1.0 Purdue ................................................1993Opponents - 1.7 Wisconsin ...........................................1974
Kickoff ReturnsMost Kickoffs Returned
Michigan9 Ohio State ..........................................1968
8 Northwestern ...................................1958 8 Ohio State ..........................................1961 8 Purdue ................................................1962 8 Tennessee ..........................................2002Both Teams 14 Illinois ..................................................1986 14 Minnesota ..........................................1951 14 Texas (Rose Bowl) ...........................2004Opponents 11 Pittsburgh ..........................................1947 11 Illinois ..................................................1986
Fewest Kickoffs ReturnedMichigan
0 Many games LAST: at Illinois .............................................2011Both Teams 0 Ohio State ..........................................1980Opponents 0 Many games LAST: Indiana ................................................1982
Most Yards ReturnedMichigan241 Ohio State ..........................................1961
221 Texas (Rose Bowl) ...........................2004 186 Nebraska (Alamo Bowl) ................2005 172 Minnesota ..........................................2005Both Teams 435 Texas (Rose Bowl) ...........................2004 307 Minnesota ..........................................1951 284 Ohio State ..........................................1961Opponents 230 Minnesota ..........................................1951 214 Texas (Rose Bowl) ...........................2004
Fewest Yards ReturnedMichigan
- 2 Michigan State .................................1992Both Teams 0 Ohio State ..........................................1980 17 Iowa .....................................................1941 17 Ohio State ..........................................1983Opponents 0 Many games LAST: UCLA ....................................................1983
Highest Avg. Yards Per Return(Min. 3 rtns)
Michigan39.0 Ohio State ..........................................1981 39.0 Michigan State .................................1990Opponents 64.0 Notre Dame ......................................1989 35.3 Wisconsin ...........................................1944
Lowest Avg. Yards Per Return(Min. 3 rtns)
Michigan3.7 Illinois ..................................................1941
4.8 Ohio State ..........................................1954
Opponents5.7 Indiana ................................................1980
Total ReturnsMost Returns
Michigan15 Pittsburgh ..........................................194715 Minnesota ..........................................195115 Nebraska (Alamo Bowl) ................2005
Both Teams 27 Ohio State ..........................................1946 27 Pittsburgh ..........................................1947Opponents 15 Wisconsin ...........................................1969
Fewest ReturnsMichigan
1 Iowa .....................................................1977 1 Wisconsin ...........................................1980 1 Illinois ..................................................1991Both Teams 4 Iowa .....................................................1977 5 Iowa .....................................................1985Opponents 1 Iowa .....................................................1985 1 Notre Dame ......................................1997
Most Yards ReturnedMichigan311 Pittsburgh ..........................................1947267 Minnesota ..........................................1951267 Maryland ............................................1990
Both Teams502 Minnesota ..........................................1951493 Pittsburgh ..........................................1947
Opponents243 Illinois ..................................................1966223 Texas (Rose Bowl) ...........................2004
Fewest Yards ReturnedMichigan
-14 Wisconsin ...........................................19800 Illinois ..................................................1991
Both Teams 15 Wisconsin ...........................................1980 22 California ............................................1966Opponents 2 Iowa .....................................................1985
Highest Avg. Yards Per Return(Min 4 rtns)
Michigan32.2 Michigan State .................................1990 31.3 Illinois ..................................................1972Opponents 48.5 Notre Dame ......................................1989 30.9 Iowa .....................................................1958
Lowest Avg. Yards Per Return(Min 4 rtns)
Michigan0.5 Northwestern ...................................19511.0 Wisconsin ..........................................1986
Opponents1.2 Wisconsin ...........................................1981
Most Touchdowns ReturnedMichigan
3 Pittsburgh ..........................................1947 2 California ............................................1940 2 Tulane..................................................1972 2 Northwestern ...................................1975 2 North Carolina State ......................1994Both Teams 3 Pittsburgh ..........................................1947 3 Illinois ..................................................1966Opponents 2 Illinois ..................................................1966 2 Notre Dame ......................................1989 2 Florida State ......................................1991
InterceptionsMost Interceptions
Michigan6 Ohio State ..........................................1940
6 Minnesota ..........................................1951 6 Ohio State ..........................................1969 6 Miami, FL ............................................1984 6 Michigan State .................................1997Both Teams 9 Wisconsin ...........................................1959 9 Indiana ................................................1946Opponents 7 Michigan State .................................1987
6 Indiana ................................................1946 6 Michigan State .................................1959
Most Yards ReturnedMichigan 138 Northwestern ...................................1968 137 Northwestern ...................................1946Both Teams 170 Northwestern ...................................1946 158 Indiana ................................................1956Opponents 123 Michigan State .................................1959
Fewest Yards ReturnedMichigan - 3 Wisconsin ...........................................1988 - 3 Indiana ................................................1988Both Teams - 3 Wisconsin ...........................................1988 - 3 Indiana ................................................1988Opponents - 3 Northwestern ...................................1968
FumblesMost Fumbles
Michigan 12 Illinois ..................................................1946 10 Illinois ..................................................1992Both Teams 15 Wisconsin ...........................................1944 13 Five games LAST: Michigan State .................................1973Opponents 12 Wisconsin ...........................................1944
Most Fumbles LostMichigan 5 Many games LAST: North Carolina .................................1965Both Teams 10 Army ....................................................1955 9 Illinois ..................................................1968 9 Indiana ................................................1972Opponents 8 Army ....................................................1955 6 Army ....................................................1956 6 Indiana ................................................1972 6 Michigan State .................................1973
Most Fumble Return YardsMichigan 83 Minnesota ..........................................2011Both Teams 83 Minnesota ..........................................2011Opponents 38 Memphis ............................................1995 19 Houston ..............................................1993
TurnoversMost Turnovers
Michigan 8 Ohio State ..........................................1952 8 Indiana ................................................1959Both Teams 15 Army ....................................................1955 14 Indiana ................................................1946Opponents 10 Army ....................................................1955
Fewest TurnoversMichigan 0 Many games LAST: Minnesota ..........................................2011Both Teams 0 Wisconsin ...........................................1943 0 Iowa .....................................................1961 0 Minnesota ..........................................1966 0 UCLA ....................................................1972 0 Michigan State .................................1995 0 Penn State .........................................2002Opponents 0 Many games LAST: Ohio State ..........................................2002
PenaltiesMost Penalties
Michigan 15 UCLA ....................................................1981 14 Harvard ...............................................1940 14 Army ....................................................1962Both Teams 28 vs. Alabama .......................................2000 24 UCLA ....................................................1981 22 Southern California ........................1957 22 Oregon State ....................................1986Opponents 18 vs. Alabama .......................................2000
14 Colorado.............................................1996 13 Great Lakes ........................................1945 13 Oregon State ....................................1986 13 Michigan State .................................2011
Fewest PenaltiesMichigan
0 Many games LAST: Wisconsin ...........................................1980Both Teams 1 Purdue ................................................1948 1 Ohio State ..........................................1962 1 Arizona ................................................1978Opponents 0 Many games LAST: Wisconsin ...........................................1997
Most Yards PenalizedMichigan148 UCLA ....................................................1981
146 South Carolina .................................1985Both Teams 247 vs. Alabama .......................................2000 246 Indiana ................................................1955 242 UCLA ....................................................1981Opponents 132 vs. Alabama .......................................2000 129 Illinois ..................................................1980
Fewest Yards PenalizedMichigan
0 Many games LAST: Wisconsin ...........................................1980Both Teams 5 Arizona ................................................1978 5 Purdue ................................................1948Opponents 0 Many games LAST: Wisconsin ...........................................1997
ScoringMost Points (Since 1879)
Michigan130 West Virginia .....................................1904
128 Buffalo .................................................1901 119 Michigan Agricultural....................1902 107 Iowa .....................................................1902 95 Kalamazoo .........................................1904Both Teams 132 Illinois ..................................................2010 130 West Virginia .....................................1904 128 Buffalo .................................................1901 119 Michigan Agricultural....................1902 107 Iowa .....................................................1902Opponents 65 Illinois ..................................................2010 58 Cornell .................................................1891 56 Cornell .................................................1889 55 Northwestern ...................................1958 54 Northwestern ...................................2000
Fewest Points (Since 1879)Michigan
0 73 games LAST: Iowa .....................................................1984Both Teams 0 12 games LAST: Northwestern ...................................1938Opponents 0 334 games LAST: Minnesota ..........................................2011
Most Decisive Win130 pts West Virginia .....................................1904 85 pts Chicago...............................................1939 69 pts Pittsburgh ..........................................1947 69 pts Northwestern ...................................197558 pts Minnesota ..........................................2011 57 pts Illinois ..................................................196957 pts Delaware State .................................2009
Most Decisive Loss36 pts Ohio State ..........................................196835 pts at Ohio State .....................................2008 31 pts Northwestern ...................................195829 pts at Penn State ....................................2008
Most TouchdownsMichigan
12 Chicago...............................................1939 10 Pittsburgh ..........................................1947 10 Northwestern ...................................1975 10 Illinois ..................................................1981Both Teams 13 Illinois ..................................................1981 13 Northwestern ...................................2000 12 Chicago...............................................1939 12 Minnesota ..........................................1951 12 Northwestern ...................................1977
RECORD BOOK12 Florida State ......................................1991
Opponents 8 Northwestern ...................................1958 8 Florida State ......................................1991 7 Ohio State ..........................................1961 7 Ohio State ..........................................1968
Fewest TouchdownsMichigan
0 Many games LAST: Purdue ................................................1995Both Teams 0 Many games LAST: Purdue ................................................1995Opponents 0 Many games LAST: Minnesota ..........................................2011
Most Touchdowns By:Rushing
Michigan9 Chicago...............................................1939
8 Iowa .....................................................1971 8 Indiana ................................................1975 8 Illinois ..................................................1986Both Teams 9 Chicago...............................................1939 9 Ohio State ..........................................1968 9 Indiana ................................................1975 9 Illinois ..................................................1986 9 Wisconsin ...........................................1988Opponents 7 Ohio State ..........................................1968 6 Wisconsin ...........................................2010
PassingMichigan
5 Cornell .................................................1952 5 Minnesota ..........................................1989 5 Houston ..............................................1992Both Teams 8 Florida State ......................................1991 7 Northwestern ...................................2000 7 Notre Dame ......................................2011 6 Purdue ................................................1984 6 Miami, FL ............................................1988 6 Purdue ................................................1989 6 Michigan State .................................1991 6 Houston ..............................................1992 6 Minnesota ..........................................1994Opponents 4 Purdue ................................................1962 4 Purdue ................................................1989 4 Florida State ......................................1991 4 Northwestern ...................................2000
Most Points by Quarter:First Quarter
Michigan28 Rice .......................................................2000
28 Eastern Michigan ............................2005 28 Delaware State .................................2009 24 Northwestern ...................................1991 23 Wisconsin ...........................................1976Both Teams 31 Northwestern ...................................1991 29 Florida State ......................................1991Opponents 27 Illinois ..................................................1924 21 Illinois ..................................................1981 21 Notre Dame ......................................2008
Second QuarterMichigan
35 Northwestern ...................................1982 35 Houston ..............................................1992 35 Indiana ................................................2000Both Teams 49 Illinois ..................................................2010 35 Indiana ................................................1973 35 Northwestern ...................................1978 35 Northwestern ...................................1982 35 Houston ..............................................1992Opponents 34 Northwestern ...................................1958
Third QuarterMichigan
28 Iowa .....................................................1971 28 Navy .....................................................1972 28 Navy .....................................................1976 28 Northwestern ...................................1977 28 Minnesota ..........................................1992Both Teams 35 vs. Alabama .......................................2000 34 Minnesota ..........................................1992 30 Iowa .....................................................1992 30 Northwestern ...................................2000Opponents 20 Indiana ................................................1956 20 Cornell .................................................1951
Fourth QuarterMichigan
31 at Minnesota .....................................2003 28 Pittsburgh ..........................................1947 28 Vanderbilt ..........................................1969 28 Northwestern ...................................1975 28 Illinois ..................................................1981 28 Notre Dame ......................................2011Both Teams 39 Penn State .........................................2005 38 at Minnesota .....................................2003 37 Ohio State ..........................................1961 35 Vanderbilt ..........................................1969 35 Purdue ................................................1982 35 Notre Dame ......................................2011Opponents 29 Ohio State ..........................................1961 22 Penn State .........................................2005
Most Points by Half:First Half
Michigan55 Chicago...............................................193949 Delaware State .................................2009
45 Northwestern ...................................1991 45 Indiana ................................................2000Both Teams 62 Illinois ..................................................2010 55 Chicago...............................................1939 54 Florida State ......................................1991 52 Northwestern ...................................1991 51 Northwestern ...................................2000Opponents 43 Northwestern ...................................1958 32 Oregon ................................................2007 31 Illinois ..................................................2010
Second HalfMichigan
49 Pittsburgh ..........................................194749 Navy .....................................................197649 Northwestern ...................................1977
Both Teams62 Northwestern ...................................197759 at Minnesota .....................................2003
54 Northwestern ...................................2000 49 Pittsburgh ..........................................1947 49 Navy .....................................................1976Opponents 31 Ohio State ..........................................1988 31 Northwestern ...................................2000 29 Ohio State ..........................................1961 29 Ohio State ..........................................1968
Most ConversionsMichigan
10 Chicago...............................................193910 Illinois ..................................................1981
Both Teams13 Illinois ..................................................198111 Navy .....................................................197611 Northwestern ...................................1977
Opponents7 Ohio State ..........................................1961
6 Tennessee ..........................................2002 6 Illinois ..................................................2010
Most Two-point ConversionsMichigan
3 Northwestern ...................................1958 2 Indiana ................................................1960 2 Wisconsin ...........................................1970 2 Minnesota ..........................................1987Both Teams 5 Northwestern ...................................1958 3 Iowa .....................................................1958Opponents 2 Northwestern ...................................1958 2 Iowa .....................................................1958 2 Wisconsin ...........................................1959 2 Minnesota ..........................................1961 2 Iowa .....................................................1992
Most Two-point Conversions Att.Michigan
3 Eight games LAST: Colorado.............................................1994Both Teams 9 Northwestern ...................................1958 6 Minnesota ..........................................1968Opponents 6 Northwestern ...................................1958
Most Field GoalsMichigan
5 Minnesota ..........................................1988 5 Illinois ..................................................1990Both Teams
7 Texas A&M .........................................1995 6 Stanford ..............................................1975 6 Notre Dame ......................................1985 6 Illinois ..................................................1990 6 Michigan State .................................1994 6 Northwestern ...................................1995Opponents 5 Texas A&M .........................................1995 4 Ohio State ..........................................1974 4 Notre Dame ......................................1979 4 Notre Dame ......................................1985 4 Iowa .....................................................1985 4 Notre Dame ......................................1988 4 Northwestern ...................................1995 4 Northwestern ...................................2000
Most Field Goals Att. (Since 1964)Michigan 5 Ohio State ..........................................1969 5 Stanford ..............................................1975 5 California ............................................1979 5 Illinois ..................................................1984 5 Miami, FL ............................................1988 5 Minnesota ..........................................1988 5 Illinois ..................................................1990 5 Notre Dame ......................................1994 5 Illinois ..................................................1994Both Teams 8 Ohio State ..........................................1974 8 Texas A&M .........................................1995Opponents 5 Texas A&M .........................................1995 5 Michigan State .................................1965 5 Minnesota ..........................................1977 5 Ohio State ..........................................1977 5 Iowa .....................................................1985
Most SafetiesMichigan 2 Navy .....................................................1976Both Teams 2 Navy .....................................................1976Opponents 1 Many games LAST: Notre Dame ......................................2002
Third Downs(Since 1981)
Most Third Down AttemptsMichigan 21 Miami, FL ............................................1988 20 South Carolina .................................1985 20 Illinois ..................................................1990 20 Houston ..............................................1992 20 Northwestern ...................................1997Opponents 21 Iowa .....................................................1985 21 Indiana ................................................1991 21 Ohio State ..........................................1996
Fewest Third Down AttemptsMichigan 6 Wisconsin ...........................................1982 6 Western Michigan (shortened) ..2011 9 Iowa .....................................................1985 9 Notre Dame ......................................1987 9 Minnesota ..........................................1990 9 Notre Dame ......................................2011Opponents 8 Wisconsin ...........................................1986 9 Indiana ................................................1987 9 Illinois ..................................................1990
Highest Third Down Conversion Pct.Michigan 87.5 Indiana (14/16) ................................1981 78.6 Northwestern (11/14) ....................1988Opponents 77.8 Purdue (14/18) .................................2000 73.3 Purdue (11/15) .................................1984 71.4 Washington (10/14) .......................1983
Lowest Third Down Conversion Pct.Michigan 0.0 Notre Dame (0/11) ........................1982 0.0 Penn State (0/9) ..............................1994Opponents 0.0 Memphis (0/15) ..............................1995 0.0 Minnesota (0/13)............................1992 0.0 Indiana (0/12) ..................................1992 0.0 Penn State (0/12) ............................1997 0.0 Indiana (0/12) ...................................2004 0.0 Minnesota (0/11) .............................2011
TEAM SEASON RECORDS
First DownsMost First Downs
Michigan 311 ........................................2003 286 ........................................1986 271 ........................................1971Both Teams 525 ........................................1982 518 ........................................1986Opponents 292 ........................................2010 247 ........................................2000 243 ........................................1994
Most First Downs Per GameMichigan 23.9 .......................................2003 22.6 .......................................1971 22.4 .......................................1992Opponents 22.5 .......................................2010 20.5 .......................................2000 20.3 .......................................1994
Fewest First DownsMichigan 85 ..........................................1939 92 ..........................................1938Both Teams 158 ........................................1938 160 ........................................1939Opponents 49 ..........................................1940
Fewest First Downs Per GameMichigan 10.6 .......................................1939 10.9 .......................................1962Opponents 6.1 .........................................1940
Most by RushingMichigan 229 ........................................1971 211 ........................................1976Opponents 130 ........................................1968 125 ........................................2010
Fewest by RushingMichigan 60 ..........................................1939 61 ..........................................1962Opponents 31 ..........................................1940
Most by PassingMichigan 164 ........................................2003 143 ........................................1999 143 ........................................2002Opponents 152 ........................................1982 148 ........................................2010 135 ........................................2000 132 ........................................2006
Fewest by PassingMichigan 12 ..........................................1944 14 ..........................................1941 14 ..........................................1943Opponents 12 ..........................................1940 12 ..........................................1943
Most by PenaltyMichigan 20 ..........................................1999 20 ..........................................2001 19 ..........................................1997 19 ..........................................1982 19 ..........................................1998Opponents 21 ..........................................1966 20 ..........................................2004 19 ..........................................2006 19 ..........................................2010
Fewest by PenaltyMichigan 0 .............................................1940 2 .............................................1938 2 .............................................1939 2 .............................................1941 2 .............................................1946Opponents 1 .............................................1938 1 .............................................1943 1 .............................................1959
Team Season RecordsRushing
Most AttemptsMichigan 842 ........................................1971 738 ........................................1975Both Teams 1287 .....................................1975 1283 .....................................1971Opponents 554 ........................................2010 549 ........................................1975
Most Attempts Per GameMichigan 70.2 .......................................1971 63.2 .......................................1973Opponents 54.6 .......................................1968
Fewest AttemptsMichigan 336 ........................................1939 388 ........................................1938Both Teams 674 ........................................1938 697 ........................................1940Opponents 255 ........................................1940
Fewest Attempts Per GameMichigan 38.5 .......................................1999 38.8 .......................................2002 40.0 .......................................2001 40.5 .......................................1998 41.2 .......................................2006Opponents 31.9 .......................................1940
Most Net YardsMichigan 4144 .....................................1976 3978 .....................................1971Both Teams 5598 .....................................1976 5453 .....................................1975Opponents 2456 .....................................2010 1982 .....................................1968
Most Net Yards Per GameMichigan 345.3 ....................................1976 331.5 ....................................1971Opponents 208.8 ....................................1957
Fewest Net YardsMichigan 891 ........................................1962 1180 .....................................1963Both Teams 2047 .....................................1948 2414 .....................................1938Opponents 564 ........................................2006 789 ........................................1948 789 ........................................1971
Fewest Net Yards Per GameMichigan 99.0 .......................................1962 121.8 ....................................1999 131.1 ....................................1963Opponents 43.4 .......................................2006 65.8 .......................................1971
Highest Average Yards Per RushMichigan 5.9 .........................................1976 5.7 .........................................1992 5.6 .........................................2010Opponents 4.2 .........................................1962
Lowest Average Yards Per RushMichigan 2.2 .........................................1962 2.7 .........................................1951Opponents 1.8 .........................................1971 1.9 .........................................2006
Most Touchdowns RushingMichigan 47 ..........................................1971 43 ..........................................1976Opponents 34 ..........................................2010 19 ..........................................1957 19 ..........................................1958
Fewest Touchdowns RushingMichigan 9 .............................................1962 10 ..........................................1959Opponents 2 .............................................1940 2 .............................................1973 4 .............................................1985
PassingMost Attempted
Michigan 476 ........................................2003 472 ........................................2002 437 ........................................1999 415 ........................................2004 409 ........................................2005Both Teams 912 ........................................2002 886 ........................................2003 822 ........................................2001 819 ........................................2006 800 ........................................2005Opponents 479 ........................................1982
Most Attempted Per GameMichigan 36.6 .......................................2003 36.4 .......................................1999 36.2 .......................................2002 34.6 .......................................2004 34.1 .......................................2005Opponents 39.9 .......................................1982 37.5 .......................................2006
Fewest AttemptedMichigan 74 ..........................................1943 75 ..........................................1941Both Teams 185 ........................................1940 190 ........................................1943Opponents 86 ..........................................1940
Fewest Attempted Per GameMichigan 7.9 .........................................1944 8.2 .........................................1943Opponents 9.6 .........................................1955
Most CompletedMichigan 284 ........................................2003 264 ........................................1999 259 ........................................2002 248 ........................................2004 243 ........................................2010Both Teams 505 ........................................2003 504 ........................................2010 495 ........................................2002 468 ........................................2006 461 ........................................2005Opponents 295 ........................................1982 262 ........................................2006 261 ........................................2010 247 ........................................2000
Most Completed Per GameMichigan 22.0 .......................................1999 21.8 .......................................2003 20.7 .......................................2004 19.9 .......................................2002 19.8 .......................................2005Opponents 24.6 .......................................1982
Fewest CompletedMichigan 24 ..........................................1944 33 ..........................................1941Both Teams 66 ..........................................1943 66 ..........................................1944Opponents 24 ..........................................1940
Fewest Completed Per GameMichigan 2.4 .........................................1944 3.4 .........................................1975Opponents 3.0 .........................................1940
Highest Completion Pct.Michigan 65.2 .......................................1992 64.8 .......................................1991Opponents 63.8 .......................................2010 62.6 .......................................1984
Lowest Completion Pct.Michigan 30.4 .......................................1944 32.8 .......................................1975Opponents 27.9 .......................................1940
Most Net YardsMichigan 3520 .....................................2003 3252 .....................................2010 3177 .....................................1999 3026 .....................................2002 2931 .....................................1998Both Teams 6656 .....................................2010 5945 .....................................2002 5867 .....................................2003 5723 .....................................1999 5686 .....................................2000Opponents 3404 .....................................2010 3057 .....................................1982 2924 .....................................2006 2919 .....................................2002 2914 .....................................2000
Most Net Yards Per GameMichigan 270.8 ....................................2003 264.8 ....................................1999 250.2 ....................................2010 232.8 ....................................2002 231.0 ....................................2000Opponents 261.8 ....................................2010 254.8 ....................................1982 242.8 ....................................2000 229.3 ....................................2001 224.9 ....................................2006
Fewest Net YardsMichigan 418 ........................................1941 492 ........................................1944Both Teams 955 ........................................1941 1079 .....................................1943Opponents 402 ........................................1955
Fewest Net Yards Per GameMichigan 49.2 .......................................1944 52.3 .......................................1941Opponents 44.7 .......................................1955
Highest Avg. Yards Per CompMichigan 21.0 .......................................1946 20.5 .......................................1944Opponents 18.8 .......................................1958
Lowest Avg. Yards Per CompMichigan 10.9 .......................................1967 11.1 .......................................1962Opponents 9.6 .........................................1978
Highest Avg Yards Per AttemptMichigan 9.9 .........................................1947 9.8 .........................................1986Opponents 8.4 .........................................1958 8.3 .........................................2010
Lowest Avg. Yards Per AttemptMichigan 4.3 .........................................1949 4.7 .........................................1962Opponents 3.9 .........................................1943
Most Interceptions ThrownMichigan 22 ..........................................1946 21 ..........................................1953 21 ..........................................1959Both Teams 44 ..........................................1946 44 ..........................................1947Opponents 27 ..........................................1947
Fewest Interceptions ThrownMichigan 2 .............................................1988 4 .............................................1972 5 .............................................2000Both Teams 12 ..........................................1961 16 ..........................................1966 18 ..........................................1999Opponents 7 .............................................1941 7 .............................................1958 7 .............................................1961
RECORD BOOK
Most Touchdown PassesMichigan 26 ..........................................2003 26 ..........................................2000 25 ..........................................1991 25 ..........................................1992 25 ..........................................2004Both Teams 44 ..........................................2010 42 ..........................................1991 42 ..........................................2000 41 ..........................................1999 41 ..........................................2006Opponents 23 ..........................................1994 21 ..........................................2010 19 ..........................................2006 18 ..........................................1999 17 ..........................................1991 17 ..........................................2002
Fewest Touchdown PassesMichigan 1 .............................................1962 3 .............................................1941Both Teams 4 .............................................1941 6 .............................................1960Opponents 1 .............................................1941 1 .............................................1960 1 .............................................1972
Total OffenseMost Plays
Michigan 1014 .....................................2003 977 ........................................2002 967 ........................................1971 961 ........................................1995Both Teams 1904 .....................................2010 1882 .....................................2002 1858 .....................................2003 1841 .....................................1995 1815 .....................................1998Opponents 963 ........................................2010 931 ........................................1982
Most Plays Per GameMichigan 83.5 .......................................1969 80.6 .......................................1971Opponents 79.5 .......................................1968 74.1 .......................................2010
Fewest PlaysMichigan 456 ........................................1939 495 ........................................1941Both Teams 882 ........................................1940 942 ........................................1938Opponents 341 ........................................1940
Fewest Plays Per GameMichigan 56.4 .......................................1955 57.0 .......................................1939Opponents 42.6 .......................................1940
Most Net YardsMichigan 6353 .....................................2010 5807 .....................................2003 5603 .....................................1992 5396 .....................................1986 5353 .....................................2000Both Teams 12213 ...................................2010 10032 ...................................2000 9670 .....................................2003 9475 .....................................2002 9332 .....................................1994Opponents 5860 .....................................2010 4679 .....................................2000 4520 .....................................2002 4401 .....................................1982 4142 .....................................2005
Most Net Yards Per GameMichigan 488.7 ....................................2010 466.9 ....................................1992 446.7 ....................................2003 446.1 ....................................2000 432.5 ....................................1990Opponents 450.8 ....................................2010 389.9 ....................................2000 366.8 ....................................1982
Fewest Net YardsMichigan 1602 .....................................1962 2079 .....................................1959Both Teams 3745 .....................................1940 3855 .....................................1938Opponents 1282 .....................................1940
Fewest Net Yards Per GameMichigan 178.0 ....................................1962 231.0 ....................................1959Opponents 160.3 ....................................1940
Highest Average Yards Per PlayMichigan 6.8 .........................................2010 6.4 .........................................1992 6.4 .........................................1947Opponents 6.1 .........................................2010 5.6 .........................................1994 5.3 .........................................2000 5.1 .........................................1984
Lowest Average Yards Per PlayMichigan 2.9 .........................................1962 3.5 .........................................1951Opponents 3.0 .........................................1943
PuntingMost Punts
Michigan 83 ..........................................1950 77 ..........................................2001 74 ..........................................2002 73 ..........................................1951Both Teams 173 ........................................1950 169 ........................................2001 164 ........................................1995Opponents 95 ..........................................2003 93 ..........................................1995 92 ..........................................1950 92 ..........................................2001
Most Punts Per GameMichigan 8.5 .........................................1938 8.3 .........................................1950Opponents 10.3 .......................................1938
Fewest PuntsMichigan 31 ..........................................1943 32 ..........................................1956Both Teams 73 ..........................................1956 76 ..........................................1957Opponents 36 ..........................................1962
Fewest Punts Per GameMichigan 2.8 .........................................1976 3.0 .........................................1986Opponents 4.0 .........................................1962
Most YardsMichigan 3077 .....................................2002 2985 .....................................2001 2774 .....................................1999 2757 .....................................2004 2753 .....................................1950Opponents 4045 .....................................2003
Fewest YardsMichigan 1112 .....................................1957 1155 .....................................1956
Highest Net Yards Per PuntMichigan 43.6 .......................................1986 43.3 .......................................1981Both Teams 41.60 ....................................1984 41.55 ....................................1981Opponents 42.6 .......................................2003 41.8 .......................................2005 41.6 .......................................2010 41.1 .......................................1985
Lowest Net Yards Per PuntMichigan 32.7 .......................................1957 33.2 .......................................1950Both Teams 33.66 ....................................1954 33.79 ....................................1957Opponents 29.8 .......................................1941
Most Punts BlockedMichigan 7 .............................................1950 7 .............................................2001 5 .............................................1940Opponents 5 .............................................1989 4 .............................................1979
Punt ReturnsMost Punts Returned
Michigan 53 ..........................................2003 53 ..........................................1971 51 ..........................................1997 49 ..........................................2001Both Teams 87 ..........................................2001 84 ..........................................1971 84 ..........................................2002 81 ..........................................2003 81 ..........................................1950Opponents 47 ..........................................1938
Fewest Punts ReturnedMichigan 14 ..........................................2010 17 ..........................................1994 18 ..........................................1962Both Teams 23 ..........................................2010 36 ..........................................1988 36 ..........................................1994Opponents 8 .............................................1990 9 .............................................2010 11 ..........................................1976
Most Yards ReturnedMichigan 791 ........................................1947 756 ........................................2002 673 ........................................2003 587 ........................................1990 511 ........................................2001Both Teams 1021 .....................................2003 905 ........................................1947 898 ........................................2004 813 ........................................2001 774 ........................................1999Opponents 485 ........................................2004 429 ........................................1962 413 ........................................1999
Fewest Yards ReturnedMichigan 64 ..........................................1962 104 ........................................2010 118 ........................................1994Both Teams 192 ........................................2010 230 ........................................1986 270 ........................................1994Opponents 14 ..........................................1990 39 ..........................................1976
Highest Avg. Yards Per Punt ReturnMichigan 18.0 .......................................1947 15.2 .......................................1990Opponents 15.9 .......................................1943
Lowest Avg. Yards Per Punt ReturnMichigan 3.6 .........................................1962 5.5 .........................................1952Opponents 1.8 .........................................1990 2.9 .........................................1981 2.9 .........................................1984
Most Returned for TouchdownsMichigan 4 .............................................1947 2 ...........................Many seasons ..................................LAST: 2004Opponents 3 .............................................2003 2 .............................................1999
Kickoff ReturnsMost Kickoffs Returned
Michigan 72 ..........................................2010 44 ..........................................1998 40 ..........................................2005 39 ..........................................1994 39 ..........................................1995Both Teams 103 ........................................1994 102 ........................................1991Opponents 68 ..........................................1992 67 ..........................................1971 60 ..........................................2010
Fewest Kickoffs ReturnedMichigan 8 .............................................1940 10 ..........................................1941Both Teams 32 ..........................................1940 40 ..........................................1941Opponents 20 ..........................................1938
Most Yards ReturnedMichigan 1544 .....................................2010 936 ........................................2005 928 ........................................1990 926 ........................................1998 911 ........................................2004Both Teams 2819 .....................................2010 2056 .....................................1994 2022 .....................................1990Opponents 1318 .....................................2006 1275 .....................................2010 1226 .....................................1992 1211 .....................................1986 1180 .....................................2003
Fewest Yards ReturnedMichigan 153 ........................................1938 179 ........................................1941Both Teams 671 ........................................1941 675 ........................................1940Opponents 228 ........................................1938
Highest Avg. Yards/Kickoff ReturnMichigan 27.9 .......................................1940 27.3 .......................................1990Opponents 23.7 .......................................1944
Lowest Avg. Yards/Kickoff ReturnMichigan 11.9 .......................................1966 13.9 .......................................1965Opponents 6.4 .........................................1969
Most Returned for TouchdownsMichigan 1 ......................................12 times LAST: ....................................2005
Total ReturnsMost Returns
Michigan 107 ........................................1998 100 ........................................1997 100 ........................................2010 97 ..........................................1990 96 ..........................................2003Both Teams 199 ........................................1971 192 ........................................2003 191 ........................................1995Opponents 105 ........................................1971 105 ........................................1992
Fewest ReturnsMichigan 46 ..........................................1941 58 ..........................................1940 58 ..........................................1954 58 ..........................................1955 58 ..........................................1963Both Teams 110 ........................................1963 112 ........................................1940Opponents 50 ..........................................1996 52 ..........................................1963 56 ..........................................2005
Most Yards ReturnedMichigan 1891 .....................................2010 1680 .....................................1990 1651 .....................................2004 1545 .....................................1998 1537 .....................................2005Both Teams 3425 .....................................2004 3041 .....................................2003 2900 .....................................1990 2790 .....................................1968 2720 .....................................2006Opponents 1774 .....................................2004 1648 .....................................2003 1651 .....................................2006 1570 .....................................1968 1550 .....................................2010
Fewest Yards ReturnedMichigan 556 ........................................1941 732 ........................................1984Both Teams 1153 .....................................1986 1393 .....................................1940Opponents 519 ........................................1981
Highest Avg. Yards Per ReturnMichigan 19.4 .......................................2004 18.9 .......................................2010 17.3 .......................................1990 16.6 .......................................1982Opponents 18.4 .......................................2010 17.6 .......................................1966 17.6 .......................................1997 17.4 .......................................2004
Lowest Avg. Yards Per ReturnMichigan 10.3 .......................................1978 10.5 .......................................1984Opponents 7.1 .........................................1969
Most Returned for TouchdownsMichigan 7 .............................................1947 6 .............................................2003 5 .............................................1972 4 .............................................1998Opponents 4 .............................................2003 3 .............................................1989 3 .............................................1999 2 ................................Eight times LAST: ..................................2005
InterceptionsMost Interceptions
Michigan 27 ..........................................1947 25 ..........................................1949 25 ..........................................1968Both Teams 44 ..........................................1946 44 ..........................................1947Opponents 22 ..........................................1946
Fewest InterceptionsMichigan 7 .............................................1958 7 .............................................1961Both Teams 12 ..........................................1961 16 ..........................................1966Opponents 2 .............................................1988 4 .............................................1972
Most Yards ReturnedMichigan 447 ........................................1968 348 ........................................1946 322 ........................................2004Both Teams 674 ........................................1968 583 ........................................1946 574 ........................................2004Opponents 322 ........................................1959
Fewest Yards ReturnedMichigan 15 ..........................................1986 40 ..........................................1994Both Teams 65 ..........................................1986 97 ..........................................1940Opponents 11 ..........................................1972
Most Returned for TouchdownsMichigan 4 .............................................1998 3 .............................................1947 3 .............................................1968Opponents 3 .............................................1996 2 .............................................1991
FumblesMost Fumbles
Michigan 41 ..........................................1950 39 ..........................................1951 39 ..........................................1952Both Teams 75 ..........................................1950 74 ..........................................1973Opponents 44 ..........................................1973
Fewest FumblesMichigan 11 ..........................................1994 13 ..........................................2006 13 ..........................................1999 15 ..........................................1938Both Teams 30 ..........................................1997 30 ..........................................1938 32 ..........................................2006 36 ..........................................1945 36 ..........................................1981 36 ..........................................1994Opponents 8 .............................................1997 14 ..........................................1940
Most Fumbles LostMichigan 23 ..........................................1950 22 ..........................................1952Both Teams 42 ..........................................1952 41 ..........................................1950Opponents 25 ..........................................1971 23 ..........................................1956
Fewest Fumbles LostMichigan 4 .............................................2006 5 .............................................1999 5 .............................................1945 5 .............................................1968Both Teams 10 ..........................................1945 11 ..........................................1940Opponents 4 .............................................1940
TurnoversMost Turnovers
Michigan 39 ..........................................1950 37 ..........................................1952Both Teams 76 ..........................................1952 75 ..........................................1947Opponents 43 ..........................................1947 43 ..........................................1952
Fewest TurnoversMichigan 11 ..........................................1988 12 ..........................................2006 13 ..........................................1999 14 ..........................................1974 14 ..........................................1969Both Teams 34 ..........................................1961 35 ..........................................1999 37 ..........................................1941Opponents 17 ..........................................2003 18 ..........................................1941 18 ..........................................1961 19 ..........................................2010
Highest Takeaway MarginMichigan +28........................................1969 +21........................................1968
Lowest Giveaway MarginMichigan -10 .........................................2010 -9 ...........................................1954 -6 ...........................................1959
PenaltiesMost Penalties
Michigan 95 ..........................................1998 91 ..........................................1994 87 ..........................................1986Both Teams 188 ........................................1999 179 ........................................1994 169 ........................................1986 169 ........................................1998Opponents 106 ........................................1999 89 ..........................................2001 88 ..........................................1994 85 ..........................................2011 82 ..........................................1986 82 ..........................................1995
Fewest PenaltiesMichigan 22 ..........................................1939 28 ..........................................1948Both Teams 38 ..........................................1939 52 ..........................................1946Opponents 16 ..........................................1939
Most Yards PenalizedMichigan 792 ........................................1994 775 ........................................1998 740 ........................................1986Both Teams 1547 .....................................1994 1523 .....................................1999 1454 .....................................1998Opponents 870 ........................................1999 755 ........................................1994 754 ........................................2001 734 ........................................2011 679 ........................................1998
Fewest Yards PenalizedMichigan 196 ........................................1939 254 ........................................1959Both Teams 315 ........................................1939 430 ........................................1938Opponents 119 ........................................1939
ScoringMost Points
Michigan 644 ........................................1902 460 ........................................2003 432 ........................................1976 431 ........................................1992Both Teams 884 ........................................2010 679 ........................................2003 656 ........................................1902 649 ........................................2004 633 ........................................2000Opponents 458 ........................................2010 347 ........................................2008 330 ........................................2009 279 ........................................2004 268 ........................................1994
Most Points Per GameMichigan 58.5 .......................................1902 39.4 .......................................1947 36.0 .......................................1976 35.4 .......................................2003Opponents 35.2 .......................................2010 23.8 .......................................1962 23.2 .......................................2004
Fewest PointsMichigan 21 ..........................................1934 70 ..........................................1962 112 ........................................1959Both Teams 164 ........................................1934 171 ........................................1938 188 ........................................1941Opponents 0 .............................................1901 34 ..........................................1940
Fewest Points Per GameMichigan 2.6 .........................................1934 7.8 .........................................1962 12.4 .......................................1959Opponents 0.0 .........................................1901 4.3 .........................................1940
Greatest Outstanding MarginMichigan 632 ........................................1902 341 ........................................1947 338 ........................................1971Opponents 144 ........................................1962 122 ........................................1934 104 ........................................2008
Most TouchdownsMichigan 61 ..........................................2003 59 ..........................................1992 59 ..........................................2010 58 ..........................................1976Both Teams 116 ........................................2010 88 ..........................................2003 85 ..........................................2009 83 ..........................................1991Opponents 57 ..........................................2010 42 ..........................................2008 39 ..........................................2009 34 ..........................................2002 34 ..........................................2004 33 ..........................................1994
Fewest TouchdownsMichigan 10 ..........................................1962 16 ..........................................1959Both Teams 28 ..........................................1941 31 ..........................................1960Opponents 5 .............................................1940
Most Touchdowns By:Rushing
Michigan 47 ..........................................1971 43 ..........................................1976Both Teams 51 ..........................................1971 51 ..........................................1976Opponents 34 ..........................................2010 19 ..........................................1957 19 ..........................................1958
TEAM SEASON RECORDS
RECORD BOOK
PassingMichigan 26 ..........................................2003 26 ..........................................2000 25 ..........................................1991 25 ..........................................1992 25 ..........................................2004Both Teams 44 ..........................................2010 42 ..........................................1991 42 ..........................................2000 41 ..........................................1999 41 ..........................................2006Opponents 23 ..........................................1994 21 ..........................................2010 19 ..........................................2006 18 ..........................................1999 17 ..........................................1991 17 ..........................................2002
Punt ReturnsMichigan 4 .............................................1947
Kickoff ReturnsMichigan 1 ............. 12 times LAST: 2005
Interception ReturnsMichigan 4 .............................................1998 3 .............................................1947 3 .............................................1968
Blocked KicksMichigan 2 .............................................1950 2 .............................................1990
Most Points by Quarter:First Quarter
Michigan 122 ........................................2010 107 ........................................2000 102 ........................................2003 101 ........................................1983 101 ........................................1992Both Teams 186 ........................................2010 158 ........................................1998 151 ........................................2002 145 ........................................1992 144 ........................................2004Opponents 80 ..........................................1998 69 ..........................................1967 66 ..........................................2004 64 ..........................................2010
Second QuarterMichigan 154 ........................................1992 141 ........................................1976Both Teams 277 ........................................2010 207 ........................................2001 200 ........................................1982Opponents 194 ........................................2010 80 ..........................................1958 77 ..........................................1999
Third QuarterMichigan 125 ........................................1994 122 ........................................1976Both Teams 187 ........................................2010 161 ........................................2003 160 ........................................2004 157 ........................................1994 157 ........................................2002 155 ........................................1999Opponents 92 ..........................................2010 74 ..........................................2003 74 ..........................................1998 64 ..........................................2002 63 ..........................................1999
Fourth QuarterMichigan 153 ........................................2003 138 ........................................1971 122 ........................................1991Both Teams 219 ........................................2003 193 ........................................1995 192 ........................................2010 183 ........................................2004 182 ........................................1991Opponents 99 ..........................................1994 97 ..........................................1995 97 ..........................................2005
Fewest Points by Quarter: First Quarter
Michigan 17 ..........................................1963 20 ..........................................1958 20 ..........................................1959Both Teams 31 ..........................................1963Opponents 0 .............................................1973
Second QuarterMichigan 17 ..........................................1962 20 ..........................................1959Both Teams 40 ..........................................1941Opponents 10 ..........................................1972
Third QuarterMichigan 13 ..........................................1962 26 ..........................................1957 26 ..........................................1960Both Teams 29 ..........................................1954 29 ..........................................1960Opponents 0 .............................................1954
Fourth QuarterMichigan 15 ..........................................1962 16 ..........................................1958Both Teams 52 ..........................................1941Opponents 2 .............................................1953
Most Points by Half:First Half
Michigan 255 ........................................1992 239 ........................................2000 237 ........................................1976Both Teams 463 ........................................2010 339 ........................................2005 338 ........................................1991 335 ........................................1992Opponents 258 ........................................2010 137 ........................................1994 130 ........................................2004 127 ........................................2001 126 ........................................1998
Second HalfMichigan 240 ........................................2003 227 ........................................1971 222 (+OT) ...........................2004 221 (+OT) ...........................2010 215 ........................................1977Both Teams 421 (+OT) ...........................2010 380 ........................................2003 371 (+OT) ...........................2004 328 ........................................1995 319 ........................................1999Opponents 200 (+OT) ...........................2010 149 (+OT) ...........................2004 147 ........................................2000 147 ........................................2002 142 ........................................1995
Fewest Points by Half:First Half
Michigan 42 ..........................................1962 40 ..........................................1959Both Teams 94 ..........................................1941Opponents 13 ..........................................1972
Second HalfMichigan 28 ..........................................1962 56 ..........................................1954Both Teams 83 ..........................................1954Opponents 13 ..........................................1941
Most ConversionsMichigan 58 ..........................................2003 56 ..........................................1971 56 ..........................................1976 56 ..........................................2010Both Teams 110 ........................................2010 85 ..........................................2003 73 ..........................................2000 71 ..........................................2004 69 ..........................................1991 69 ..........................................1999Opponents 54 ..........................................2010 34 ..........................................2004 29 ..........................................1994 27 ..........................................2003 27 ..........................................1999 27 ..........................................2002 27 ..........................................2005
Fewest ConversionsMichigan 3 .............................................1941 5 .............................................1962Both Teams 10 ..........................................1938 19 ..........................................1941 19 ..........................................1953Opponents 4 .............................................1938 4 .............................................1940
Most Two-point ConversionsMichigan 7 .............................................1958 4 .............................................1960Both Teams 15 ..........................................1958 7 .............................................1961Opponents 8 .............................................1958
Most Two-point Conversions Att.Michigan 12 ..........................................1958 8 .............................................1968Both Teams 30 ..........................................1958Opponents 18 ..........................................1958
Most Field GoalsMichigan 25 ..........................................1994 20 ..........................................1985 20 ..........................................2005Both Teams 38 ..........................................1995 37 ..........................................1994 36 ..........................................2005Opponents 19 ..........................................1995 18 ..........................................1996
Fewest Field GoalsMichigan 0 .................................14 seasons ..................................LAST: 1958Both Teams 0 ................................... 7 seasons ..................................LAST: 1958Opponents 0 .................................11 seasons ..................................LAST: 1961
Most Field Goals AttemptedMichigan 30 ..........................................1994 29 ..........................................1986Opponents 26 ..........................................1995 26 ..........................................1996
Fewest Field Goals Att. (Since 1958)Michigan 2 .............................................1958 3 .............................................1960 3 .............................................1962Opponents 0 .............................................1958
Most SafetiesMichigan 3 .............................................1976 3 .............................................1998Both Teams 4 .............................................1955 3 .............................................1976Opponents 3 .............................................1955
Fewest SafetiesMichigan 0 .................................39 seasons LAST: 2002Both Teams 0 .................................31 seasons LAST: 1997Opponents 0 ...........................Many seasons LAST: 1997
Third Downs(Since 1981)
Highest Third Down Conversion Pct.Michigan 49.6 .......................................1986 49.4 .......................................1992 49.4 .......................................2000 49.0 .......................................2003Opponents 45.0 .......................................1984 43.2 .......................................2010 42.6 .......................................1982 42.6 .......................................1991 42.6 .......................................1994
Lowest Third Down Conversion Pct.Michigan 35.4 .......................................1995 37.8 .......................................1994Opponents 26.1 .......................................1997 29.0 .......................................1992 29.1 .......................................2006 29.6 .......................................2003
Time of Possession(Since 1981)
Greatest AdvantageMichigan 92:36 ....................................2006 90:08 ....................................1988 79:08 ....................................1986Opponents 38:52 ....................................1982
The 1902 National Champion team, one of Fielding Yost’s famed “Point-A-Minute” squads, outscored opponents 644-12.
RushingMost Attempts
39 George Woodard, Texas A&M .......................................................................Oct. 1, 1977 39 Chris Wells, Ohio State ................................................................................ Nov. 17, 2007 38 Scott Dierking, Purdue...................................................................................Nov. 6, 1976 37 Javon Ringer, Michigan State .................................................................... Oct. 25, 2008 36 George Rogers, South Carolina .............................................................. Sept. 27, 1980 36 Laurence Maroney, Minnesota ....................................................................Oct. 8, 2005 35 Brian Calhoun, Wisconsin ......................................................................... Sept. 24, 2005
Most Yards Gained 268 Damien Anderson, Northwestern .............................................................Nov. 4, 2000 220 Chris Wells, Ohio State ................................................................................ Nov. 17, 2007 211 T.J. Duckett, Michigan State .........................................................................Nov. 3, 2001 205 DeAndra Cobb, Michigan State ................................................................ Oct. 30, 2004 201 Darrell Thompson, Minnesota ....................................................................Nov. 7, 1987 197 Marion Barber III, Minnesota ..................................................................... Oct. 10, 2003 194 Javon Ringer, Michigan State .................................................................... Oct. 25, 2008 192 Vince Young, Texas (Rose Bowl) ................................................................... Jan. 1, 2004 188 Glen Davis, Army ............................................................................................ Oct. 13, 1945
Average Gain Per Play (Minimum of ten carries) 17.3 Robert Mitchell, Illinois (10-173) ................................................................Nov. 5, 1955 15.9 Creighton Miller, Notre Dame (10-159) ....................................................Oct. 9, 1943 13.3 Tommy Bell, Army (10-133) ...........................................................................Oct. 2, 1954 12.7 Percy Harvin, Florida (13-165) ...................................................................... Jan. 1, 2008
Most Rushing Touchdowns 4 Harold “Red” Grange, Illinois ...................................................................... Oct. 18, 1924 4 Robert Ferguson, Ohio State .................................................................... Nov. 25, 1961 4 James Otis, Ohio State ................................................................................ Nov. 23, 1968 4 Vince Young, Texas (Rose Bowl) ................................................................... Jan. 1, 2005 4 Montee Ball, Wisconsin ............................................................................... Nov. 20, 2010
PassingMost Attempted
71 Sandy Schwab, Northwestern ................................................................... Oct. 23, 1982 64 Erik Wilhelm, Oregon State ...................................................................... Sept. 20, 1986 58 Jeff Welsh, Western Michigan ................................................................. Sept. 22, 2001 53 Dave Wilson, Illinois ...................................................................................... Oct. 25, 1980 53 Tony Eason, Illinois ..........................................................................................Nov. 7, 1981
Most Completed 45 Sandy Schwab, Northwestern ................................................................... Oct. 23, 1982 45 Ben Chappell, Indiana .....................................................................................Oct. 2, 2010 39 Erik Wilhelm, Oregon State ...................................................................... Sept. 20, 1986 36 Jeff Welsh, Western Michigan ................................................................. Sept. 22, 2001 33 Aaron Opelt, Toledo ...................................................................................... Oct. 11, 2008 32 Drew Brees, Purdue..........................................................................................Oct. 7, 2000 32 Walt Church, Eastern Michigan .............................................................. Sept. 19, 1998
Highest Completion Percentage (Minimum 20 attempts) 81.8 Steve Pelluer, Washington (27-33)........................................................ Sept. 17, 1983 78.8 Chuck Hartlieb, Iowa (26-33) .................................................................... Oct. 15, 1988 76.9 Jim Miller, Michigan State (30-39) .......................................................... Oct. 12, 1991
Most Yards Gained Passing 480 Ben Chappell, Indiana .....................................................................................Oct. 2, 2010 436 Sandy Schwab, Northwestern ................................................................... Oct. 23, 1982 400 Bill Burke, Michigan State ..............................................................................Oct. 9, 1999 394 Tim Schade, Minnesota .............................................................................. Nov. 12, 1994 394 Ben Leard, Auburn (Capital One Bowl) ..................................................... Jan. 1, 2001 393 Casey Clausen, Tennessee (Capital One Bowl) ....................................... Jan. 1, 2002 391 John David Booty, Southern California (Rose Bowl) ............................ Jan. 1, 2007 386 Tony Eason, Illinois ..........................................................................................Nov. 7, 1981
Average Yards Per Completion (Minimum 10 completions) 20.6 Joe Germaine, Ohio State (16-330) ........................................................ Nov. 21, 1998 19.3 Tim Clifford, Indiana (12-232) .................................................................. Oct. 27, 1979 19.0 Bill Burke, Michigan State (21-400) ............................................................Oct. 9, 1999 18.3 Dennis Dixon, Oregon (16-293) .................................................................Sept. 8, 2007 18.0 Bernard Krueger, Illinois (12-216) ............................................................ Oct. 30, 1948 16.9 Roger Staubach, Navy (14-237) ...................................................................Oct. 5, 1963
Most Touchdown Passes Thrown 4 Eric Hunter, Purdue .........................................................................................Nov. 4, 1989 4 Kurt Kittner, Illinois ........................................................................................ Oct. 23, 1999 4 Troy Smith, Ohio State ................................................................................ Nov. 18, 2006 4 John David Booty, Southern California (Rose Bowl) ............................ Jan. 1, 2007 4 Daryll Clark, Penn State ............................................................................... Oct. 24, 2009 3 24 times LAST: Tommy Rees, Notre Dame ....................................... Sept. 10, 2011
OPPONENT RECORDS
Opponent RecordsMost Interceptions Thrown
6 Bernie Kosar, Miami, FL.................................................................................Sept. 8, 1984 6 Todd Schultz, Michigan State .................................................................... Oct. 25, 1997 5 Paul Giel, Minnesota ..................................................................................... Oct. 27, 1951 5 Mike Howard, Wisconsin ................................................................................Oct. 5, 1985
ReceivingMost Passes Caught
20 Nick Moore, Toledo ....................................................................................... Oct. 11, 2008 17 Jon Harvey, Northwestern .......................................................................... Oct. 23, 1982 15 Tandon Doss, Indiana ......................................................................................Oct. 2, 2010 13 Calvin Williams, Purdue .................................................................................Nov. 4, 1989 13 Aaron Osterman, Minnesota .................................................................... Nov. 12, 1994 13 Michael Floyd, Notre Dame ..................................................................... Sept. 10, 2011 12 Glenn Bourquin, Minnesota....................................................................... Oct. 13, 1979 12 David Williams, Illinois ................................................................................. Oct. 27, 1984 12 Mitch Lyons, Michigan State ..................................................................... Oct. 10, 1992 12 Brian Stablein, Ohio State .......................................................................... Nov. 21, 1992 12 Sam Simmons, Northwestern .....................................................................Nov. 4, 2000 12 Jordan White, Western Michigan ..............................................................Sept. 3, 2011
Most Yards Gained 255 Plaxico Burress, Michigan State ...................................................................Oct. 9, 1999 221 Tandon Doss, Indiana ......................................................................................Oct. 2, 2010 217 David Boston, Ohio State ........................................................................... Nov. 21, 1998 208 Jon Harvey, Northwestern .......................................................................... Oct. 23, 1982 205 Dwayne Jarrett, Southern California (Rose Bowl) ................................. Jan. 1, 2007 187 Aaron Osterman, Minnesota .................................................................... Nov. 12, 1994 166 Marcel Courtillet, Duke .............................................................................. Sept. 28, 1968 162 Nick Moore, Toledo ....................................................................................... Oct. 11, 2008 159 Michael Floyd, Notre Dame ..................................................................... Sept. 10, 2011
Most Touchdown Passes Caught 3 Calvin Williams, Purdue .................................................................................Nov. 4, 1989 3 Graham Zug, Penn State ............................................................................. Oct. 24, 2009 3 Derrell Johnson-Koulianos, Iowa ............................................................. Oct. 16, 2010 2 21 times LAST: Keshawn Martin, Michigan State ............................. Oct. 15, 2011
Total OffenseMost Plays
76 Sandy Schwab, Northwestern ................................................................... Oct. 23, 1982 71 Ben Chappell, Indiana .....................................................................................Oct. 2, 2010 71 Erik Wilhelm, Oregon State ...................................................................... Sept. 20, 1986 69 Jeff Welsh, Western Michigan ................................................................. Sept. 22, 2001 61 Tony Eason, Illinois ..........................................................................................Nov. 7, 1981 60 Dan Robinson, Hawaii ................................................................................. Nov. 28, 1998 58 Jon Beutjer, Illinois ...................................................................................... Sept. 28, 2002
Most Yards Gained 475 Ben Chappell, Indiana .....................................................................................Oct. 2, 2010 431 Juice Williams, Illinois ......................................................................................Oct. 4, 2008 431 Sandy Schwab, Northwestern ................................................................... Oct. 23, 1982 403 Tony Eason, Illinois ..........................................................................................Nov. 7, 1981 392 Tim Schade, Minnesota .............................................................................. Nov. 12, 1994 387 John David Booty, Southern California (Rose Bowl) ............................ Jan. 1, 2007 387 Joey Elliott, Purdue .........................................................................................Nov. 7, 2009 386 Troy Smith, Ohio State ................................................................................ Nov. 20, 2004 383 Ben Leard, Auburn (Capital One Bowl) ..................................................... Jan. 1, 2001 379 Kordell Stewart, Colorado ........................................................................ Sept. 24, 1994 379 Casey Clausen, Tennessee (Capital One Bowl) ....................................... Jan. 1, 2002 377 Zak Kustok, Northwestern ............................................................................Nov. 4, 2000 377 Jon Beutjer, Illinois ...................................................................................... Sept. 28, 2002 372 Vince Young, Texas (Rose Bowl) ................................................................... Jan. 1, 2005 368 Dennis Dixon, Oregon ..................................................................................Sept. 8, 2007
All-Purpose(Rushing, Receiving, & Returns)
Most Plays 42 Paul Giel, Minnesota ..................................................................................... Oct. 24, 1953 42 Brian Calhoun, Wisconsin ......................................................................... Sept. 24, 2005 40 Vaughn Dunbar, Indiana ............................................................................. Oct. 19, 1991 39 Cleveland Franklin, Baylor ........................................................................ Sept. 27, 1975 39 Scott Dierking, Purdue...................................................................................Nov. 6, 1976
Most Yards Gained 409 Harold “Red” Grange, Illinois ...................................................................... Oct. 18, 1924 363 Tandon Doss, Indiana ......................................................................................Oct. 2, 2010
PuntingMost Punts
21 Vic Janowicz, Ohio State ............................................................................ Nov. 25, 1950 12 Mike Coughlin, Memphis .............................................................................Sept. 9, 1995 11 Brian Lewis, Utah ......................................................................................... Sept. 21, 2002 11 A.J. Trapasso, Ohio State ............................................................................ Nov. 17, 2007 10 Steve Fitts, Illinois ........................................................................................ Sept. 29, 2001 10 Andy Groom, Ohio State ............................................................................ Nov. 24, 2001 10 Dan Orseske, Minnesota ................................................................................Oct. 1, 2011
Most Yards Punting 685 Vic Janowicz, Ohio State ............................................................................ Nov. 25, 1950 486 Tom Moore, Navy ..............................................................................................Oct. 2, 1971 466 Steve Fitts, Illinois ........................................................................................ Sept. 29, 2001 459 John Kidd, Northwestern ............................................................................ Oct. 15, 1983
Highest Average Yards Per Punt (Minimum 3 punts) 54.33 Bill Brown, Illinois (3-163) ............................................................................Nov. 8, 1958 53.33 Dan Stryzinski, Indiana (3-160) ................................................................ Oct. 24, 1987 53.25 Reggie Roby, Iowa (4-213)......................................................................... Oct. 16, 1982
Punt ReturnsMost Returns
7 Carlyle Holiday, Notre Dame ................................................................... Sept. 11, 2004 6 John Pingel, Michigan State .........................................................................Oct. 1, 1938 6 Glen Davis, Army ............................................................................................ Oct. 12, 1946 6 Benjamin Norman, Indiana ........................................................................ Oct. 19, 1968 6 Nathaniel Butler, Wisconsin .........................................................................Nov. 1, 1969 6 William Anderson, Ohio State .................................................................. Nov. 21, 1970 6 Gari Scott, Michigan State .............................................................................Oct. 9, 1999
Most Yards Returned 166 Tom Campana, Ohio State ........................................................................ Nov. 20, 1971 139 Ryne Robinson, Miami (Ohio) ....................................................................Sept. 4, 2004 123 Ted Ginn, Ohio State .................................................................................... Nov. 20, 2004 108 Freddie Milons, Alabama ............................................................................... Jan. 1, 2000 106 Derrick Mason, Michigan State...................................................................Nov. 4, 1995 105 Ricky Watters, Notre Dame ...................................................................... Sept. 10, 1988
Highest Average Yards Per Return (Minimum 2 returns) 49.0 Robert Morse, Michigan State (2-98).........................................................Oct. 6, 1984 43.5 Danny Crooks, Wisconsin (2-87) ............................................................... Oct. 31, 1970 41.0 Willie Fleming, Iowa (2-82) ...........................................................................Nov. 1, 1958
Kickoff ReturnsMost Returns
** 8 Rick Hoffman, Indiana .................................................................................. Oct. 30, 1971 ** 8 Craig Clemons, Iowa .......................................................................................Nov. 6, 1971 ** 8 Byron Sanders, Northwestern ................................................................... Oct. 29, 1988 7 Clarence Self, Wisconsin ............................................................................. Nov. 15, 1947 7 Michael Senters, Northwestern ..................................................................Nov. 9, 1991 7 Derrick Mason, Michigan State....................................................................Oct. 8, 1994 7 Ramonce Taylor, Texas (Rose Bowl) ............................................................ Jan. 1, 2005
Most Yards Returned ** 203 Ron Engel, Minnesota .................................................................................. Oct. 27, 1951 201 Ramonce Taylor, Texas (Rose Bowl) ............................................................ Jan. 1, 2005 192 Raghib Ismail, Notre Dame ...................................................................... Sept. 16, 1989 188 Dervon Wallace, Western Michigan .........................................................Sept. 3, 2011 178 Clarence Self, Wisconsin ............................................................................. Nov. 15, 1947 178 John Lewis, Minnesota ................................................................................ Oct. 24, 1992
Highest Average Yardage Per Return (Minimum 2 returns) 64.0 Raghib Ismail, Notre Dame (3-192) ...................................................... Sept. 16, 1989 41.0 Tim Dwight, Iowa (2-82) .............................................................................. Oct. 18, 1997 40.0 Clinton Lynch, Illinois (2-80) ..................................................................... Oct. 23, 1993
InterceptionsMost Interceptions
4 John Miller, Michigan State........................................................................ Oct. 10, 1987 3 Seven players LAST: Greg Yeldell, Indiana .......................................... Oct. 24, 1998
Most Yards Returned 100 Tyrrell Herbert, Toledo ................................................................................. Oct. 11, 2008 99 Bruce Sullivan, Illinois ....................................................................................Nov. 5, 1966 97 Eddie Tomlin, Maryland ............................................................................. Sept. 30, 1989 95 Devon Mitchell, Iowa.................................................................................... Oct. 20, 1984 94 Ricardo Allen, Purdue .................................................................................. Nov. 13, 2010 93 Robert Suci, Michigan State .........................................................................Oct. 3, 1959
RECORD BOOK
Total ReturnsMost Returns
10 Craig Clemons, Iowa .......................................................................................Nov. 6, 1971 10 Ryne Robinson, Miami (Ohio) ....................................................................Sept. 4, 2004 9 Ramonce Taylor, Texas (Rose Bowl) ............................................................ Jan. 1, 2005 8 Glen Davis, Army ............................................................................................ Oct. 12, 1946 8 Ron Carver, UCLA ......................................................................................... Sept. 25, 1971 8 Jon Hoffman, Indiana ................................................................................... Oct. 30, 1971 8 Byron Sanders, Northwestern ................................................................... Oct. 29, 1988 8 Chris Gaiters, Minnesota ............................................................................ Nov. 18, 1989 8 Ajamu Stoner, Indiana ................................................................................. Oct. 21, 1995
Most Yards Returned 249 Ryne Robinson, Miami (Ohio) ....................................................................Sept. 4, 2004 203 Ron Engel, Minnesota .................................................................................. Oct. 27, 1951 202 Ramonce Taylor, Texas (Rose Bowl) ............................................................ Jan. 1, 2005 192 Raghib Ismail, Notre Dame ...................................................................... Sept. 16, 1989 179 Craig Clemons, Iowa .......................................................................................Nov. 6, 1971
Highest Average Yards Per Return (Minimum 3 returns) 64.0 Raghib Ismail, Notre Dame (3-192) ...................................................... Sept. 16, 1989 46.0 Danny Crooks, Wisconsin (3-138) ........................................................... Oct. 31, 1970 41.3 Bruce Sullivan, Illinois (3-124) .....................................................................Nov. 5, 1966
Defense (Since 1966)Most Tackles
29 Chris Spielman, Ohio State ....................................................................... Nov. 22, 1986 27 John Voorhees, Northwestern ................................................................ Sept. 11, 1971 26 Bob Golic, Notre Dame .............................................................................. Sept. 23, 1978
Most Tackles For Loss 5 Ryan Kerrigan, Purdue (17 yards) ........................................................... Nov. 13, 2010 5 Stephen Boyd, Boston College (22 yards) ............................................Sept. 3, 1994 4 John Tietz, Wisconsin (41 yards)............................................................. Nov. 18, 1967 4 Mike Lettieri, Navy (20 yards) .......................................................................Oct. 5, 1968 4 Jim Schwantz, Purdue (35 yards) ..............................................................Nov. 4, 1989 4 Mel Agee, Illinois (10 yards) ..................................................................... Nov. 10, 1990 4 Simeon Rice, Illinois (22 yards) .................................................................Sept. 2, 1995 4 Jared DeVries, Iowa (22 yards) .................................................................. Oct. 18, 1997 4 Kenechi Udeze, Southern California (23 yards) ..................................... Jan. 1, 2004 4 Brian Cushing, Southern California (19 yards) ....................................... Jan. 1, 2007 4 Vernon Gholston, Ohio State (21 yards) ............................................... Nov. 17, 2007
Most Sacks (Since 1980) 4 Ryan Kerrigan, Purdue (15 yards) ........................................................... Nov. 13, 2010 3 Kevin Griffith, Notre Dame (16 yards) ................................................. Sept. 18, 1982 3 Donald Jones, Washington (22 yards)...................................................... Jan. 1, 1992 3 Jared DeVries, Iowa (20 yards) .................................................................. Oct. 18, 1997 3 Kenechi Udeze, Southern California (22 yards) ..................................... Jan. 1, 2004 3 Vernon Gholston, Ohio State (20 yards) ............................................... Nov. 17, 2007 3 Ryan Kerrigan, Purdue (21 yards) ..............................................................Nov. 1, 2008
Most Passes Broken Up 6 Dennis White, Northwestern .......................................................................Nov. 2, 1968 6 David King, Auburn.......................................................................................... Jan. 2, 1984 5 Will Poole, Southern California .................................................................... Jan. 1, 2004 5 Walter Thurmond, Oregon ..........................................................................Sept. 8, 2007
Most Fumble Recoveries 2 10 players LAST: Stephen Boyd, Boston College ..............................Sept. 3, 1994
RECORD BOOK152
ScoringMost Points Scored
30 Harold “Red” Grange, Illinois ...................................................................... Oct. 18, 1924 30 Mikel Leshoure, Illinois ..................................................................................Nov. 6, 2010 24 Robert Ferguson, Ohio State .................................................................... Nov. 25, 1961 24 James Otis, Ohio State ................................................................................ Nov. 23, 1968 24 Vince Young, Texas (Rose Bowl) ................................................................... Jan. 1, 2005 24 Kory Sheets, Purdue........................................................................................Nov. 1, 2008 24 Montee Ball, Wisconsin ............................................................................... Nov. 20, 2010 20 Sherman Lewis, Michigan State ............................................................... Oct. 13, 1962
Most Touchdowns Scored 5 Harold “Red” Grange, Illinois ...................................................................... Oct. 18, 1924 5 Mikel Leshoure, Illinois ..................................................................................Nov. 6, 2010 4 Robert Ferguson, Ohio State .................................................................... Nov. 25, 1961 4 James Otis, Ohio State ................................................................................ Nov. 23, 1968 4 Vince Young, Texas (Rose Bowl) ................................................................... Jan. 1, 2005 4 Kory Sheets, Purdue........................................................................................Nov. 1, 2008 4 Montee Ball, Wisconsin ............................................................................... Nov. 20, 2010
Most Field Goals Scored 5 Kyle Bryant, Texas A&M ...............................................................................Dec. 28, 1995 4 Tom Klaban, Ohio State .............................................................................. Nov. 23, 1974 4 Chuck Male, Notre Dame .......................................................................... Sept. 15, 1979 4 John Carney, Notre Dame ........................................................................ Sept. 14, 1985 4 Rob Houghtlin, Iowa ..................................................................................... Oct. 19, 1985 4 Reggie Ho, Notre Dame ............................................................................ Sept. 10, 1988 4 Sam Valenzisi, Northwestern ........................................................................Oct. 7, 1995 4 Louie Sakoda, Utah ...................................................................................... Aug. 30, 2008 4 Philip Welch, Wisconsin ............................................................................. Sept. 27, 2008 4 Kevin Kelly, Penn State ................................................................................ Oct. 18, 2008 4 Nick Freeland, Indiana ............................................................................... Sept. 26, 2009
Most Field Goals Attempted (Since 1964) 6 Kyle Bryant, Texas A&M (5-6) ....................................................................Dec. 28, 1995 5 Richard Kenney, Michigan State (2-5) ......................................................Oct. 9, 1965 5 Paul Rogind, Minnesota (3-5) ................................................................... Oct. 22, 1977 5 Vlade Janakievski, Ohio State (2-5) ....................................................... Nov. 19, 1977 5 Rob Houghtlin, Iowa (4-5) ......................................................................... Oct. 19, 1985 5 Philip Welch, Wisconsin (4-5) ................................................................... Sept. 27, 2008 5 Nick Freeland, Indiana ............................................................................... Sept. 26, 2009 5 Mitch Ewald, Indiana .......................................................................................Oct. 2, 2010
Most Point-After-Touchdowns Scored 7 Derek DePasquale, Mississippi State (7-7) ............................................... Jan. 1, 2011 6 Richard Van Raaphorst, Ohio State (6-6) .............................................. Nov. 25, 1961 6 Alex Walls, Tennessee (6-6) ............................................................................ Jan. 1, 2002 6 Aaron Pettrey, Ohio State (6-6) ................................................................ Nov. 18, 2006 6 Carson Wiggs, Purdue (6-7) ..........................................................................Nov. 1, 2008 6 Derek Dimke, Illinois (6-6) ............................................................................Nov. 6, 2010 6 Philip Welch, Wisconsin (6-6) .................................................................... Nov. 20, 2010 5 Angelo Bertelli, Notre Dame (5-5) ..............................................................Oct. 9, 1943 5 James Roman, Ohio State (5-6) ............................................................... Nov. 23, 1968 5 Nathan Trout, Syracuse (5-5) ................................................................... Sept. 12, 1998 5 Neil Rackers, Illinois (5-5) ............................................................................ Oct. 23, 1999 5 Dusty Mangum, Texas (5-5)........................................................................... Jan. 1, 2005 5 Mitch Ewald, Indiana (5-5) .............................................................................Oct. 2, 2010
Longest PlaysScrimmage Run
100 C.W. Savage, Oberlin.................................................................................... Nov. 19, 1892 98 Darrell Thompson, Minnesota ....................................................................Nov. 7, 1987 89 Dan Herron, Ohio State .............................................................................. Nov. 27, 2010 89 Eugene Ciolek, Michigan State ....................................................................Oct. 2, 1937 85 Ray Purdin, Northwestern .......................................................................... Oct. 17, 1959 85 Darius Willis, Indiana .................................................................................. Sept. 26, 2009 81 Tiki Barber, Virginia....................................................................................... Aug. 26, 1995 80 Laurence Maroney, Minnesota ....................................................................Oct. 9, 2004 76 Jonathan Wells, Ohio State ....................................................................... Nov. 20, 1999
Passing Play 95 Dayne Crist to Kyle Rudolph, Notre Dame ......................................... Sept. 11, 2010 94 Marquel Fleetwood to John Lewis, Minnesota................................... Oct. 24, 1992 88 Ray Stephens to Charles Litten, Minnesota ......................................... Oct. 26, 1968 85 Dennis Dixon to Brian Paysinger, Oregon .............................................Sept. 8, 2007 83 John Easterbrook to Richard Kreitling, Illinois ......................................Nov. 8, 1958 81 Chris Relf to Ladarius Perkins, Mississippi State .................................... Jan. 1, 2011 80 Lew Hamity to John Davenport, Chicago ...............................................Oct. 8, 1938 80 Joe Sparma to Bob Klein, Ohio State .................................................... Nov. 25, 1961 80 Mike Samuel to Chris Chambers, Wisconsin ....................................... Nov. 14, 1998 80 Pat Devlin to Stephfon Green, Penn State ........................................... Oct. 18, 2008
Punt Return 90 Dean Look, Michigan State ...........................................................................Oct. 4, 1958 87 Danny Crooks, Wisconsin ............................................................................ Oct. 31, 1970 87 Bobby Morse, Michigan State ......................................................................Oct. 6, 1984
Kickoff Return 99 Lynn Jordan, Wisconsin .............................................................................. Nov. 10, 1934 97 Kevin Hicks, Washington State ..................................................................Sept. 4, 1993 95 Harold “Red” Grange, Illinois ...................................................................... Oct. 18, 1924 95 Ron Engel, Minnesota .................................................................................. Oct. 27, 1951 92 Raghib Ismail, Notre Dame ...................................................................... Sept. 16, 1989
Interception Return 100 Tyrrell Herbert, Toledo ................................................................................. Oct. 11, 2008 98 Bruce Sullivan, Illinois ....................................................................................Nov. 5, 1966 97 Eddie Tomlin, Maryland ............................................................................. Sept. 30, 1989 94 Ricardo Allen, Purdue .................................................................................. Nov. 13, 2010 93 Bob Suci, Michigan State ...............................................................................Oct. 3, 1959 91 Kraig Loftquist, Minnesota ......................................................................... Oct. 24, 1964
Field Goal 57 Morten Anderson, Michigan State .......................................................... Oct. 11, 1980 56 Tom Nichol, Iowa ........................................................................................... Oct. 22, 1983 55 Scott Bonnell, Indiana .................................................................................. Oct. 28, 1989 54 Chad Seitz, Miami, OH ............................................................................... Sept. 30, 1995 53 Pete Stoyanovich, Indiana .......................................................................... Oct. 22, 1988
Punt 86 Greg Montgomery, Michigan State ........................................................ Oct. 11, 1986 78 Howard Wedebrook, Ohio State ............................................................. Nov. 21, 1936 75 Bruce Barnes, UCLA..................................................................................... Sept. 23, 1972 75 Greg Montgomery, Michigan State ........................................................ Oct. 12, 1985
** Denotes Big Ten Conference Record
153RECORD BOOK
RushingAn Individual Attempted 25 Rushes:
MICHIGAN: Denard Robinson (26 attempts), vs. Ohio State ............................ Nov. 26, 2011OPPONENT: Marcus Coker (29 attempts), at Iowa ..................................................Nov. 5, 2011
An Individual Attempted 30 Rushes:MICHIGAN: Mike Hart (32 attempts), Florida ............................................................. Jan. 1, 2008OPPONENT: Adam Robinson (31 attempts), Iowa ................................................ Oct. 16, 2010
An Individual Rushed for 150 Yards:MICHIGAN: Denard Robinson (170 yards), vs. Illinois ......................................... Nov. 26, 2011OPPONENT: Edwin Baker (167 yards) at Michigan State .................................... Oct. 15, 2011
An Individual Rushed for 200 Yards:MICHIGAN: Denard Robinson (200 yards), San Diego State ........................... Sept. 24, 2011OPPONENT: Chris Wells (222 yards), Ohio State ................................................... Nov. 17, 2007
A Team Had Less Than 25 Rushing Attempts:MICHIGAN: Mississippi State (25 attempts) ................................................................ Jan. 1, 2010OPPONENT: Northwestern (25 attempts)....................................................................Oct. 8, 2011
A Team Rushed For Over 200 Yards:MICHIGAN: vs. Ohio State (277 yards) ...................................................................... Nov. 26, 2011OPPONENT: Michigan State (213 yards) at Michigan State ................................ Oct. 15, 2011
A Team Rushed For Over 300 Yards:MICHIGAN: Purdue (339 yards) .................................................................................... Oct. 29, 2011OPPONENT: Wisconsin (357 yards) ............................................................................. Nov. 20, 2010
A Team Rushed For Over 400 Yards:MICHIGAN: Bowling Green (466 yards) ................................................................... Sept. 25, 2010OPPONENT: Minnesota (424 yards) ............................................................................ Oct. 10, 2003
A Team Rushed For Over 500 Yards:MICHIGAN: vs. Stanford (531 yards) ........................................................................ Sept. 18, 1976OPPONENT: Never — RECORD is Minnesota (424 yards) ................................... Oct. 10, 2003
A Team Was Held To Under 100 Yards Rushing:MICHIGAN: at Michigan State (82 yards) .................................................................. Oct. 15, 2011OPPONENT: at Illinois (37 yards) .................................................................................. Nov. 12, 2011
A Team Was Held To Under 50 Yards Rushing:MICHIGAN: at Michigan State (28 yards) .....................................................................Oct. 3, 2009OPPONENT: at Illinois (37 yards) .................................................................................. Nov. 12, 2011
An Individual Scored On A Run of 60 Yards:MICHIGAN: Denard Robinson (87 yards), at Notre Dame.................................. Sept. 11, 2010OPPONENT: James White (61 yards), Wisconsin ................................................... Nov. 20, 2010
An Individual Scored On A Run of 70 Yards:MICHIGAN: Denard Robinson (72 yards), at Indiana ................................................Oct. 2, 2010OPPONENT: Mikel Leshoure (70 yards), Illinois ...................................................... Oct. 31, 2009 Jason Ford (79 yards), Illinois .................................................................... Oct. 31, 2009
An Individual Scored On A Run of 80 Yards:MICHIGAN: Denard Robinson (87 yards), at Notre Dame.................................. Sept. 11, 2010OPPONENT: Darius Willis (85 yards), Indiana ........................................................ Sept. 26, 2009
PassingAn Individual Attempted 40 Passes:
MICHIGAN: Denard Robinson (41 attempts), vs. Mississippi State .................... Jan. 1, 2010OPPONENT: Dan Persa (44 attempts), Northwestern .............................................Oct. 8, 2011
An Individual Attempted 50 Passes:MICHIGAN: Chad Henne (54 attempts), at Ohio State ....................................... Nov. 20, 2004OPPONENT: Ben Chappell (64 attempts), Indiana ...................................................Oct. 2, 2010
An Individual Completed 20 Passes:MICHIGAN: Denard Robinson (27 completions), vs. Mississippi State ............. Jan. 1, 2010OPPONENT: Dan Persa (32 completions), Northwestern ......................................Oct. 8, 2011
An Individual Completed 30 Passes:MICHIGAN: Chad Henne (33 completions), Minnesota .........................................Oct. 9, 2004OPPONENT: Dan Persa (32 completions), Northwestern ......................................Oct. 8, 2011
The Last Time it Happened ... An Individual Passed For 300 Yards:
MICHIGAN: Denard Robinson (337 yards), at Northwestern ................................Oct. 8, 2011OPPONENT: Dan Persa (331 yards), Northwestern ..................................................Oct. 8, 2011
An Individual Passed For 400 Yards:MICHIGAN: Never -- Record is 389 by John Navarre at Iowa ...............................Oct. 4, 2003OPPONENT: Ben Chappell (480 yards), Indiana ........................................................Oct. 2, 2010
An Individual Threw Three Touchdown Passes:MICHIGAN: Denard Robinson (3 TDs), Ohio State ................................................ Nov. 26, 2011OPPONENT: Tommy Rees (3 TDs), Notre Dame .................................................... Sept. 10, 2011
An Individual Threw Four Touchdown Passes:MICHIGAN: Denard Robinson (4 TDs), Notre Dame ........................................... Sept. 10, 2011OPPONENT: Scott Tolzien (4 TDs), Wisconsin .......................................................... Nov. 14, 2009
A Team Had Less Than 10 Passing Attempts:MICHIGAN: Northwestern (5 attempts) .................................................................... Oct. 31, 1987OPPONENT: Eastern Michigan (6 attempts) .......................................................... Sept. 17, 2011
A Team Had Less Than Five Completions:MICHIGAN: Northwestern (1 completion) ............................................................... Oct. 31, 1987OPPONENT: Eastern Michigan (3 completions) ................................................... Sept. 17, 2011
A Team Had Less Than 50 Yards Passing:MICHIGAN: Northwestern (3 yards) ............................................................................ Oct. 31, 1987OPPONENT: Eastern Michigan (29 yards) ............................................................... Sept. 17, 2011
An Individual Threw A 60-Yard Scoring Pass:MICHIGAN: Denard Robinson (75 yards), Illinois .....................................................Nov. 6, 2010OPPONENT: Aaron Pankratz (71 yards), Bowling Green ................................... Sept. 25, 2010
An Individual Threw A 70-Yard Scoring Pass:MICHIGAN: Denard Robinson (75 yards), Illinois .....................................................Nov. 6, 2010OPPONENT: Aaron Pankratz (71 yards), Bowling Green ................................... Sept. 25, 2010
An Individual Threw A 80-Yard Scoring Pass:MICHIGAN: Ryan Mallett (97 yards), at Wisconsin ................................................ Nov. 10, 2007OPPONENT: Dayne Crist (95 yards), Notre Dame ................................................ Sept. 11, 2010
ReceivingAn Individual Caught Eight Passes:
MICHIGAN: Roy Roundtree (9 receptions), vs. Mississippi State ......................... Jan. 1, 2011OPPONENT: Marvin McNutt (9 receptions), at Iowa ...............................................Nov. 5, 2011
An Individual Caught Nine Passes:MICHIGAN: Roy Roundtree (9 receptions), vs. Mississippi State ......................... Jan. 1, 2011OPPONENT: Marvin McNutt (9 receptions), at Iowa ................................................Nov. 5, 2011
An Individual Caught 10 Passes:MICHIGAN: Roy Roundtree (10 receptions), Purdue ..............................................Nov. 7, 2009OPPONENT: Jeremy Ebert (11 receptions), Northwestern ....................................Oct. 8, 2011
An Individual Had 100 Yards In Receptions:MICHIGAN: Junior Hemingway (124 yards), at Northwestern ..............................Oct. 8, 2011OPPONENT: A.J. Jenkins (103 yards), at Illinois ..................................................... Nov. 12, 2011
An Individual Had 150 Yards In Receptions:MICHIGAN: Junior Hemingway (165 yards), Notre Dame ................................. Sept. 10, 2011OPPONENT: Michael Floyd (159 yards), Notre Dame ......................................... Sept. 10, 2011
An Individual Scored On A 60-Yard Reception:MICHIGAN: Roy Roundtree (75 yards), Illinois ..........................................................Nov. 6, 2010OPPONENT: Tyrone Pronty (71 yards), Bowling Green ...................................... Sept. 25, 2010
An Individual Scored On A 70-Yard Reception:MICHIGAN: Roy Roundtree (75 yards), Illinois ..........................................................Nov. 6, 2010OPPONENT: Tyrone Pronty (71 yards), Bowling Green ...................................... Sept. 25, 2010
An Individual Scored On A 80-Yard Reception:MICHIGAN: Mario Manningham (97 yards), at Wisconsin ................................. Nov. 10, 2007OPPONENT: Kyle Rudolph (95 yards), Notre Dame ............................................ Sept. 11, 2010
Total OffenseA Team Gained 500 Total Yards:
MICHIGAN: Purdue (535 yards) .................................................................................... Oct. 29, 2011OPPONENT: Notre Dame (513 yards) ....................................................................... Sept. 10, 2011
A Team Gained 600 Total Yards:MICHIGAN: Illinois (676 yards) ........................................................................................Nov. 6, 2010OPPONENT: Oregon (624 yards) ...................................................................................Sept. 8, 2007
A Team Gained Less Than 200 Total Yards:MICHIGAN: Ohio State (198 yards) ........................................................................... Nov. 22, 2008OPPONENT: Minnesota (177 yards) ...............................................................................Oct. 1, 2011
A Team Gained Less Than 100 Total Yards:MICHIGAN: Ohio State (91 yards) .............................................................................. Nov. 17, 2007OPPONENT: Notre Dame (79 yards) ......................................................................... Sept. 15, 2007
PenaltiesA Team Was Penalized 10 Times:
MICHIGAN: at Illinois (10-86 yards) ............................................................................. Oct. 16, 2004OPPONENT: at Michigan State (13-124 yards) ........................................................ Oct. 15, 2011
A Team Was Penalized 15 Times:MICHIGAN: vs. UCLA (15-148 yards) ...........................................................................Dec. 31, 1981OPPONENT: Utah (15-137 yards) ................................................................................ Aug. 30, 2008
A Team Was Not Penalized:MICHIGAN: vs. Wisconsin..................................................................................................Nov. 8, 1980OPPONENT: Wisconsin ................................................................................................... Nov. 15, 1997
PuntingA Team Punted 10 Times:
MICHIGAN: at Notre Dame (10 punts) ..................................................................... Sept. 11, 2010OPPONENT: Minnesota (10 punts) .................................................................................Oct. 1, 2011
A Team Did Not Punt:MICHIGAN: Bowling Green .......................................................................................... Sept. 25, 2010OPPONENT: Notre Dame .............................................................................................. Sept. 13, 1986
An Individual Recorded A 60-Yard Punt:MICHIGAN: Will Hagerup (72 yards), at Purdue ..................................................... Nov. 13, 2010OPPONENT: Justin DuVernois (61 yards), at Illinois ............................................. Nov. 12, 2011
An Individual Recorded A 70-Yard Punt:MICHIGAN: Will Hagerup (72 yards), at Purdue ..................................................... Nov. 13, 2010OPPONENT: Jake Richardson (74 yards), Miami, Ohio ..........................................Sept. 6, 2008
An Individual Recorded A 80-Yard Punt:MICHIGAN: Monte Robbins (82 yards), at Hawaii ....................................................Dec. 6, 1987OPPONENT: Greg Montgomery (86 yards), Michigan State .............................. Oct. 11, 1986
An Individual Ran For A First Down Out of Punt Formation:MICHIGAN: Zoltan Mesko (7 yards), at Minnesota ..................................................Nov. 8, 2008OPPONENT: Anthony Heygood (61 yards), Purdue ................................................Nov. 1, 2008
A Team Had A Punt Blocked:MICHIGAN: Massachusetts........................................................................................... Sept. 18, 2010OPPONENT: Nebraska ..................................................................................................... Nov. 19, 2011
TurnoversAn Individual Threw Five Interceptions:
MICHIGAN: Demetrius Brown (7 int), vs. Michigan State ................................... Oct. 10, 1987OPPONENT: Todd Schultz (5 int), at Michigan State............................................. Oct. 25, 1997
An Individual Threw Six Interceptions:MICHIGAN: Demetrius Brown (7 int.), vs. Michigan State .................................. Oct. 10, 1987OPPONENT: Bernie Kosar (6 int.), Miami, Fla. ...........................................................Sept. 8, 1984
An Individual Made Two Interceptions:MICHIGAN: James Rogers (2 int.), at Purdue .......................................................... Nov. 13, 2010OPPONENT: Ibraheim Campbell (2 int.), Northwestern .........................................Oct. 8, 2011
An Individual Made Three Interceptions:MICHIGAN: Andy Moeller (3 int.), vs. Wisconsin........................................................Oct. 4, 1986OPPONENT: Greg Yeldell (3 int.), Indiana..................................................................OCt. 24, 1998
A Team Turned The Ball Over Four Times:MICHIGAN: San Diego State (2 fumbles, 2 interceptions) ................................ Sept. 24, 2011OPPONENT: Notre Dame (3 fumbles, 2 interceptions) ...................................... Sept. 10, 2011
A Team Turned The Ball Over Five Times:MICHIGAN: at Purdue (3 fumbles, 2 interceptions) ............................................. Nov. 13, 2010OPPONENT: Notre Dame (3 fumbles, 2 interceptions) ...................................... Sept. 10, 2011
A Team Turned The Ball Over Six Times:MICHIGAN: at Notre Dame (4 fumbles, 2 interceptions) .................................. Sept. 13, 2008OPPONENT: Miami (5 interceptions, 2 fumbles) .....................................................Sept. 4, 2004
A Team Turned The Ball Over Seven Times:MICHIGAN: Michigan State (Seven - 7 interceptions) .......................................... Oct. 10, 1987OPPONENT: Miami (5 interceptions, 2 fumbles) .....................................................Sept. 4, 2004
A Team Lost Four Fumbles:MICHIGAN: at Notre Dame (4 fumbles) ................................................................... Sept. 13, 2008OPPONENT: Northern Illinois (4 fumbles) .................................................................Sept. 3, 2005
A Team Lost Five Fumbles:MICHIGAN: North Carolina (5 fumbles) ................................................................... Sept. 18, 1965OPPONENT: Wisconsin (5 fumbles) ........................................................................... Sept. 22, 1984
A Team Recovered An Onside Kick:MICHIGAN: Michigan State ............................................................................................ Oct. 30, 2004OPPONENT: Purdue ............................................................................................................Nov. 7, 2009
First DownsA Team Had 30 First Downs:
MICHIGAN: Minnesota (32 first downs) .......................................................................Oct. 1, 2011OPPONENT: Indiana (35 first downs) ............................................................................Oct. 2, 2010
A Team Had Less Than 10 First Downs:MICHIGAN: Ohio State (8 first downs) ...................................................................... Nov. 17, 2007OPPONENT: Minnesota (8 first downs) ........................................................................Oct. 1, 2011
ScoringAn Individual Scored Three Touchdowns:
MICHIGAN: Denard Robinson (3 TDs), San Diego State .................................... Sept. 24, 2011OPPONENT: Vick Ballard (3 TDs), Mississippi State ................................................... Jan. 1, 2011
An Individual Scored Four Touchdowns:MICHIGAN: Chris Perry (4 TDs), vs. Notre Dame .................................................. Sept. 13, 2003OPPONENT: Montee Ball (4 TDs), Wisconsin........................................................... Nov. 20, 2010
An Individual Scored Five Touchdowns:MICHIGAN: Ron Johnson (5 TDs), vs. Wisconsin ................................................... Nov. 16, 1968OPPONENT: Mikel Leshoure (5 TDs), Illinois ..............................................................Nov. 6, 2010
An Individual Caught Two Touchdown Passes:MICHIGAN: Roy Roundtree (2 TDs), Illinois ................................................................Nov. 6, 2010 Junior Hemingway (2 TDs), Illinois ............................................................Nov. 6, 2010OPPONENT: Keshawn Martin (2 TDs), at Michigan State .................................... Oct. 15, 2011
An Individual Caught Three Touchdown Passes:MICHIGAN: Mario Manningham (3 TDs), at Notre Dame.................................. Sept. 16, 2006OPPONENT: Derrell Johnson-Koulianos (3 TDs), Iowa ......................................... Oct. 16, 2010
An Individual Caught and Ran for a Touchdown:MICHIGAN: Vincent Smith vs. Minnesota ....................................................................Oct. 1, 2011
A Non-QB Passed and Ran for a Touchdown:MICHIGAN: Vincent Smith vs. Minnesota ....................................................................Oct. 1, 2011
An Individual Passed and Caught for a Touchdown:MICHIGAN: Vincent Smith vs. Minnesota ....................................................................Oct. 1, 2011
An Individual Passed, Ran and Caught for a Touchdown:MICHIGAN: Vincent Smith vs. Minnesota ....................................................................Oct. 1, 2011
An Individual Kicked Three Field Goals:MICHIGAN: Brendan Gibbons (3 FGs), Minnesota ...................................................Oct. 1, 2011OPPONENT: Devin Barclay (3 FGs), Ohio State ...................................................... Nov. 27, 2010
An Individual Kicked Four Field Goals:MICHIGAN: K.C. Lopata (5 FGs), at Minnesota ..........................................................Nov. 8, 2008OPPONENT: Nick Freeland (4 FGs), Indiana ........................................................... Sept. 26, 2009
THE LAST TIME IT HAPPENED
RECORD BOOKAn Individual Returned A Kickoff For A Touchdown:
MICHIGAN: Darryl Stonum (94 yards), Notre Dame ........................................... Sept. 12, 2009OPPONENT: Jordan Hall (85 yards), Ohio State ..................................................... Nov. 27, 2010
An Individual Returned A Punt For A Touchdown:MICHIGAN: Martavious Odoms (73 yards), at Purdue ...........................................Nov. 1, 2008OPPONENT: Ted Ginn (82 yards), Ohio State .......................................................... Nov. 20, 2004
An Individual Returned An Interception For A Touchdown:MICHIGAN: Brandon Herron (94 yards), Western Michigan ...............................Sept. 3, 2011OPPONENT: Isaiah Lewis (39 yards), at Michigan State ....................................... Oct. 15, 2011
An Individual Returned A Blocked Punt For A Touchdown:MICHIGAN: Brandon Graham (2 yards), vs. Delaware State............................... Oct. 17, 2009OPPONENT: Jordan Carey (0 yards), Oregon ......................................................... Sept. 20, 2003
An Individual Returned A Blocked Field Goal For A Touchdown:MICHIGAN: Jeremy LeSueur (78 yards), at Oregon ............................................. Sept. 20, 2003OPPONENT: Roc Alexander (77 yards), Washington............................................ Nov. 16, 1996
An Individual Returned A Fumble For A Touchdown:MICHIGAN: Courtney Avery (83 yards), Minnesota .................................................Oct. 1, 2011OPPONENT: Cameron Heyward (0 yards), Ohio State ........................................ Nov. 21, 2009
An Individual Kicked A 50-Yard Field Goal:MICHIGAN: Jason Olesnavage (51 yards), Purdue...................................................Nov. 7, 2009OPPONENT: Brett Maher (51 yards), Nebraska ...................................................... Nov. 19, 2011
A Team Scored A 2-Point Conversion:MICHIGAN: vs. Southern California (Mike Hart run) ................................................. Jan. 1, 2007OPPONENT: Nebraska (Todd Peterson pass from Zac Taylor) ...........................Dec. 28, 2006
A Team Scored A Safety:MICHIGAN: Purdue ........................................................................................................... Oct. 29, 2011OPPONENT: Penn State .................................................................................................... Oct. 24, 2009
A Team Recorded A Shutout:MICHIGAN: Minnesota (58-0) ...........................................................................................Oct. 1, 2011OPPONENT: Iowa (26-0) .................................................................................................. Oct. 20, 1984
A Team Scored 30 Points In A Quarter:MICHIGAN: at Minnesota (31 points - fourth quarter) ........................................ Oct. 10, 2003OPPONENT: Northwestern (34 points - second quarter) .................................... Oct. 18, 1958
A Team Scored 30 Points In A Half:MICHIGAN: Minnesota (38 points, first half ) ..............................................................Oct. 1, 2011OPPONENT: Mississippi State (31 points, first half ) ................................................. Jan. 1, 2010
A Team Scored 40 Points In A Half:MICHIGAN: Delaware State (49 points, first half ) .................................................. Oct. 17, 2009OPPONENT: Northwestern (43 points) ...................................................................... Oct. 18, 1958
TOTAL OFFENSE RUSHING PASSING SCORINGYear G Plays Yards YPG Att. Yds. TDs YPG Att. Cmp. Int. Pct. Yds. TDs YPG 1st Downs Pts. Avg. Pen. Yds.2011 12 792 5077 423.1 530 2828 31 235.7 262 145 15 .553 2249 20 187.4 258 410 34.2 49 4322010 13 941 6353 488.7 556 3101 35 238.5 385 243 15 .631 3252 23 250.2 299 426 32.8 60 5972009 12 823 4614 384.5 494 2234 27 186.2 329 189 15 .574 2380 15 198.3 235 354 29.5 58 5172008 12 791 3489 290.8 453 1771 17 147.6 228 165 12 .488 1718 11 143.2 186 243 20.2 57 5002007 13 963 5006 385.1 540 2144 20 164.9 423 225 14 .532 2862 25 220.2 279 354 27.2 66 5802006 13 866 4820 370.8 535 2282 21 175.5 331 206 8 .622 2538 22 195.2 251 380 29.2 62 5702005 12 908 4611 384.2 499 1939 16 161.6 409 238 8 .582 2672 23 222.7 259 345 28.8 48 3822004 12 896 4638 386.5 481 1843 15 153.6 415 248 12 .598 2795 25 232.9 250 370 30.8 62 5472003 13 1014 5807 446.7 538 2287 29 175.9 476 284 10 .507 3520 26 270.8 311 460 35.4 64 5172002 13 977 4955 381.2 505 1929 25 148.4 472 259 7 .549 3026 21 232.8 261 361 27.8 65 4982001 12 883 4311 359.2 480 1716 18 143.0 403 216 14 .536 2595 20 216.2 228 320 26.7 65 4842000 12 863 5353 446.1 542 2581 25 215.1 321 190 5 .592 2772 26 231.0 265 404 33.7 64 5551999 12 899 4639 386.6 462 1462 21 121.8 437 264 8 .604 3177 23 264.8 256 361 30.1 82 6531998 13 929 4951 380.8 526 2020 21 155.4 403 238 14 .591 2931 18 225.5 238 359 27.6 95 7701997 12 888 4652 387.7 558 2188 20 182.3 330 209 6 .633 2464 17 205.3 253 322 26.8 83 6831996 12 850 4583 381.9 512 2015 17 167.9 338 188 12 .556 2568 15 214.0 227 277 23.1 70 5581995 13 961 5140 395.4 600 2621 21 201.6 361 190 15 .526 2519 16 193.8 267 338 26.0 81 6861994 12 801 4988 415.7 505 2460 22 205.0 296 188 11 .635 2528 13 210.7 245 330 27.5 91 7921993 12 834 4856 404.7 526 2260 25 188.3 308 195 7 .633 2596 17 216.3 248 342 28.5 65 5781992 12 872 5603 466.9 567 3217 31 268.1 305 199 15 .652 2386 25 198.8 269 431 35.9 71 6821991 12 830 5036 419.7 543 2781 27 231.8 287 176 7 .648 2255 25 187.9 254 420 35.0 52 4421990 12 863 5190 432.5 585 3175 23 264.6 278 163 11 .586 2015 22 167.9 267 389 32.4 56 4811989 12 770 4432 369.3 525 2499 22 208.3 245 149 9 .608 1933 19 161.1 231 335 27.9 59 4931988 12 848 4862 405.2 633 3031 32 252.6 215 130 2 .605 1831 12 152.6 245 361 30.1 68 5771987 12 804 4569 380.8 604 3162 30 263.5 200 93 18 .465 1407 12 117.3 236 331 27.6 45 3551986 13 925 5396 415.1 641 2599 36 199.9 284 182 12 .641 2797 10 215.2 286 379 29.2 87 7401985 12 833 4652 387.7 590 2536 19 211.3 243 151 6 .621 2116 18 176.3 244 342 28.5 70 5851984 12 842 3701 308.4 585 2083 14 173.5 257 141 15 .549 1618 11 134.8 213 214 17.8 58 4721983 12 880 4724 393.7 645 3160 29 263.3 235 121 10 .515 1564 14 130.3 266 355 29.6 56 4631982 12 845 4749 395.8 578 2801 25 233.4 267 138 16 .517 1948 17 162.3 259 345 28.8 43 3311981 12 845 5044 420.3 626 3293 31 274.4 219 101 11 .461 1751 16 145.9 259 355 29.6 74 6761980 12 911 4707 392.3 674 3023 24 251.9 237 127 10 .536 1684 18 140.3 260 322 26.8 50 4451979 12 877 4921 410.1 645 2885 29 240.4 232 128 14 .552 2036 13 169.7 227 312 26.0 47 4601978 12 912 4649 387.4 734 3251 31 270.9 178 86 6 .483 1398 19 116.5 261 372 31.0 44 4311977 12 843 4364 363.7 664 2986 30 248.8 179 92 10 .514 1378 16 114.8 226 353 29.4 50 4431976 12 817 5160 430.0 706 4144 43 345.3 111 54 8 .486 1016 13 84.7 264 432 36.0 30 3071975 12 863 4672 389.3 738 3848 35 320.7 125 41 15 .328 824 5 68.7 242 324 27.0 31 3191974 11 812 4409 400.8 686 3372 30 306.5 126 63 5 .500 1037 10 94.3 245 324 29.5 38 3841973 11 800 3915 355.9 695 3208 37 291.6 105 50 9 .476 707 5 64.3 211 330 30.0 58 5601972 11 803 3714 337.6 668 2845 25 258.6 135 63 4 .467 869 6 79.0 219 264 24.0 51 5131971 12 967 4687 390.6 842 3978 47 331.5 125 50 7 .400 709 5 59.1 271 421 35.1 54 6131970 10 795 3730 373.0 597 2508 32 250.8 198 90 6 .455 1222 8 122.2 203 288 28.8 45 4841969 11 918 4492 408.4 673 2938 267.1 245 119 7 .486 1554 8 141.3 242 352 32.0 68 6361968 10 794 3953 395.3 539 2270 227.0 255 119 13 .467 1683 13 168.3 214 217 21.7 59 5621967 10 732 2937 293.7 488 1635 163.5 244 120 13 .492 1302 130.2 168 144 14.4 40 4431966 10 698 3527 352.7 467 1845 184.5 232 121 7 .522 1682 168.2 186 236 23.6 52 6031965 10 731 3360 336.0 531 2023 202.3 200 94 10 .470 1337 133.7 196 185 18.5 52 4461964 10 651 3040 304.0 518 2143 214.3 142 67 6 .472 897 89.7 175 201 20.1 47 4461963 9 546 2143 238.1 392 1180 131.1 154 75 9 .488 963 107.0 130 131 14.6 39 3241962 9 552 1602 178.0 400 891 99.0 152 64 11 .421 711 79.0 98 70 7.8 53 4771961 9 539 2556 284.0 427 1841 204.6 112 54 5 .482 715 79.4 135 212 23.6 41 4011960 9 605 2520 280.0 456 1642 182.4 149 63 11 .423 878 97.6 145 133 14.8 35 3481959 9 589 2079 231.0 441 1278 142.0 148 67 21 .453 801 89.0 127 122 13.6 29 2541958 9 607 2461 273.4 431 1253 139.2 176 93 13 .528 1208 134.2 143 132 14.7 35 3371957 9 628 2781 309.0 482 1772 196.9 146 72 12 .493 1009 112.1 149 187 20.8 36 3361956 9 599 2975 330.6 471 1943 215.9 128 66 8 .516 1032 114.7 160 233 25.9 46 4201955 9 508 2131 236.8 393 1359 151.0 115 44 12 .383 772 85.8 107 179 19.9 54 4991954 9 588 2303 255.9 452 1414 157.1 136 54 18 .397 889 98.8 123 139 15.4 46 3291953 9 570 2626 291.8 401 1578 175.3 169 73 21 .432 1048 116.4 129 163 18.1 41 4221952 9 650 3098 344.2 462 1852 205.8 188 93 11 .495 1246 138.4 143 207 23.0 52 5011951 9 600 2117 235.2 454 1226 136.2 146 58 17 .397 891 99.0 117 135 12.3 45 3681950 10 582 2245 224.5 398 1265 126.5 184 73 14 .397 980 98.0 112 150 15.0 25 2981949 9 668 2451 272.3 469 1607 178.6 199 66 12 .332 854 94.9 135 135 12.3 33 2611948 9 576 2613 290.3 408 1258 139.8 168 76 7 .452 1355 150.6 134 252 28.0 26 2811947 10 656 4205 420.5 476 2417 241.7 180 92 17 .511 1788 178.8 175 394 39.4 31 2851946 9 579 3166 351.8 428 1844 204.9 151 63 22 .417 1322 146.9 148 233 25.9 31 3141945 10 596 2815 281.5 468 1832 183.2 128 51 12 .398 983 98.3 136 187 18.7 40 4101944 10 606 3045 304.5 527 2553 255.3 79 24 14 .304 492 49.2 139 204 20.4 34 3041943 9 598 3269 363.2 524 2648 294.2 74 36 11 .486 621 69.0 131 302 33.6 40 4131942 10 678 2854 285.4 519 2019 201.9 159 59 11 .371 835 83.5 159 221 22.1 36 3431941 8 495 2288 286.0 420 1870 233.8 75 33 12 .440 418 52.3 107 147 18.4 37 3051940 8 2463 307.9 1943 242.9 99 45 11 .455 520 65.0 132 196 24.5 42 3481939 8 2277 284.6 1704 213.0 120 50 13 .416 573 71.6 85 219 27.4 22 1961938 8 2222 277.8 1584 198.0 122 51 7 .418 638 79.8 92 131 16.4 38 2951937 8 1082 135.3 711 88.9 86 28 12 .326 371 46.4 51 54 6.8 2101936 8 1133 141.6 832 104.0 101 19 15 .188 301 37.6 53 36 4.5 135
ANNUAL TEAM STATISTICS
Michigan’s Annual Team Statistics
TOTAL OFFENSE RUSHING PASSING SCORINGYear G Plays Yards YPG Att. Yds. TDs YPG Att. Cmp. Int. Pct. Yds. TDs YPG 1st Downs Pts. Avg. Pen. Yds.2011 12 727 3811 317.6 381 1549 13 129.1 346 202 8 .584 2262 12 188.5 202 206 17.2 85 7342010 13 963 5860 450.8 554 2456 34 188.9 409 261 12 63.8 3404 21 261.8 292 458 35.2 57 5042009 12 838 4720 393.3 474 2063 20 171.9 364 219 11 .602 2657 18 221.4 233 330 27.5 69 5782008 12 836 4403 366.9 462 1643 21 136.9 374 216 9 .578 2760 19 230.0 204 347 28.9 65 5702007 13 898 4364 335.7 505 2039 17 156.8 393 217 14 .552 2325 14 178.8 228 278 21.4 75 6322006 13 789 3488 268.3 301 564 5 43.4 488 262 12 .537 2924 19 224.9 188 207 15.9 63 5012005 12 821 4142 345.2 430 1648 12 137.3 391 223 12 .570 2494 14 207.8 223 244 20.3 75 6282004 12 811 4035 336.2 440 1600 19 133.3 371 207 16 .558 2435 14 202.9 204 279 23.2 79 5832003 13 844 3863 297.2 434 1516 14 116.6 410 221 14 .539 2347 9 180.5 200 219 16.8 74 6452002 13 905 4520 347.7 465 1601 16 123.2 440 236 16 .536 2919 17 224.5 239 265 20.4 76 5962001 12 847 3821 318.4 428 1069 12 89.1 419 231 11 .551 2752 13 229.3 192 237 19.8 89 7542000 12 882 4679 389.9 460 1765 12 147.1 422 247 16 .585 2914 16 242.8 247 229 19.1 70 601 1999 12 795 3996 333.0 439 1450 10 120.8 356 184 10 .519 2546 18 212.2 196 247 20.6 106 8701998 13 886 3939 303.0 515 1583 11 121.8 371 185 19 .499 2356 15 181.2 197 235 18.1 74 6791997 12 723 2674 222.8 396 1068 7 89.0 327 162 23 .495 1606 5 133.8 142 114 9.5 77 6461996 12 844 3557 296.4 455 1375 10 114.6 389 214 14 .550 2182 5 181.8 204 184 15.3 71 5861995 13 880 3702 284.8 464 1211 13 93.2 416 234 15 .563 2491 9 191.6 204 223 17.2 82 6701994 12 831 4344 362.0 442 1490 10 124.2 389 234 8 .602 2854 23 237.8 243 268 22.3 88 7551993 12 816 3868 322.3 415 1296 6 108.0 401 230 17 .574 2572 11 214.3 230 160 13.3 73 6111992 12 807 3664 305.3 412 1090 8 90.8 395 228 13 .577 2574 11 214.5 207 171 14.3 68 5571991 12 847 3949 329.1 440 1265 8 105.4 407 234 16 .575 2684 17 233.7 222 203 16.9 59 4741990 12 816 3863 321.9 420 1256 15 104.7 396 243 24 .614 2607 10 217.3 229 198 16.5 65 5121989 12 824 3633 302.8 477 1319 9 109.9 347 214 17 .617 2314 12 192.8 222 184 15.3 59 5421988 12 739 3506 292.2 435 1556 11 129.7 304 172 16 .566 1950 6 162.5 189 167 13.9 65 5521987 12 796 3601 300.1 504 1602 12 133.5 292 167 12 .572 1999 9 166.6 201 172 14.3 64 5211986 13 845 3902 300.2 444 1540 10 118.5 401 219 15 .546 2362 12 181.7 232 203 15.6 82 6671985 12 763 3160 263.3 445 1439 4 119.1 318 166 21 .522 1721 4 143.4 178 98 8.1 52 5231984 12 808 4118 343.2 466 1742 16 145.1 342 214 20 .626 2376 8 198.0 235 200 16.6 63 4971983 12 756 3259 271.6 427 1352 5 112.7 329 179 19 .544 1907 12 158.9 190 160 13.3 50 4041982 12 931 4401 366.8 452 1344 15 112.0 479 295 12 .616 3057 9 254.8 266 204 17.0 64 6551981 12 819 3879 323.3 468 1537 9 128.1 351 187 21 .533 2342 10 195.2 219 162 13.5 47 4461980 12 780 3333 277.8 450 1399 116.6 330 171 20 .518 1934 161.2 199 129 10.8 62 5741979 12 804 3117 259.8 494 1261 105.1 310 170 13 .548 1856 154.7 180 151 12.6 41 4301978 12 728 2529 210.8 480 1374 114.5 249 118 12 .474 1135 96.3 159 105 8.8 39 3921977 12 780 3012 251.0 536 1451 120.9 245 134 15 .547 1561 130.1 170 124 10.3 36 3411976 12 796 3047 253.9 512 1454 121.2 284 155 23 .546 1593 132.8 177 95 7.9 44 3571975 12 783 2996 249.7 549 1605 133.8 234 113 10 .483 1391 115.9 175 130 10.8 42 4101974 11 659 2353 213.9 438 1163 105.7 221 106 14 .479 1190 108.2 144 65 5.9 43 3651973 11 661 2396 217.8 444 1075 97.7 217 111 14 .512 1321 120.1 134 68 6.2 34 2951972 11 680 2372 215.6 480 1440 130.9 200 82 17 .410 932 84.7 142 57 5.2 49 4271971 12 699 2360 196.7 441 789 65.8 258 128 15 .496 1571 130.9 146 83 6.9 43 3651970 10 663 2478 247.8 416 1051 105.1 247 121 20 .490 1427 142.7 130 90 9.0 48 4411969 11 763 3351 304.6 489 1851 168.3 274 130 24 .474 1500 136.4 185 148 13.5 43 3741968 10 795 3252 325.2 546 1993 199.3 249 96 25 .386 1270 127.0 201 155 15.5 35 3831967 10 690 2961 296.1 516 1808 180.8 174 74 14 .425 1153 115.3 167 179 17.9 43 3881966 10 685 2549 254.9 489 1596 159.6 196 82 9 .418 953 95.3 165 138 13.8 36 4371965 10 666 2760 276.0 440 1436 143.6 226 118 14 .522 1324 132.4 161 161 16.1 54 5621964 10 551 2082 208.2 326 781 78.1 252 118 14 .468 1301 130.1 133 76 7.6 39 3271963 9 584 2642 293.6 408 1251 139.0 176 98 9 .557 1391 154.6 149 127 14.1 37 3721962 9 598 2748 305.3 440 1839 204.3 159 75 13 .472 909 101.0 152 214 23.8 46 3751961 9 565 2326 258.4 404 1225 136.1 161 80 7 .496 1101 122.3 131 163 18.1 32 2841960 9 524 1968 218.7 373 1238 137.6 151 63 13 .417 730 81.1 106 84 9.3 34 2491959 9 579 2520 280.0 457 1634 181.6 122 57 14 .467 886 98.4 129 161 17.9 31 3241958 9 547 2642 293.6 451 1835 203.9 96 43 7 .448 807 89.7 135 211 23.4 54 4161957 9 576 2560 284.4 458 1879 208.8 118 51 12 .432 681 75.7 132 147 16.3 44 4321956 9 533 2208 245.3 433 1629 181.0 100 39 9 .390 579 64.3 124 123 13.7 34 3101955 9 556 1998 222.0 470 1596 177.3 86 28 10 .326 402 44.7 107 94 10.4 53 5061954 9 544 2170 241.1 380 1427 158.6 164 68 8 .414 743 82.6 110 87 9.7 35 3371953 9 570 2230 247.8 416 1488 165.3 164 68 19 .414 742 82.4 118 101 11.2 55 5991952 9 594 2381 264.6 375 1149 127.7 219 109 23 .498 1232 136.9 108 134 14.9 51 5031951 9 660 2621 291.2 492 1590 176.7 168 76 21 .452 1031 114.6 139 122 13.6 43 3801950 10 590 2028 202.8 439 1278 127.8 151 56 16 .371 750 75.0 100 114 11.4 39 2941949 9 554 1936 215.1 406 1048 116.4 148 55 25 .372 888 98.7 94 85 9.4 31 2581948 9 540 1848 205.3 373 789 87.7 167 74 21 .443 1059 117.7 100 44 4.9 27 3181947 10 571 2056 205.6 415 1250 125.0 156 67 27 .429 806 80.6 100 53 5.3 22 2011946 9 446 1903 211.4 330 1028 114.2 116 51 22 .440 875 97.2 110 73 8.1 21 1551945 10 576 2459 245.9 452 1652 165.2 124 54 17 .435 807 80.7 112 99 9.9 47 3951944 10 554 2032 203.2 430 1423 142.3 124 42 15 .339 609 60.9 104 91 9.1 32 2971943 9 473 1406 156.2 357 948 105.3 116 30 22 .259 458 50.9 68 73 8.1 20 1551942 10 537 2170 217.0 379 1055 105.5 158 75 14 .475 1115 111.5 101 134 13.4 42 3171941 8 1654 206.8 942 117.8 119 54 7 .454 712 89.0 82 41 5.0 22 1661940 8 1282 160.3 847 105.9 86 24 16 .279 435 54.4 49 34 4.3 23 1651939 8 1726 215.8 970 121.3 141 55 17 .390 756 94.5 75 94 11.8 16 1191938 8 1613 201.6 830 103.8 146 57 7 .390 783 97.9 66 40 5.0 21 1351937 8 1935 241.9 1246 155.8 95 39 12 .411 689 86.1 79 110 13.8 3211936 8 1740 217.5 1340 167.5 93 32 9 .344 400 50.0 83 127 15.9 324
RECORD BOOK
Opponents’ Annual Team Statistics
Scrimmage Run92 Butch Woolfolk vs. Wisconsin (TD) ..............................................................................1979
91 Tony Boles vs. Indiana (TD) ............................................................................................1989 90 Carlos Brown vs. Eastern Michigan (TD) ....................................................................2009 89 Butch Woolfolk at Wisconsin (TD) ...............................................................................1981 88 Tyrone Wheatley vs. Washington (TD) .......................................................................1993 87 Denard Robinson at Notre Dame (TD) ....................................................2010 86 Tom Harmon at California (TD) ....................................................................................1940 86 Chris Howard vs. Minnesota (TD) .................................................................................1996 85 Bill Culligan vs. Wisconsin (TD) .....................................................................................1944 85 Russell Davis vs. Stanford (TD) ......................................................................................1976 85 Carlos Brown vs. Minnesota (TD) ..................................................................................2007 84 Mel Anthony vs. Oregon State (TD) ............................................................................1965 84 Billy Taylor at Illinois (TD) ................................................................................................1969 82 Tyrone Wheatley vs. Iowa (TD) .....................................................................................1992 81 Tony Boles at Wisconsin (TD) ........................................................................................1988 80 Glenn Doughty vs. Vanderbilt (TD) .............................................................................1969 80 Anthony Thomas at Hawaii (TD) ...................................................................................1998 77 Jim Smith vs. Indiana (TD) ..............................................................................................1975 77 Jamie Morris vs. Alabama (TD) .....................................................................................1988 75 William Heston at Wisconsin (TD) ...............................................................................1904 75 Rob Lytle vs. Michigan State (TD) ...............................................................................1976 75 Steve Smith at Minnesota (TD).....................................................................................1983 74 B.J. Dickey vs. Wisconsin ..................................................................................................1977 74 Jamie Morris vs. Northwestern (TD) ...........................................................................1987 74 Tyrone Wheatley vs. Northwestern (TD) ...................................................................1991
LONGEST PLAYS ...
Longest Plays from ScrimmagePassing Play
97 Ryan Mallett – Mario Manningham at Wisconsin (TD) .........................................200790 Todd Collins – Derrick Alexander vs. Illinois (TD) ...................................................1993
83 Rick Leach – Jim Smith vs. Purdue (TD)......................................................................1975 81 Drew Henson – Marcus Knight at Michigan State (TD) ........................................1999 77 Jim Harbaugh – John Kolesar vs. Ohio State (TD) ..................................................1985 77 John Navarre -- Tyrece Butler at Iowa .........................................................................2001 77 Denard Robinson -- Junior Hemingway vs. Notre Dame .....................................2011 76 Rick Leach – Curt Stephenson vs. Washington (TD) ..............................................1978 76 Tom Brady – Tai Streets at Minnesota (TD) ...............................................................1998 75 Brian Griese – Amani Toomer vs. Minnesota (TD) ..................................................1995 75 Drew Henson – Marquise Walker vs. Indiana ...........................................................2000 72 Dave Glinka – Ben McRae vs. Purdue (TD) ................................................................1961 71 Ted Topor – Lowell Perry vs. Minnesota (TD) ...........................................................1951 71 John Wangler – Doug Marsh vs. Wisconsin (TD) .....................................................1979 71 Steve Smith – Anthony Carter vs. Notre Dame (TD) ..............................................1981 71 John Navarre -- Jason Avant at Iowa ...........................................................................2003 70 Bob Chappuis – Bob Mann vs. Pittsburgh (TD) .......................................................1947 70 Terry Barr – Ron Kramer vs. UCLA (TD) .......................................................................1956 70 Don Moorhead – Paul Staroba at Wisconsin ............................................................1970 70 Drew Henson – Anthony Thomas at Ohio State (TD) ...........................................2000
Field Goal57 Hayden Epstein at Michigan State ...............................................................................200156 Hayden Epstein at Michigan State ...............................................................................199956 Mike Gillette at Ohio State ..............................................................................................198855 J.E. Duffy vs. Cornell ...........................................................................................................189153 Mike Gillette vs. Iowa ........................................................................................................198652 Bob Bergeron vs. Washington ........................................................................................198452 Mike Gillette vs. Illinois .....................................................................................................198651 Mike Lantry vs. Stanford ..................................................................................................197351 Bob Wood vs. Navy ............................................................................................................197651 Bob Bergeron at Minnesota ............................................................................................198351 J.D. Carlson vs. Illinois .......................................................................................................199051 Jay Feely vs. Baylor .............................................................................................................199751 Jay Feely vs. Michigan State ...........................................................................................199851 Hayden Epstein at Iowa ....................................................................................................200151 Jason Olesnavage vs. Purdue .........................................................................................2009
Punt82 Monte Robbins at Hawaii ................................................................................................198679 Pete Drehmann vs. Indiana .............................................................................................196778 Monte Robbins vs. Michigan State ..............................................................................198476 Elroy Hirsch at Northwestern .........................................................................................1943
Interception Return95 Tom Harmon vs. Iowa (TD) .............................................................................................193994 Brandon Herron vs. Western Michigan (TD) .............................................................201192 Ken Tureaud vs. UCLA (TD) ............................................................................................196192 Thom Darden vs. UCLA (TD) ..........................................................................................197188 Ernest Shazor vs. Miami, Ohio (TD) ..............................................................................2004
82* Bob Wiese – Bump Elliott vs. Northwestern (TD) * Lateral ...............................1946
Kickoff Return100 Seth Smith vs. Wisconsin (TD).......................................................................................1994 99 Dennis Fitzgerald at Michigan State (TD) .................................................................1960 99 Tyrone Wheatley vs. Houston (TD) ..............................................................................1992 97 Grant Mason at Indiana ....................................................................................................2004 95 John Garrells vs. Illinois (TD) .........................................................................................1906 95 Desmond Howard vs. Michigan State (TD) ..............................................................1990 95 Steve Breaston vs. Minnesota (TD)...............................................................................2005 94 Tom Harmon at California (TD) ....................................................................................1940 93 Desmond Howard at Boston College (TD) ...............................................................1991 90 Dave Raimey vs. Ohio State (TD) .................................................................................1961
Punt Return93 Desmond Howard vs. Ohio State (TD) .......................................................................199188 Dave Brown vs. Colorado (TD) ......................................................................................197484 Gilvanni Johnson at Minnesota (TD) ..........................................................................198583 Darrell Harper at Minnesota (TD) ................................................................................195983 Dave Brown vs. Navy (TD) ..............................................................................................197283 Gil Chapman vs. Oregon (TD) .......................................................................................197382 Terry Barr vs. Army (TD)...................................................................................................195580 Paul Kromer at Ohio State (TD) ....................................................................................194080 Bob Chappuis vs. Pittsburgh (TD) ...............................................................................194780 Derrick Alexander vs. Michigan State (TD) ..............................................................199279 Derrick Alexander vs. North Carolina State (TD) ....................................................1994
78 Gene Derricotte vs. Pittsburgh (TD) ...........................................................................1947 78 Anthony Carter vs. Northwestern (TD) ......................................................................1979 78 Charles Woodson vs. Ohio State (TD)..........................................................................1997Butch Woolfolk had a 92-yard touchdown run vs. Wisconsin in 1979.
RushingYear Long Player, Game Date2011 65 Fitzgerald Toussaint at Illinois...........................................................Nov. 12, 20112010 87 Denard Robinson at Notre Dame (TD) ........................................ Sept. 11, 20102009 90 Carlos Brown vs. Eastern Michigan (TD) ..................................... Sept. 19, 20092008 58 Steven Threet vs. Wisconsin ............................................................ Sept. 27, 20082007 85 Carlos Brown vs. Minnesota (TD) .................................................... Oct. 27, 20072006 54 Mike Hart at Minnesota .................................................................... Sept. 30, 20062005 64 Mike Hart at Michigan State ................................................................Oct. 1, 20052004 46 David Underwood vs. Northwestern .............................................Nov. 13, 20042003 63 Chris Perry vs. Central Michigan ..................................................... Aug. 30, 20032002 59 B.J. Askew at Minnesota (TD) ..............................................................Nov. 9, 20022001 30 B.J. Askew vs. Miami of Ohio ..............................................................Sept. 1, 2001 30 B.J. Askew vs. Western Michigan ................................................... Sept. 22, 2001 30 Chris Perry vs. Ohio State ...................................................................Nov. 24, 20012000 68 Anthony Thomas at UCLA (TD) ...................................................... Sept. 16, 20001999 60 Anthony Thomas vs. Northwestern (TD) ........................................Nov. 6, 19991998 80 Anthony Thomas at Hawaii (TD) ......................................................Nov. 28, 19981997 58 Anthony Thomas vs. Iowa .................................................................. Oct. 18, 19971996 86 Chris Howard at Minnesota (TD) ..................................................... Oct. 26, 19961995 60 Tshimanga Biakabutuka vs. Minnesota......................................... Oct. 28, 19951994 67 Tyrone Wheatley vs. Penn State (TD) ............................................. Oct. 15, 19941993 59 Tyrone Wheatley vs. Washington State (TD) ................................Sept. 4, 19931992 88 Tyrone Wheatley vs. Washington (TD) .............................................. Jan. 1, 19931991 74 Tyrone Wheatley vs. Northwestern (TD) .........................................Nov. 9, 19911990 63 Jon Vaughn vs. UCLA (TD)................................................................ Sept. 22, 19901989 91 Tony Boles vs. Indiana (TD) ................................................................ Oct. 28, 19891988 81 Tony Boles at Wisconsin (TD) ...............................................................Oct. 1, 19881987 77 Jamie Morris vs. Alabama (TD) ............................................................ Jan. 2, 19881986 55 Robert Perryman at Hawaii (TD) ........................................................ Dec. 6, 19861985 65 Phil Webb vs. Purdue (TD)....................................................................Nov. 9, 19851984 68 Jamie Morris vs. Minnesota ...............................................................Nov. 10, 19841983 75 Steve Smith at Minnesota (TD) ........................................................Nov. 12, 19831982 52 Larry Ricks vs. Purdue ..........................................................................Nov. 13, 19821981 89 Butch Woolfolk at Wisconsin (TD) ................................................. Sept. 12, 19811980 64 Butch Woolfolk at Indiana (TD) ..........................................................Nov. 1, 19801979 92 Butch Woolfolk vs. Wisconsin (TD) .................................... Nov. 3, 19791978 45 Rick Leach vs. Illinois .......................................................................... Sept. 16, 19781977 74 B.J. Dickey vs. Wisconsin ..................................................................... Oct. 15, 19771976 85 Russell Davis vs. Stanford (TD) ....................................................... Sept. 11, 19761975 77 Jim Smith vs. Indiana (TD) ...................................................................Nov. 8, 19751974 49 Mark Elzinga vs. Minnesota (TD) ..................................................... Oct. 26, 19741973 71 Chuck Heater vs. Indiana (TD) ............................................................Nov. 3, 19731972 58 Gil Chapman vs. Michigan State (TD) ............................................ Oct. 14, 19721971 66 Bill Taylor vs. Indiana (TD) .................................................................. Oct. 30, 19711970 53 Glenn Doughty vs. Michigan State ................................................. Oct. 17, 19701969 84 Bill Taylor at Illinois (TD) ........................................................................Nov. 8, 19691968 67 Ron Johnson vs. Wisconsin (TD) ......................................................Nov. 16, 1968
PassingYear Long Player, Game Date2011 77 Denard Robinson to Junior Hemingway vs. Notre Dame .............Sept. 10, 20112010 75 Denard Robinson to Roy Roundtree vs. Illinois (TD)...................... Nov. 6, 2010 75 Denard Robinson to Roy Roundtree vs. Illinois ............................... Nov. 6, 20102009 76 Tate Forcier to Roy Roundtree at Illinois ............................................Oct. 31, 20092008 51 Steven Threet to Darryl Stonum at Purdue (TD) ............................. Nov. 1, 20082007 97 Ryan Mallett to Mario Manningham at Wisconsin (TD) .............Nov. 10, 20072006 69 Chad Henne to Mario Manningham at Notre Dame (TD) ........Sept. 16, 20062005 54 Chad Henne to Jason Avant vs. Notre Dame .................................Sept. 10, 20052004 69 Chad Henne to Braylon Edwards at Indiana (TD) ............................ Oct. 2, 20042003 71 John Navarre to Jason Avant at Iowa .................................................... Oct. 4, 20032002 49 John Navarre to Braylon Edwards vs. Florida ......................................Jan. 1, 20032001 77 John Navarre to Tyrece Butler at Iowa ................................................Oct. 27, 20012000 75 Drew Henson to Marquise Walker vs. Indiana .................................Oct. 14, 20001999 81 Drew Henson to Marcus Knight at Michigan State (TD) ............... Oct. 9, 19991998 76 Tom Brady to Tai Streets at Minnesota (TD) .....................................Oct. 31, 19981997 58 Brian Griese to Tai Streets vs. Washington State (TD) ......................Jan. 1, 19981996 69 Brian Griese to Tai Streets at Ohio State (TD) ..................................Nov. 23, 19961995 75 Brian Griese to Amani Toomer vs. Minnesota (TD) ........................Oct. 28, 19951994 65 Todd Collins to Amani Toomer vs. Colorado (TD) ........................Sept. 24, 19941993 90 Todd Collins to Derrick Alexander vs. Illinois (TD) ............ Oct. 23, 19931992 65 Elvis Grvac to Amani Toomer at Northwestern ................................ Nov. 7, 19921991 65 Elvis Grbac to Desmond Howard at Minnesota (TD) ..........................Oct. 25, 19911990 63 Elvis Grbac to Desmond Howard vs. Mississippi (TD) ............................Jan. 1, 19911989 49 Michael Taylor to Greg McMurtry at Minnesota (TD) ........................ Nov. 18, 19891988 57 Demetrius Brown to Greg McMurtry at Ohio State (TD) .................. Nov. 19, 19881987 62 Demetrius Brown to Greg McMurtry at Minnesota (TD) ....................Nov. 7, 19871986 62 Jim Harbaugh to Greg McMurtry at Wisconsin ................................ Oct. 4, 19861985 77 Jim Harbaugh to John Kolesar vs. Ohio State (TD) .......................Nov. 23, 19851984 67 Vince Bean to Paul Jokisch vs. Minnesota (TD) ..............................Nov. 10, 19841983 67 Steve Smith to Triando Markray vs. Ohio State (TD) ....................Nov. 19, 19831982 62 Steve Smith to Anthony Carter vs. Purdue (TD) ............................Nov. 13, 19821981 71 Steve Smith to Anthony Carter vs. Notre Dame (TD) .................Sept. 19, 19811980 55 John Wangler to Craig Dunaway vs. Michigan State ....................Oct. 11, 19801979 71 John Wangler to Doug Marsh vs. Wisconsin (TD) ........................... Nov. 3, 19791978 65 Rick Leach to Ralph Clayton at Wisconsin (TD) ...............................Oct. 21, 19781977 76 Rick Leach to Curt Stephenson vs. Washington (TD) ......................Jan. 2, 19781976 64 Rick Leach to Jim Smith at Purdue (TD) .............................................. Nov. 6, 19761975 83 Rick Leach to Jim Smith vs. Purdue (TD) ............................................. Nov. 8, 19751974 52 Dennis Franklin to Jim Smith vs. Purdue (TD) ................................Nov. 16, 19741973 46 Dennis Franklin to Paul Seal vs. Wisconsin (TD)..............................Oct. 20, 19731972 52 Dennis Franklin to Clint Haslerig vs. Purdue ...................................Nov. 18, 19721971 49 Larry Cipa to Mike Oldham vs. Navy (TD)............................................ Oct. 2, 19711970 70 Don Moorhead to Paul Staroba at Wisconsin ..................................Oct. 31, 19701969 49 Jim Betts to Bill Harris vs. Washington ..............................................Sept. 27, 19691968 69 Dennis Brown to Bill Harris vs. Illinois .................................................. Nov. 9, 1968
RECORD BOOK
Longest Plays of the Year (Since 1968)Kickoff Return
Year Long Player, Game Date2011 33 Martavious Odoms vs. Purdue ......................................................... Oct. 29, 20112010 47 Jeremy Gallon at Penn State ............................................................. Oct. 30, 20102009 94 Darryl Stonum vs. Notre Dame (TD) ............................................ Sept. 12, 20092008 53 Boubacar Cissoko at Purdue ...............................................................Nov. 1, 20082007 35 Brandon Minor vs. Purdue ................................................................. Oct. 13, 20072006 64 Steve Breaston vs. Iowa ...................................................................... Oct. 21, 20062005 95 Steve Breaston vs. Minnesota (TD) ....................................................Oct. 8, 20052004 97 Grant Mason at Indiana .........................................................................Oct. 2, 20042003 45 Jeremy LeSueur vs. Houston ..............................................................Sept. 6, 20032002 49 Jeremy LeSueur vs. Western Michigan ...........................................Sept. 7, 20022001 57 Todd Howard vs. Minnesota..............................................................Nov. 10, 20012000 53 Ryan Beard vs. Rice ................................................................................Sept. 9, 20001999 53 Walter Cross at Penn State .................................................................Nov. 13, 19991998 45 Anthony Thomas vs. Michigan State............................................ Sept. 26, 19981997 43 Anthony Thomas vs. Ohio State.......................................................Nov. 22, 19971996 59 Tyrone Butterfield vs. Michigan State..............................................Nov. 2, 19961995 40 Mercury Hayes vs. Nortwestern ..........................................................Oct. 7, 19951994 100 Seth Smith vs. Wisconsin (TD) ..........................................Oct. 29, 19941993 50 Tyrone Wheatley vs. Washington State ..........................................Sept. 4, 19931992 99 Tyrone Wheatley vs. Houston (TD) ............................................... Sept. 26, 19921991 93 Desmond Howard at Boston College (TD) ...................................Sept. 7, 19911990 95 Desmond Howard vs. Michigan State (TD).................................. Oct. 13, 19901989 85 Tony Boles vs. Purdue (TD) ..................................................................Nov. 4, 19891988 59 Tony Boles at Notre Dame ............................................................... Sept. 10, 1988 59 John Kolesar at Ohio State.................................................................Nov. 19, 19881987 45 Allen Jefferson vs. Alabama.................................................................. Jan. 2, 19881986 33 Jamie Morris at Ohio State ................................................................Nov. 22, 19861985 60 Jamie Morris at Iowa ............................................................................. Oct. 19,19851984 80 Jamie Morris vs. Northwestern......................................................... Oct. 13, 19841983 38 Kerry Smith vs. Iowa ............................................................................. Oct. 22, 19831982 48 Anthony Carter vs. Wisconsin ......................................................... Sept. 11, 19821981 52 Anthony Carter vs. Ohio State ..........................................................Nov. 21, 19811980 67 Anthony Carter at Notre Dame ...................................................... Sept. 20, 19801979 42 Anthony Carter vs. Kansas ............................................................... Sept. 22, 19791978 48 Ralph Clayton vs. Arizona ......................................................................Oct. 7, 19781977 62 Stan Edwards vs. Northwestern .........................................................Nov. 5, 19771976 36 Jim Smith vs. Wisconsin .................................................................... Sept. 11, 19761975 64 Gordon Bell vs. Baylor ........................................................................ Sept. 27, 19751974 40 Gordon Bell at Indiana ..........................................................................Nov. 2, 19741973 31 Clint Haslerig vs. Illinois ......................................................................Nov. 10, 19731972 73 Gil Chapman at Illinois (TD) .............................................................. Oct. 21, 19721971 45 Harry Banks at Minnesota .................................................................. Oct. 23, 19711970 38 Dave Rather vs. Illinois ..........................................................................Nov. 7, 19701969 44 Bill Taylor vs. Missouri .............................................................................Oct. 4, 19691968 48 Lance Scheffler vs. Minnesota .......................................................... Oct. 26, 1968
Punt ReturnYear Long Player, Game Date2011 32 Jeremy Gallon vs. Nebraska ...............................................................Nov. 19, 20112010 34 Junior Hemingway vs. Mississippi State ...............................................Jan. 1, 20112009 33 Junior Hemingway vs. Purdue ................................................................ Nov. 7, 20092008 73 Martavious Odoms at Purdue (TD) ....................................................... Nov. 1, 20082007 29 Greg Mathews at Michigan State .......................................................... Nov. 3, 20072006 83 Steve Breaston at Indiana (TD) .............................................................Nov. 11, 20062005 72 Steve Breaston vs. Eastern Michigan ..................................................... Oct. 8, 20052004 76 Leon Hall at Indiana (TD) ............................................................................ Oct. 2, 20042003 74 Steve Breaston vs. Illinois (TD) ...............................................................Oct. 18, 20032002 27 Julius Curry vs. Western Michigan ........................................................ Sept. 7, 20022001 43 Marlin Jackson at Wisconsin (TD off blocked punt) .....................Nov. 17, 20012000 48 Ronald Bellamy vs. Rice ............................................................................. Sept. 9, 20001999 24 DiAllo Johnson at Penn State ................................................................Nov. 13, 19991998 28 Marcus Knight at Hawaii ..........................................................................Nov. 28, 19981997 78 Charles Woodson vs. Ohio State (TD) ................................................Nov. 22, 19971996 31 Charles Woodson vs. Alabama ..................................................................Jan. 1, 1997 31 Chuck Winters vs. Boston College ......................................................Sept. 21, 19961995 56 Amani Toomer at Indiana (TD)...............................................................Oct. 21, 19951994 72 Amani Toomer at Illinois (TD) .................................................................Oct. 22, 19941993 79 Derrick Alexander vs. North Carolina State (TD) ...............................Jan. 1, 19941992 80 Derrick Alexander vs. Michigan State (TD) .......................................Oct. 10, 19921991 93 Desmond Howard vs. Ohio State (TD) ............................... Nov. 23, 19911990 60 Tripp Welborne at Indiana .......................................................................Oct. 27, 19901989 63 Tripp Welborne at UCLA .........................................................................Sept. 23, 19891988 60 John Kolesar at Northwestern................................................................Oct. 29, 19881987 43 John Kolesar vs. Washington State ....................................................Sept. 19, 19871986 34 Dieter Heren vs. Illinois ............................................................................... Nov. 1, 19861985 84 Gilvanni Johnson at Minnesota (TD) ..................................................Nov. 16, 19851984 18 Tony Gant vs. Wisconsin..........................................................................Sept. 22, 19841983 41 Evan Cooper at Michigan State ............................................................... Oct. 8, 19831982 72 Anthony Carter at Notre Dame (TD) .................................................Sept. 18, 19821981 59 Anthony Carter vs. Illinois ......................................................................... Nov. 7, 19811980 21 Anthony Carter at Ohio State ................................................................Nov. 22, 19801979 78 Anthony Carter vs. Northwestern (TD) ............................................... Sept. 8, 19791978 21 Mike Harden vs. Illinois............................................................................Sept. 16, 19781977 49 Dwight Hicks vs. Northwestern .............................................................. Nov. 5, 19771976 41 Jim Smith vs. Wake Forest .......................................................................... Oct. 2, 19761975 50 Jim Smith vs. Indiana .................................................................................Oct. 25, 19751974 88 Dave Brown vs. Colorado (TD) .............................................................Sept. 11, 19741973 83 Gil Chapman vs. Oregon (TD) .................................................................. Oct. 6, 19731972 83 Dave Brown vs. Navy (TD).......................................................................... Oct. 7, 19721971 47 Thom Darden vs. Illinois ...........................................................................Oct. 16, 19711970 44 Dave Rather vs. Texas A&M ........................................................................ Oct. 3, 19701969 60 Barry Pierson vs. Ohio State ...................................................................Nov. 22, 19691968 63 George Hoey vs. Navy.................................................................................. Oct. 5, 1968School record in bold face type
PassingYear Name Att. Comp. Int. Pct. Yds. TD1938 Tom Harmon 45 21 1 .467 310 31939 Tom Harmon 94 37 8 .394 488 61940 Tom Harmon 94 43 11 .457 506 71941 Tom Kuzma 59 26 10 .441 317 31942 Bob Chappuis 64 28 4 .438 358 31943 Elroy Hirsch 22 9 2 .409 213 31944 Bill Culligan 39 12 8 .308 245 31945 Pete Elliott 52 19 6 .365 393 31946 Bob Chappuis 92 52 7 .565 734 71947 Bob Chappuis 110 62 6 .564 1164 141948 Chuck Ortmann 87 41 2 .471 856 91949 Chuck Ortmann 126 45 3 .357 627 21950 Chuck Ortmann 120 56 8 .467 736 11951 Bill Putich 77 32 7 .416 380 21952 Ted Kress 85 45 7 .529 559 41953 Lou Baldacci 51 21 6 .412 302 11954 Jim Maddock 35 16 5 .457 293 11955 Jim Maddock 52 20 3 .385 343 21956 Bob Ptacek 23 15 2 .652† 245 31957 Jim Van Pelt 80 42 3 .525 629 71958 Bob Ptacek 115 65 9 .565 763 31959 Stan Noskin 115 61 15 .530 747 51960 Dave Glinka 124 54 11 .435 755 51961 Dave Glinka 96 46 5 .479 588 41962 Bob Chandler 63 29 4 .460 401 11963 Bob Timberlake 98 47 4 .480 593 31964 Bob Timberlake 137 70 5 .511 884 51965 Wally Gabler 125 58 2 .464 825 41966 Dick Vidmer 226 117 7 .518 1611 101967 Dennis Brown 156 82 7 .526 913 51968 Dennis Brown 229 109 10 .476 1562 121969 Don Moorhead 210 103 7 .490 1261 51970 Don Moorhead 190 87 6 .458 1167 81971 Tom Slade 63 27 4 .429 364 21972 Dennis Franklin 123 59 2 .480 818 61973 Dennis Franklin 67 36 5 .537 534 41974 Dennis Franklin 104 58 5 .558 933 81975 Rick Leach 100 32 12 .320 680 31976 Rick Leach 105 50 8 .476 973 131977 Rick Leach 174 90 9 .517 1348 151978 Rick Leach 158 78 6 .494 1283 171979 John Wangler 130 78 7 .600 1431 81980 John Wangler 212 117 9 .552 1522 161981 Steve Smith 210 97 11 .462 1661 151982 Steve Smith 227 118 13 .520 1735 141983 Steve Smith 205 106 8 .517 1420 131984 Jim Harbaugh 111 60 5 .541 718 31985 Jim Harbaugh 227 145 6 .639 1976 181986 Jim Harbaugh 277 180 11 .650 2729 101987 Demetrius Brown 168 80 16† .476 1251 111988 Michael Taylor 122 76 2 .623 957 51989 Michael Taylor 121 74 3 .612 1081 11 Elvis Grbac 116 73 3 .629 824 81990 Elvis Grbac 266 155 10 .583 1911 211991 Elvis Grbac 254 165 6 .650 2085 25†1992 Elvis Grbac 199 129 12 .648 1640 171993 Todd Collins 296 189 7 .639 2509 171994 Todd Collins 288 186 10 .646 2518 131995 Brian Griese 238 127 10 .534 1577 131996 Scott Dreisbach 269 149 9 .554 2025 121997 Brian Griese 307 193 6 .629 2293 171998 Tom Brady 350 214 12 .611 2636 151999 Tom Brady 341 214 6 .628 2586 202000 Drew Henson 237 146 4 .616 2146 182001 John Navarre 385 207 13 .538 2435 192002 John Navarre 448 248 7 .554 2905 212003 John Navarre 456† 270† 10 .592 3331† 242004 Chad Henne 399 240 12 .602 2743 25†2005 Chad Henne 382 223 8 .584 2526 232006 Chad Henne 328 203 8 .619 2508 222007 Chad Henne 278 162 9 .583 1938 172008 Steven Threet 200 102 7 .510 1105 92009 Tate Forcier 281 165 10 .587 2050 132010 Denard Robinson 291 182 11 .625 2570 182011 Denard Robinson 237 133 14 .561 2056 18† Denotes category high
ANNUAL LEADERS
Leaders Through the YearsReceiving
Year Reception Leader No. Year Yardage Leader Yds.1938 Paul Kromer 9 1938 Forest Evashevski 831939 Forest Evashevski 14 1939 Forest Evashevski 1341940 Ed Frutig 12 1940 Ed Frutig 1811941 George Ceithaml 10 1941 Phil Sharpe 1061942 George Ceithaml 18 1942 George Ceithaml 2321943 Farnham Johnson 4 1943 Farnham Johnson 1091944 Dick Rifenberg 8 1944 Dick Rifenburg 2321945 Hank Fonde 11 1945 Ed McNeill 1791946 Bobby Mann 14 1946 Bobby Mann 2851947 Bump Elliott 18 1947 Bobby Mann 3571948 Dick Rifenburg 22 1948 Dick Rifenburg 508 Leo Koceski 221949 Harry Allis 23 1949 Harry Allis 3381950 Lowell Perry 24 1950 Lowell Perry 3741951 Lowell Perry 16 1951 Lowell Perry 3951952 Lowell Perry 31 1952 Lowell Perry 4921953 Bob Topp 23 1953 Bob Topp 3311954 Ron Kramer 23 1954 Ron Kramer 3031955 Ron Kramer 12 1955 Tom Maentz 2531956 Ron Kramer 18 1956 Ron Kramer 3531957 Gary Prahst 15 1957 Gary Prahst 2331958 Gary Prahst 22 1958 Gary Prahst 3131959 Bob Johnson 20 1959 Bob Johnson 2641960 Bob Johnson 15 1960 Bob Johnson 2301961 George Mans 15 1961 Bennie McRae 2101962 Harvey Chapman 11 1962 Harvey Chapman 223 Dave Raimey 111963 John Henderson 27 1963 John Henderson 3301964 John Henderson 31 1964 John Henderson 4271965 Jack Clancy 52 1965 Jack Clancy 7621966 Jack Clancy 76 1966 Jack Clancy 10791967 Jim Berline 54 1967 Jim Berline 6241968 Jim Mandich 43 1968 Jim Mandich 5761969 Jim Mandich 50 1969 Jim Mandich 6621970 Paul Staroba 35 1970 Paul Staroba 5191971 Glenn Doughty 16 1971 Glenn Doughty 2031972 Paul Seal 18 1972 Paul Seal 2431973 Paul Seal 14 1973 Paul Seal 2541974 Gil Chapman 23 1974 Jim Smith 3921975 Jim Smith 24 1975 Jim Smith 5531976 Jim Smith 26 1976 Jim Smith 7141977 Ralph Clayton 24 1977 Ralph Clayton 4771978 Ralph Clayton 25 1978 Ralph Clayton 5461979 Doug Marsh 33 1979 Doug Marsh 6121980 Anthony Carter 51 1980 Anthony Carter 8181981 Anthony Carter 50 1981 Anthony Carter 9521982 Anthony Carter 43 1982 Anthony Carter 8441983 Sim Nelson 41 1983 Sim Nelson 4941984 Sim Nelson 40 1984 Sim Nelson 4591985 Eric Kattus 38 1985 Paul Jokisch 6811986 Gerald White 38 1986 Ken Higgins 6211987 Greg McMurtry 21 1987 Greg McMurtry 4741988 Greg McMurtry 27 1988 Greg McMurtry 4701989 Greg McMurtry 41 1989 Greg McMurtry 7111990 Desmond Howard 63 1990 Desmond Howard 10251991 Desmond Howard 62 1991 Desmond Howard 9851992 Derrick Alexander 50 1992 Derrick Alexander 7401993 Derrick Alexander 35 1993 Derrick Alexander 6211994 Amani Toomer 54 1994 Amani Toomer 10961995 Mercury Hayes 48 1995 Mercury Hayes 9231996 Tai Streets 44 1996 Tai Streets 7301997 Chris Howard 37 1997 Tai Streets 4761998 Tai Streets 67 1998 Tai Streets 10351999 David Terrell 71 1999 David Terrell 10382000 David Terrell 67 2000 David Terrell 11302001 Marquise Walker 86 2001 Marquise Walker 11432002 Braylon Edwards 67 2002 Braylon Edwards 10352003 Braylon Edwards 85 2003 Braylon Edwards 11382004 Braylon Edwards 97† 2004 Braylon Edwards 1330†2005 Jason Avant 82 2005 Jason Avant 10072006 Steve Breaston 58 2006 Mario Manningham 7032007 Mario Manningham 72 2007 Mario Manningham 11742008 Martavious Odoms 49 2008 Martavious Odoms 4432009 Roy Roundtree 32 2009 Roy Roundtree 4342010 Roy Roundtree 72 2010 Roy Roundtree 9352011 Junior Hemmingway 32 2011 Junior Hemmingway 636
RushingYear Name Atts. Yds. Avg.1938 Tom Harmon 77 398 5.21939 Tom Harmon 130 884 6.81940 Tom Harmon 191 852 4.51941 Bob Westfall 156 688 4.41942 Bob Wiese 133 466 3.51943 Bill Daley 120 817 6.81944 Bob Nussbaumer 78 502 6.41945 Wally Teninga 66 317 4.81946 Bob Chappuis 116 502 4.31947 J. Weisenburger 121 773 6.41948 Tom Peterson 109 330 3.01949 Don Dufek 122 392 3.21950 Don Dufek 174 702 4.01951 Don Peterson 152 549 3.61952 Ted Kress 135 623 4.61953 Tony Branoff 101 501 5.01954 Fred Baer 107 439 4.11955 Tony Branoff 86 387 4.51956 Jim Pace 103 498 4.81957 Jim Pace 123 664 5.41958 Darrell Harper 55 309 5.61959 Fred Julian 72 289 4.01960 Bennie McRae 80 352 4.41961 Dave Raimey 99 496 5.01962 Dave Raimey 124 385 3.11963 Mel Anthony 103 394 3.81964 Mel Anthony 145 702 4.81965 Carl Ward 112 639 5.71966 Dave Fisher 131 637 4.91967 Ron Johnson 220 1005 4.61968 Ron Johnson 255 1391 5.51969 Bill Taylor 141 864 6.11970 Bill Taylor 197 911 4.61971 Bill Taylor 249 1297 5.21972 Ed Shuttlesworth 157 723 4.61973 Ed Shuttlesworth 193 745 3.91974 Gordon Bell 174 1048 6.01975 Gordon Bell 273 1388 5.11976 Rob Lytle 221 1469 6.61977 Russell Davis 225 1092 4.91978 Harlan Huckleby 154 741 4.81979 Butch Woolfolk 191 990 5.21980 Butch Woolfolk 196 1042 5.31981 Butch Woolfolk 253 1459 5.81982 Lawrence Ricks 266 1388 5.21983 Rick Rogers 209 1002 4.81984 Jamie Morris 118 574 4.91985 Jamie Morris 197 1030 5.21986 Jamie Morris 212 1086 5.11987 Jamie Morris 282 1703 6.01988 Tony Boles 262 1408 5.41989 Tony Boles 131 839 6.41990 Jon Vaughn 216 1416 6.61991 Ricky Powers 240 1364 5.71992 Tyrone Wheatley 185 1357 7.31993 Tyrone Wheatley 207 1129 5.51994 Tyrone Wheatley 210 1144 5.41995 T. Biakabutuka 303 1818 6.01996 Clarence Williams 202 837 4.11997 Chris Howard 199 938 4.71998 Anthony Thomas 167 893 5.31999 Anthony Thomas 301 1297 4.32000 Anthony Thomas 319 1733 5.42001 B.J. Askew 199 902 4.52002 Chris Perry 267 1110 4.22003 Chris Perry 338 1674 5.02004 Mike Hart 282 1445 5.22005 Mike Hart 150 662 4.42006 Mike Hart 318 1562 4.92007 Mike Hart 265 1361 5.12008 Brandon Minor 103 533 5.22009 Brandon Minor 96 502 5.22010 Denard Robinson 256 1702 6.62011 Denard Robinson 208 1163 5.6
Bold Face Italic Denotes category high
RECORD BOOK
Total OffenseYear Name Plays Yds. Avg.1938 Tom Harmon 122 708 5.81939 Tom Harmon 224 1467 6.51940 Tom Harmon 285 1358 4.81941 Tom Kuzma 199 898 4.51942 Bob Chappuis 118 578 4.91943 Bill Daley 124 841 6.81944 Gene Derricotte 105 618 5.91945 Pete Elliott 141 709 5.01946 Bob Chappuis 208 1235 5.91947 Bob Chappuis 236 1674 7.11948 Chuck Ortmann 179 1073 6.01949 Chuck Ortmann 231 956 4.11950 Chuck Ortmann 201 847 4.21951 Don Peterson 165 733 4.41952 Ted Kress 220 1182 5.41953 Tony Branoff 105 614 5.81954 Dan Cline 140 621 4.41955 Tony Branoff 94 436 4.61956 Jim Pace 115 595 5.21957 Jim Pace 126 656 5.21958 Bob Ptacek 207 887 4.31959 Stan Noskin 159 718 4.51960 Dave Glinka 161 726 4.51961 Dave Glinka 129 630 4.91962 Dave Raimey 124 385 3.11963 Bob Timberlake 196 821 4.21964 Bob Timberlake 293 1515 5.21965 Wally Gabler 210 1090 5.21966 Dick Vidmer 293 1641 5.61967 Dennis Brown 293 1271 4.31968 Dennis Brown 344 1777 5.21969 Don Moorhead 380 1886 5.01970 Don Moorhead 287 1535 5.31971 Bill Taylor 249 1297 5.21972 Dennis Franklin 266 1329 5.01973 Dennis Franklin 168 959 5.71974 Dennis Franklin 212 1223 5.81975 Gordon Bell 275 1399 5.11976 Rick Leach 219 1611 7.41977 Rick Leach 289 1723 6.01978 Rick Leach 303 1894 6.31979 John Wangler 188 1455 7.71980 John Wangler 244 1400 5.71981 Steve Smith 344 2335 6.81982 Steve Smith 323 2080 6.41983 Steve Smith 308 2087 6.81984 Jim Harbaugh 153 772 5.01985 Jim Harbaugh 306 2115 6.91986 Jim Harbaugh 371 2847 7.71987 Jamie Morris 282 1703 6.01988 Tony Boles 262 1408 5.41989 Michael Taylor 176 1254 7.11990 Elvis Grbac 288 1928 6.71991 Elvis Grbac 277 1982 7.21992 Elvis Grbac 214 1590 7.41993 Todd Collins 330 2428 7.41994 Todd Collins 341 2475 7.31995 T. Biakabutuka 303 1818 6.01996 Scott Dreisbach 329 2121 6.41997 Brian Griese 365 2313 6.31998 Tom Brady 409 2528 6.21999 Tom Brady 378 2539 6.72000 Drew Henson 270 2140 7.92001 John Navarre 434 2317 5.32002 John Navarre 488 2889 5.92003 John Navarre 504 3240 6.42004 Chad Henne 454 2606 5.72005 Chad Henne 436 2551 5.92006 Chad Henne 375 2425 6.52007 Chad Henne 302 1818 6.02008 Steven Threet 276 1306 4.72009 Tate Forcier 399 2290 5.72010 Denard Robinson 547 4272 7.82011 Denard Robinson 445 3219 7.6
PuntingYear Name No. Yds. Avg.1938 Paul Kromer 34 1191 35.01939 Paul Kromer 16 662 41.41940 Tom Harmon 42 1551 36.91941 Tom Kuzma 43 1577 36.71942 Bob Wiese 15 530 35.31943 Bob Wiese 26 1009 38.81944 Bob Wiese 24 986 41.11945 J. Weisenburger 38 1341 35.31946 Bob Wiese 16 640 40.01947 J. Weisenburger 29 984 33.91948 Wally Teninga 48 1910 39.81949 Wally Teninga 53 2056 38.81950 Chuck Ortmann 40 1283 32.11951 Bill Billings 66 2270 34.41952 Bill Billings 40 1468 36.71953 Lou Baldacci 13 553 42.51954 Ron Kramer 19 783 41.21955 Tom Maentz 11 440 40.01956 Tom Maentz 11 434 39.51957 Jim Van Pelt 15 467 31.11958 Brad Myers 27 1065 39.41959 Darrell Harper 26 1066 41.01960 Reid Bushong 39 1388 35.61961 Scott Maentz 28 1044 37.31962 Joe O’Donnell 54 1879 34.81963 Joe O’Donnell 48 1746 36.41964 Stan Kemp 47 1694 36.01965 Stan Kemp 49 1774 36.21966 Stan Kemp 50 2000 40.01967 Pete Drehmann 52 1997 38.41968 Mark Werner 66 2438 36.91969 Mark Werner 54 2115 39.21970 Paul Staroba 54 2240 41.51971 Barry Dotzauer 60 2416 40.31972 Barry Dotzauer 53 2027 38.21973 Barry Dotzauer 53 2111 39.81974 John Anderson 41 1577 38.51975 John Anderson 53 2018 38.11976 John Anderson 30 1244 41.51977 John Anderson 56 2269 40.51978 Gregg Willner 54 2139 39.61979 Bryan Virgil 52 1942 37.31980 Don Bracken 56 2389 42.71981 Don Bracken 50 2167 43.31982 Don Bracken 49 1923 39.21983 Don Bracken 48 1794 37.41984 Monte Robbins 62 2705 43.61985 Monte Robbins 48 1937 40.41986 Monte Robbins 39 1701 43.61987 Monte Robbins 51 2219 43.51988 Mike Gillette 46 1834 39.91989 Chris Stapleton 39 1572 40.31990 Eddie Azcona 45 1669 37.11991 Eddie Azcona 37 1396 37.71992 Chris Stapleton 39 1548 39.71993 Chris Stapleton 49 2032 41.51994 Kraig Baker 44 1537 34.91995 Nate DeLong 45 1770 39.31996 Paul Peristeris 44 1610 36.61997 Jason Vinson 57 2183 38.31998 Jason Vinson 56 2193 39.21999 Hayden Epstein 32 1282 40.1 Cory Sargent 34 1339 39.42000 Hayden Epstein 55 2224 40.42001 Hayden Epstein 71 2790 39.32002 Adam Finley 69 2909 42.22003 Adam Finley 53 2120 40.02004 Adam Finley 64 2751 43.02005 Ross Ryan 52 1992 38.32006 Zoltan Mesko 50 2079 41.62007 Zoltan Mesko 70 2876 41.12008 Zoltan Mesko 80 3436 43.02009 Zoltan Mesko 52 2312 44.52010 Will Hagerup 33 1440 43.62011 Will Hagerup 27 993 36.8
ScoringYr. Name TD FG XP TP1938 Paul Kromer 6 0 1 371939 Tom Harmon 14 1 15 1021940 Tom Harmon 16 1 18 1171941 Tom Kuzma 8 0 0 481942 Paul White 8 0 0 481943 Elroy Hirsch 11 0 2 681944 Bob Wiese 7 0 0 421945 Wally Teninga 5 0 0 301946 Jim Brieske 0 1 29 321947 Bump Elliott 10 0 0 60 Jack Weisenburger 10 0 0 601948 Tom Peterson 9 0 1 551949 Don Dufek 5 0 0 301950 Don Dufek 9 0 0 541951 Lowell Perry 5 0 0 301952 Ted Kress 6 0 0 36 Ted Topor 6 0 0 361953 Tony Branoff 6 0 3 391954 Ron Kramer 3 0 14 321955 Ron Kramer 4 0 12 361956 Terry Barr 7 0 0 42 John Herrnstein 7 0 0 421957 Jim Pace 10 0 0 601958 Gary Prahst 4 0 1* 26 Bob Ptacek 4 0 1* 261959 Darrell Harper 3 2 7 311960 Dave Raimey 6 0 0 361961 Dave Raimey 8 0 0 481962 Dave Raimey 5 0 0 301963 John Henderson 5 0 1* 321964 Bob Timberlake 9 4 23 891965 Wally Gabler 7 0 0 421966 Jim Detwiler 10 0 0 601967 Ron Johnson 8 0 0 481968 Ron Johnson 19 0 1* 1161969 Garvie Craw 13 0 0 781970 Bill Taylor 11 0 1* 681971 Dana Coin 0 8 55 791972 Ed Shuttlesworth 11 0 0 661973 Mike Lantry 0 8 42 661974 Gordon Bell 11 0 0 661975 Gordon Bell 14 0 0 841976 Rob Lytle 16 0 0 961977 Russell Davis 9 0 0 541978 Rick Leach 12 0 0 721979 Butch Woolfolk 13 0 0 781980 Anthony Carter 14 0 0 841981 Steve Smith 12 0 1* 741982 Ali Haji-Sheikh 0 12 41 771983 Bob Bergeron 0 15 31 761984 Bob Bergeron 0 13 21 601985 Mike Gillette 0 16 30 781986 Mike Gillette 0 11 26 591987 Jamie Morris 15 0 0 901988 Mike Gillette 1 18 37 971989 J.D. Carlson 0 13 37 761990 J.D. Carlson 0 16 47 951991 Desmond Howard 23 0 0 1381992 Tyrone Wheatley 17 0 0 1021993 Tyrone Wheatley 14 0 0 841994 Remy Hamilton 0 25 26 1011995 Remy Hamilton 0 19 34 911996 Remy Hamilton 0 18 29 831997 Kraig Baker 0 14 35 771998 Jay Feely 0 17 40 911999 Anthony Thomas 17 0 0 1022000 Anthony Thomas 19 0 0 1142001 Hayden Epstein 0 13 37 762002 Chris Perry 14 0 0 842003 Chris Perry 20 0 0 1202004 Garrett Rivas 0 19 37 942005 Garrett Rivas 0 19 33 902006 Garrett Rivas 0 17 42 932007 Mike Hart 14 0 0 842008 Brandon Minor 11 0 0 662009 Jason Olesnavage 0 11 42 752010 Denard Robinson 14 0 0 842011 Denard Robinson 16 0 0 96*Two-Point Conversion
Kickoff Returns (by number of kickoffs returned)
Year Player KOR Yds Avg1968 George Hoey 12 221 18.41969 Glenn Doughty 10 199 19.91970 Glenn Doughty 7 116 16.61971 Dave Rather 12 240 20.01972 Gil Chapman 8 276 34.51973 Gil Chapman 6 135 22.5 Clint Haslerig 6 127 21.21974 Gil Chapman 12 231 19.31975 Gordon Bell 9 227 25.21976 Jim Smith 15 288 19.21977 Ralph Clayton 12 239 19.91978 Ralph Clayton 7 152 21.71979 Anthony Carter 17 385 22.61980 Anthony Carter 15 427 28.51981 Anthony Carter 15 406 27.11982 Anthony Carter 14 360 25.71983 Kerry Smith 4 108 27.0 Gilvanni Johnson 4 60 15.01984 Jamie Morris 16 307 19.21985 Jamie Morris 13 278 21.41986 Jamie Morris 15 320 21.31987 Phil Webb 11 203 18.51988 Tony Boles 14 338 24.11989 Desmond Howard 13 295 22.71990 Desmond Howard 17 504 29.61991 Desmond Howard 15 412 27.51992 Mercury Hayes 13 253 19.51993 Tyrone Wheatley 10 246 24.61994 Seth Smith 18 468 26.01995 Mercury Hayes 18 304 16.91996 Tyrone Butterfield 14 301 21.51997 Clarence Williams 14 285 20.41998 Justin Fargas 16 311 19.41999 Walter Cross 11 270 24.5 Anthony Thomas 11 216 19.62000 Walter Cross 14 260 18.62001 Todd Howard 22 469 21.32002 Jeremy LeSueur 26 583 22.42003 Steve Breaston 9 191 21.2 Jeremy LeSueur 9 189 21.02004 Steve Breaston 28 689 24.62005 Steve Breaston 23 646 28.12006 Steve Breaston 21 467 22.22007 Carlos Brown 16 306 19.12008 Boubacar Cissoko 20 467 23.4 Martavious Odoms 20 461 23.02009 Darryl Stonum 39 1001 25.72010 Jeremy Gallon 27 589 21.82011 Martavious Odoms 16 352 22.0
Punt Returns (by number of punts returned)
Year Player PR Yds Avg1941 Tom Kuzma 19 179 9.41942 Tom Kuzma 11 121 11.01943 Elroy Hirsch 17 189 11.11944 Gene Derricotte 11 69 6.31945 Henry Fonde 6 63 10.51946 Gene Derricotte 15 209 13.91947 Gene Derricotte 14 347 24.81948 Walt Teninga 12 139 11.61949 Charlie Lentz 17 169 9.91950 Chuck Ortmann 10 73 7.31951 Lowell Perry 22 232 10.51952 Lowell Perry 11 66 6.01953 Ted Kress 11 63 5.71954 Dan Cline 11 42 3.81955 Terry Barr 15 222 14.81956 Ed Shannon 7 36 5.11957 Jim Pace 8 98 12.3 Bob Ptacek 8 82 10.31958 Bob Ptacek 8 66 8.31959 Bennie McRae 5 19 3.81960 Bennie McRae 14 113 8.11961 Bennie McRae 10 39 3.91962 Dave Raimey 6 3 0.51963 Dick Rindfuss 11 96 8.71964 Dick Sygar 12 68 5.71965 Dick Sygar 10 121 12.1 Rick Volk 10 73 7.31966 Rick Volk 14 149 10.6
ANNUAL LEADERS
1967 George Hoey 12 299 24.91968 George Hoey 19 228 12.01969 Barry Pierson 21 293 14.01970 Thom Darden 18 153 8.51971 Bruce Elliott 26 202 7.81972 Gil Chapman 20 180 9.01973 David Brown 14 125 8.91974 David Brown 21 206 9.81975 Jim Smith 26 210 8.11976 Jim Smith 25 313 12.51977 Dwight Hicks 20 170 8.51978 Mike Jolly 28 152 5.41979 Anthony Carter 20 265 13.31980 Anthony Carter 24 165 6.91981 Anthony Carter 17 196 11.51982 Anthony Carter 19 270 14.21983 Evan Cooper 31 344 11.11984 Gilvanni Johnson 15 92 6.11985 John Campbell 13 120 9.21986 John Kolesar 12 69 5.8 Tony Gant 12 52 4.31987 John Kolesar 23 190 8.31988 John Kolesar 17 202 11.91989 Tripp Welborne 32 297 9.31990 Tripp Welborne 31 477 15.41991 Desmond Howard 18 282 15.71992 Derrick Alexander 26 371 14.31993 Derrick Alexander 16 163 10.21994 Amani Toomer 17 118 6.91995 Amani Toomer 21 177 8.41996 Chuck Winters 24 176 7.31997 Charles Woodson 36 301 8.41998 Marcus Knight 19 159 8.41999 DiAllo Johnson 23 239 10.42000 Ronald Bellamy 27 297 11.02001 Marquise Walker 23 206 9.02002 Julius Curry 28 302 10.82003 Steve Breaston 45 619 13.82004 Steve Breaston 24 292 12.22005 Steve Breaston 29 356 12.32006 Steve Breaston 29 332 11.42007 Greg Mathews 28 224 8.02008 Martavious Odoms 10 126 12.62009 Junior Hemingway 10 86 8.62010 Jeremy Gallon 10 43 4.32011 Jeremy Gallon 19 192 10.1
InterceptionsYear Player Int Yds TD1967 Thomas Curtis 7 93 01968 Thomas Curtis 10 182 01969 Thomas Curtis 8 156 01970 Marty Huff 5 85 0 Thom Darden 5 46 01971 Thom Darden 4 163 21972 Randy Logan 4 37 11973 Barry Dotzauer 3 13 01974 David Brown 4 75 0 Tom Drake 4 30 01975 Don Dufek 2 28 0 Dave Devich 2 23 1 Dwight Hicks 2 20 01976 Jerry Zuver 6 110 11977 Dwight Hicks 4 55 01978 Mike Harden 4 55 01979 Mike Jolly 4 0 01980 Marion Body 5 27 0 Brian Carpenter 5 0 01981 Tony Jackson 6 121 01982 Keith Bostic 5 119 11983 Bradley Cochran 5 41 01984 Bradley Cochran 5 53 01985 Ivan Hicks 6 41 01986 Andrew Moeller 4 0 01987 David Arnold 4 45 01988 Tripp Welborne 5 33 01989 Vada Murray 4 9 01990 Lance Dottin 5 16 01991 Steve Morrison 4 57 01992 Shonte Peoples 3 5 01993 Ty Law 6 79 01994 Ty Law 2 8 0 Clarence Thompson 2 0 01995 Charles Woodson 5 46 01996 Charles Woodson 5 28 0
1997 Charles Woodson 8 7 01998 William Peterson 4 76 1 DeWayne Patmon 4 13 01999 DeWayne Patmon 3 45 02000 Todd Howard 6 1 02001 Marlin Jackson 3 0 02002 Marlin Jackson 3 40 12003 Leon Hall 3 3 02004 Markus Curry 3 51 02005 Leon Hall 4 10 02006 Leon Hall 3 10 02007 Jamar Adams 3 58 0 Brandent Englemon 3 33 02008 Morgan Trent 3 0 02009 Donovan Warren 4 42 12010 Cam Gordon 3 35 0 James Rogers 3 34 02011 J.T. Floyd 2 59 0 Courtney Avery 2 1 0
Sacks Year Player Sacks Yds1983 Rodney Lyles 5 281984 Kevin Brooks 6 351985 Mark Messner 11 921986 Mark Messner 7 641987 Mark Messner 10 651988 Mark Messner 8 521989 Michael Evans 7 851990 Michael Evans 8 42 Martin Davis 8 381991 Brian Townsend 6 351992 Chris Hutchinson 11 991993 Buster Stanley 8 581994 Jason Horn 6 491995 Jason Horn 11 961996 David Bowens 12 791997 Glen Steele 7 48 Josh Williams 7 431998 James Hall 11 891999 James Hall 7 442000 Victor Hobson 3 122001 Dan Rumishek 7 412002 Victor Hobson 6 35 Shantee Orr 6 352003 Pierre Woods 7 362004 Pat Massey 5 382005 LaMarr Woodley 7 572006 LaMarr Woodley 12 1192007 Brandon Graham 8.5 542008 Brandon Graham 10 642009 Brandon Graham 9.5 742010 Ryan Van Bergen 4 352011 Ryan Van Bergen 5 34
Tackles for Loss Year Player TFL Yds1968 Henry Hill 16 N/A1969 Henry Hill 7 N/A1970 Phil Seymour 14 911971 Butch Carpenter 10 82 Tom Beckman 10 361972 Clint Spearman 8 42 Randy Logan 8 261973 Tim Davis 10 601974 Jeff Perlinger 13 491975 Greg Morton 15 611976 Dominic Tedesco 9 431977 Curtis Greer 11 481978 Curtis Greer 11 621979 Curtis Greer 23 1071980 Robert Thompson 15 601981 Tony Osbun 12 611982 Robert Thompson 15 831983 Rodney Lyles 9 521984 Kevin Brooks 13 611985 Mike Hammerstein 23 1121986 Mark Messner 10 72 Andy Moeller 10 321987 Mark Messner 20 841988 Mark Messner 26 1001989 Alex Marshall 11 621990 Michael Evans 12 491991 Erick Anderson 13 41
1992 Chris Hutchinson 13 1031993 Buster Stanley 11 651994 Trent Zenkewicz 16 631995 William Carr 21 781996 David Bowens 16 891997 Glen Steele 14 621998 James Hall 15 1011999 Dhani Jones 13 452000 Victor Hobson 12 312001 Larry Foote 26 952002 Victor Hobson 17 602003 Pierre Woods 14 502004 LaMarr Woodley 16 722005 LaMarr Woodley 16 672006 LaMarr Woodley 16.5 1312007 Shawn Crable 28.5 852008 Brandon Graham 20 972009 Brandon Graham 25 1032010 Jonas Mouton 8.5 33 Jordan Kovacs 8.5 24 Ryan Van Bergen 8.5 432011 Ryan Van Bergen 12 54
TacklesYear Player Tackles1968 Phil Seymour 102 Tom Stincic 1021969 Marty Huff 1261970 Marty Huff 1241971 Mike Taylor 1321972 Tom Kee 1161973 Steve Strinko 1371974 Steve Strinko 1141975 Calvin O’Neal 1511976 Calvin O’Neal 1531977 Ron Simpkins 1741978 Ron Simpkins 1681979 Andy Cannavino 1511980 Andy Cannavino 1681981 Mike Boren 1521982 Mike Boren 1711983 Mike Mallory 1191984 Mike Mallory 1481985 Andy Moeller 1381986 Andy Moeller 1371987 Allen Bishop 821988 Erick Anderson 77 J.J. Grant 771989 Erick Anderson 1051990 Erick Anderson 1161991 Erick Anderson 1301992 Steve Morrison 1241993 Jarrett Irons 951994 Steve Morrison 128 1995 Jarrett Irons 1241996 Sam Sword 1091997 Sam Sword 911998 Sam Sword 1271999 Ian Gold 952000 DeWayne Patmon 862001 Larry Foote 822002 Victor Hobson 992003 Lawrence Reid 822004 Ernest Shazor 842005 David Harris 882006 David Harris 1032007 Jamar Adams 922008 Obi Ezeh 982009 Stevie Brown 802010 Jonas Mouton 1172011 Kenny Demens 86
Come From Behind Victories Rank Season Opponent Place Trailed Won Points 1. 2003 Minnesota Minneapolis 7-28 38-35 21 2. 2008 Wisconsin Ann Arbor 0-19 27-25 19 3. 1995 Virginia Ann Arbor 0-17 18-17 17 2004 Michigan State Ann Arbor 10-27 45-37(3OT) 17 2011 Notre Dame Ann Arbor 24-7 35-31 17 6. 1939 Ohio State Ann Arbor 0-14 21-14 14 1955 Iowa Ann Arbor 0-14 33-21 14 1967 Illinois Champaign 0-14 27-14 14 1981 Illinois Ann Arbor 7-21 70-21 14 1997 Iowa Ann Arbor 7-21 28-24 14 1999 Alabama Miami * 35-34(OT) 14 2000 Illinois Champaign 7-21 35-31 14 13. 1916 Syracuse Ann Arbor 0-13 14-13 13 1930 Purdue Ann Arbor 0-13 14-13 13 1953 Iowa Ann Arbor 0-13 14-13 13 1954 Iowa Ann Arbor 0-13 14-13 13 1955 Minnesota Minneapolis 0-13 14-13 13 1964 Iowa Iowa City 0-13 34-20 13 2001 Iowa Iowa City 7-20 32-26 13 20. 1937 Chicago Ann Arbor 0-12 13-12 12 1994 Boston College Ann Arbor 0-12 34-26 12 22. 1919 Northwestern Ann Arbor 2-13 16-13 11 1938 Yale New Haven 2-13 15-13 11 1956 Iowa Iowa City 3-14 17-14 11 1961 Iowa Ann Arbor 3-14 23-14 11 1985 Nebraska Tempe 3-14 27-23 11 1986 Ohio State Columbus 3-14 26-24 11 1988 Southern California Pasadena 3-14 22-14 11 1989 UCLA Pasadena 3-14 24-23 11 1991 Iowa Iowa City 7-18 43-24 11* Michigan trailed 14-0 and 28-14 before rallying for a 35-34 win in overtime.
Opponent Come From Behind VictoriesRank Season Opponent Place Trailed Won Points 1. 1912 Penn Philadelphia 0-21 27-21 21 1982 UCLA Ann Arbor 0-21 31-27 21 3. 1999 Illinois Ann Arbor 7-27 35-29 20 4. 2000 Purdue West Lafayette 10-28 32-31 18 2000 Northwestern Evanston 10-28 54-51 18 6. 1988 Miami (Florida) Ann Arbor 14-30 31-30 16 1996 Northwestern Evanston 0-16 17-16 16 8. 1967 Minnesota Minneapolis 0-15 20-15 15 9. 1916 Cornell Ithaca 6-20 23-20 14 1942 Iowa Pre-Flight Ann Arbor 0-14 26-14 14 1983 Washington Seattle 10-24 25-24 14 2003 Iowa Iowa City 0-14 30-27 14 2009 Purdue Ann Arbor 10-24 38-36 14 14. 1914 Cornell Ann Arbor 0-13 28-13 13 1952 Michigan State Ann Arbor 0-13 27-13 13 1987 Ohio State Ann Arbor 0-13 23-20 13 17. 1961 Minnesota Minneapolis 8-20 23-20 12 1986 Arizona State Pasadena 3-15 22-15 12 1994 Colorado Ann Arbor 14-26 27-26 12 20. 1980 South Carolina Ann Arbor 3-14 17-14 11 1993 Illinois Ann Arbor 10-21 24-21 11 2005 Nebraska San Antonio 17-28 32-28 11
Consecutive Games Won
All Games Streak Years Began Ended 29 1901-1903 Albion, 50-0, 9/28/01 Minnesota, 6-6, 10/31/03 26 1903-1905 Ohio State, 36-0, 11/7/03 Chicago, 0-2, 11/30/05 25 1946-1949 Minnesota, 21-0, 11/2/46 Army, 7-21, 10/8/49
Home 50 1901-1907 Albion, 50-0, 9/28/01 Pennsylvania, 0-6, 11/16/07 28 1969-1973 Purdue, 31-20, 10/11/69 Ohio State, 10-10, 11/24/73 21 1897-1900 Ohio State, 34-0, 10/16/97 Ohio State, 0-0, 11/24/00
Away 11 1929-1933 Minnesota, 7-6, 11/16/29 Chicago, 0-7, 10/13/34 10 1946-1949 Minnesota, 21-0, 11/2/46 Northwestern, 20-21, 10/15/49
Conference 19 1990-1992 Indiana, 45-19, 10/27/90 Illinois, 22-22, 11/14/92 16 1996-1998 Ohio State, 13-9, 11/23/96 Ohio State, 16-31, 11/21/98 15 1946-1948 Minnesota, 21-0, 11/2/46 Northwestern, 20-21, 10/15/49 15 1971-1972 Northwestern, 21-6, 9/11/71 Ohio State, 11-14, 11/25/72 14 1931-1933 Illinois, 35-0, 10/24/31 Minnesota, 0-0, 11/18/33
RECORD BOOK
Wolverines Streaks and PeaksUnbeaten Streaks
OverallStreak Years Record Began Ended 56 1901-1905 55-0-1 Albion, 50-0, 9/28/01 Chicago, 0-2, 11/30/05 25 1946-1949 25-0-0 Minnesota, 21-0, 11/2/46 Army, 7-21, 10/8/49 22 1931-1933 20-0-2 Illinois, 35-0, 10/24/31 Michigan State, 0-16, 10/6/34 21 1973-1974 20-0-1 Iowa, 31-7, 9/15/73 Ohio State, 10-12, 11/23/74 20 1921-1924 18-0-2 Illinois, 3-0, 10/29/21 Illinois, 14-39, 10/18/24 16 1898-1899 16-0-0 Mich. Normal, 21-0, 10/1/98 Pennsylvania,10-11,11/11/99 15 1883-1888 15-0-0 Stevens Inst., 17-5, 11/27/83 U.Club (Chi.), 4-26, 11/29/88 15 1985-1986 14-0-1 Indiana, 42-15, 10/26/85 Minnesota, 17-20, 11/15/86 15 1929-1931 13-0-2 Harvard, 14-12, 11/9/29 Ohio State, 7-20, 10/17/31 13 1992-1993 10-0-3 Notre Dame, 17-17,9/12/92 Notre Dame, 23-27, 9/11/93
Home 95 1893-1907 92-0-3 N’western, 72-6, 11/18/93 Pennsylvania, 0-6, 11/16/0741 1969-1975 38-0-3 Purdue, 31-20, 10/11/69 Ohio State, 14-21, 11/22/75
Away 14 1990-1992 12-0-2 Wisconsin, 41-3, 10/6/90 Michigan State, 7-17, 10/9/93 11 1929-1933 11-0-0 Minnesota, 7-6, 11/16/29 Chicago, 0-27, 10/13/34 10 1946-1949 10-0-0 Minnesota, 21-0, 11/2/46 N’western, 20-21, 10/15/49 10 1988-1989 9-0-1 Wisconsin, 62-14, 10/1/88 Notre Dame, 24-28, 9/15/90
Conference 22 1990-1993 20-0-2 Indiana, 45-19, 10/27/90 Michigan State, 7-17, 10/9/93 17 1901-1905 16-0-1 Indiana, 33-0, 10/12/01 Chicago, 0-2, 11/30/05 17 1988-1990 16-0-1 Wisconsin, 62-14, 10/1/88 Michigan State, 27-28, 10/13/90 16 1931-1933 15-0-1 Illinois, 35-0, 10/24/31 Chicago, 0-27, 10/13/3416 1996-98 16-0-0 Ohio State, 13-9, 11/23/96 Ohio State, 16-31, 11/21/98
Home Conference 30 1968-1975 29-0-1 Mich. State, 28-14, 10/12/68 Ohio State, 14-21, 11/22/75
Away Conference 21 1987-1992 19-0-2 Minnesota, 30-20, 11/7/87 Michigan State, 7-17, 10/9/93
Greatest Margin of Victory (Since 1920) UM Opp Victory Rank Points Points Margin Opponent Year 1. 85 0 85 at Chicago 1939 2. 69 0 69 Northwestern 1975 69 0 69 Pittsburgh 1947 4. 65 0 65 Case 1921 5. 63 0 63 Michigan Agricultural 1922 63 0 63 Indiana 1925 7. 58 0 58 Indiana 2000 58 0 58 Minnesota 2011 9. 57 0 57 at Illinois 1969 63 6 57 Delaware State 2009 11. 69 13 56 Illinois 1986 70 14 56 Navy 1976 56 0 56 Wisconsin 1977 56 0 56 Virginia 1971 63 7 56 Iowa 1971 16. 55 0 55 Iowa 1970 55 0 55 Michigan State 1947 55 0 55 Miami (Ohio) 1924 55 0 55 Eastern Michigan 2005
Greatest Margin of Defeat (Since 1920) UM Opp Defeat Rank Points Points Margin Opponent Year 1. 0 40 40 Minnesota 1935 2. 0 38 38 Ohio State 1935 14 52 38 vs. Mississippi State 2010 4. 0 37 37 at Purdue 1962 5. 14 50 36 at Ohio State 1968 6. 0 34 34 at Minnesota 1934 0 34 34 at Ohio State 1934 0 34 34 Michigan State 1967 9. 6 39 33 Minnesota 1937 10. 7 39 32 Oregon 2007 11. 24 55 31 at Northwestern 1958 12. 20 50 30 Ohio State 1961 7 37 30 at Ohio State 2010 14. 6 35 29 Michigan State 1957 17 46 29 at Penn State 2008 16. 0 28 28 Michigan State 1961 0 28 28 at Michigan State 1962 0 28 28 at Ohio State 1962 17 45 28 Tennessee 2002 20. 0 27 27 at Chicago 1934
ShutoutsMost Shutouts, Season: 11 - 1901, 1903,
1905Most Shutouts, Season (Since 1939):
5 - 1940, 1947, 1948, 1976Most Consecutive Shutouts (Since
1939): 3 - 1971, 1973, 1980Most Consecutive Games Without a
Shutout: 36, 1960-1964Last Shutout: Minnesota, 58-0, Oct. 1,
2001
Teams shutout the most times by Michigan (Last)
Michigan State ................................29 (2000)Ohio State .........................................27 (1993)Illinois ..................................................21 (1991)Minnesota .........................................21 (2011)Case .....................................................18 (1923)Wisconsin ..........................................17 (1989)Indiana ...............................................16 (2000)Northwestern ...................................14 (1984)Chicago ..............................................12 (1939)Albion .................................................11 (1929)
Shutouts AgainstMost Times Shutout, Season: 5 - 1934Most Times Shutout, Season (Since
1939): 4 - 1962Most Consecutive Games Without
Being Shutout: 300 (October 27, 1984-Present)
Last Time Shutout: at Iowa, 0-26, October 20, 1984
Teams that shutout Michigan the most (Last)
Ohio State .........................................10 (1962)Minnesota .........................................10 (1977)Michigan State .................................. 9 (1967)Pennsylvania ...................................... 6 (1917)Illinois .................................................... 5 (1951)Cornell .................................................. 5 (1911)Northwestern ..................................... 4 (1951)Harvard................................................. 4 (1914)Chicago ................................................ 3 (1934)
TiesYears with the most ties3 - 1910, 19922 - 1911, 1963, 1975
Teams tied most often (Last)Ohio State ........................................... 6 (1992)Michigan State .................................. 5 (1963)Iowa ....................................................... 4 (1988)Minnesota ........................................... 3 (1950)Illinois .................................................... 2 (1992)Pennsylvania ...................................... 2 (1915)Northwestern ..................................... 2 (1946)
Highest Scoring Tie: 22-22, vs. Illinois, November 14, 1992
Last Scoreless Tie: 0-0, vs. Northwestern, November 12, 1938
Consecutive Ties: Happened Twice vs. Illinois (22-22) and Ohio State (13-
13), November 14 and 21, 1992 vs. Stanford (19-19) and Baylor (14-
14), September 20 and 27, 1975Most Games Between Ties: 123, 1975-
1985
WOLVERINE STREAKS AND PEAKS
Top Performances By Half (since 1969)
Rushing, 1st Half329 yards, vs. Indiana, 1975327 yards, vs. Michigan State, 1975300 yards, vs. Northwestern, 1975294 yards, vs. Indiana, 1971293 yards, vs. Minnesota, 1974286 yards, vs. Virginia, 1971274 yards, vs. Iowa, 1969272 yards, vs. Wisconsin, 1988268 yards, vs. Iowa, 1970265 yards, vs. Indiana, 1973
Rushing, 2nd Half312 yards, vs. Iowa, 1971287 yards, vs. Mississippi, 1991283 yards, vs. Wisconsin, 1977276 yards, vs. Stanford, 1976276 yards, vs. Iowa, 1976273 yards, vs. Northwestern, 1975273 yards, vs. Wisconsin, 1979262 yards, vs. Iowa, 1992261 yards, vs. Minnesota, 1970256 yards, vs. Northwestern, 1978256 yards, vs. Hawaii, 1986
Passing, 1st Half262 yards, vs. Illinois, 2010228 yards, vs. Indiana, 2000225 yards, vs. Purdue, 1985224 yards, at Iowa, 2003221 yards, vs. North Carolina, 1979218 yards, vs. Washington State, 1993213 yards, at Northwestern, 2003205 yards, vs. Northwestern, 1992203 yards, vs. Northwestern, 1982201 yards, vs. Indiana, 1985
Passing, 2nd Half316 yards, at Oregon, 2003303 yards, at Minnesota, 2003292 yards, vs. Alabama, 2000290 yards, vs. Notre Dame, 2011266 yards, vs. Virginia, 1995247 yards, at Michigan State, 1999239 yards, vs. Purdue, 1984236 yards, at Ohio State, 1998202 yards, vs. Penn State, 1995196 yards, vs. Minnesota, 1995190 yards, vs. Minnesota, 1994
Total Yards, 1st Half442 yards vs. Delaware State, 2009428 yards vs. Bowling Green, 2010412 yards, vs. Wisconsin, 1988396 yards, vs. Northwestern, 1991394 yards, vs. Illinois, 2010384 yards, vs. Minnesota, 2011371 yards, vs. Northwestern, 1982371 yards, vs. Indiana, 1975366 yards, vs. Minnesota, 1983364 yards, vs. Iowa, 1969356 yards, vs. UCLA, 1990
Total Yards, 2nd Half442 yards, vs. Mississippi, 1991396 yards, vs. Minnesota, 1994391 yards, vs. Wisconsin, 1979386 yards, at Minnesota, 2003370 yards, vs. Iowa, 1971366 yards, vs. Hawaii, 1986362 yards, vs. Notre Dame, 2011349 yards, vs. Minnesota, 1995346 yards, vs. Purdue, 1984339 yards, vs. Navy, 1976327 yards, vs. Iowa, 1992
Longest Scoring DrivesBy Number of Plays (since 1974)
22 Duke ...............................Sept. 17, 197719 Wisconsin ......................... Nov. 8, 198019 Indiana ...........................Sept. 29, 198419 Wisconsin .......................Nov. 15, 199719 Indiana .............................Oct. 24, 199819 at Ohio State (FG) .......Nov. 23, 200219 Notre Dame .................Sept. 13, 200319 Connecticut ................... Sept. 4, 201018 Indiana .............................Oct. 14, 200018 Ohio State ......................Nov. 22, 200317 Indiana .............................Oct. 23, 197617 Michigan State ..............Oct. 14, 197817 Michigan State ................ Oct. 8, 198317 Minnesota ........................ Nov. 1, 199717 Rice .................................... Sept. 9, 200016 Minnesota ........................ Nov. 1, 197516 Purdue .............................Nov. 18,197816 Wisconsin ......................Sept. 22, 198416 Indiana ...........................Sept. 29, 198416 Michigan State ..............Oct. 11, 198616 Michigan State ..............Oct. 10, 199216 Colorado........................Sept. 14, 199616 Baylor .............................Sept. 20, 199716 Northwestern ................Oct. 11, 199716 Eastern Michigan .......Sept. 19, 199816 Wisconsin .......................Nov. 16, 200216 at Ohio State (FG) .......Nov. 23, 200216 Western Michigan ........ Sept. 3, 201116 at Illinois ..........................Oct. 16, 200415 Wisconsin ......................Sept. 13, 197515 Notre Dame .................Sept. 23, 197815 Duke ...............................Sept. 30, 197815 Wisconsin ......................... Nov. 8, 198015 Ohio State ......................Nov. 20, 198215 Purdue .............................. Nov. 5, 198315 Minnesota ......................Nov. 10, 198415 Notre Dame .................Sept. 14, 198515 Iowa ..................................Oct. 15, 198815 Northwestern ................Oct. 29, 198815 UCLA ...............................Sept. 22, 199015 Illinois ..............................Nov. 16, 199115 Illinois ..............................Nov. 16, 199115 Illinois ...............................Oct. 23, 199315 Illinois ...............................Oct. 23, 199915 at Purdue .......................... Oct. 7, 200015 Miami of Ohio ............... Sept. 1, 200115 Purdue .............................Oct. 13, 200115 Purdue .............................Oct. 13, 200115 at Northwestern ..........Nov. 15, 200315 at Penn State .................Oct. 30, 2010
By Yards (since 1974)99 Minnesota ......................Nov. 10, 198499 South Carolina ............Sept. 21, 198599 Iowa ..................................Oct. 15, 198899 Notre Dame .................Sept. 11, 199399 Eastern Michigan ........... Oct. 6, 200798 at Oregon ......................Sept. 20, 200398 at Michigan State ........... Oct. 1, 200598 at Wisconsin ..................Nov. 10, 200798 at Notre Dame ............Sept. 11, 201097 Stanford .........................Sept. 18, 197697 Iowa .................................... Oct. 5, 199197 Washington State ........ Sept. 4, 199397 Eastern Michigan .......Sept. 17, 201196 Michigan State ................ Oct. 6, 197996 at Michigan State ........... Oct. 9, 199996 Rice .................................... Sept. 9, 200096 Connecticut ................... Sept. 4, 201095 Wisconsin ......................... Nov. 3, 197995 Ohio State ......................Nov. 20, 199395 Michigan State ..............Oct. 25, 199795 at Washington ............... Sept. 1, 200194 Stanford ............................. Oct. 5, 197494 Illinois ...............................Oct. 23, 199394 Massachusetts .............Sept. 18, 201094 Bowling Green ............Sept. 25, 201093 Indiana .............................. Nov. 2, 197493 Minnesota ........................ Nov. 1, 199793 Florida .................................Jan. 1, 200892 Illinois ................................ Nov. 9, 197492 Wisconsin ......................Sept. 12, 198192 Southern California ........Jan. 1, 198992 Purdue .............................. Nov. 2, 199192 Purdue .............................Oct. 31, 199292 Baylor .............................Sept. 20, 199792 Baylor .............................Sept. 20, 199792 Michigan State ..............Oct. 21, 200091 Indiana .............................Oct. 28, 198991 Wisconsin .......................... Oct. 6, 1990
91 Penn State .....................Nov. 18, 199591 at Wisconsin .................Sept. 25, 199991 at Illinois ..........................Oct. 16, 200491 Bowling Green ............Sept. 25, 2010
By Time of Possession (since 1978)10:25 Notre Dame ..............Sept. 13, 2003 10:01 Indiana .......................Sept. 29, 1984 9:56 Indiana .........................Oct. 24, 1998 9:06 Wisconsin ..................... Nov. 8, 1980 8:51 Michigan State ............ Oct. 8, 1983 8:43 Wisconsin ...................Nov. 16, 2002 8:33 Western Michigan .... Sept. 3, 2011 8:39 Illinois ...........................Oct. 23, 1993 8:24 at Ohio State (FG) ....Nov. 23, 2002 8:21 Wisconsin ..................... Nov. 8, 1980 8:11 Michigan State ..........Oct. 14, 1978 8:05 Connecticut ................ Sept. 4, 2010 8:04 Colorado ....................Sept. 14, 1996 8:02 Indiana .........................Oct. 14, 2000 8:01 Purdue ........................... Nov. 5, 1983 7:56 Michigan State ..........Oct. 11, 1986 7:48 Purdue ........................... Nov. 5, 1994 7:48 Purdue ..........................Oct. 13, 2001 7:39 Purdue .........................Nov. 18, 1978 7:35 Minnesota ..................Nov. 10, 1984 7:34 Northwestern .............Oct. 29, 1988 7:23 Wisconsin ...................Nov. 15, 1997 7:22 Illinois ..........................Nov. 16, 1991 7:15 Penn State .................... Nov. 7, 1998 7:13 Wisconsin ..................Sept. 22, 1984 7:13 Baylor ..........................Sept. 20, 1997 7:12 E. Michigan ...............Sept. 19, 1998 7:12 Michigan State ............ Oct. 7, 2006 7:08 Florida State .............Sept. 27, 1986 7:07 Wisconsin ...................... Oct. 5, 1985 7:05 Indiana ........................... Oct. 3, 1981 7:04 Ohio State ..................Nov. 22, 2003 7:03 Ohio State ..................Nov. 20, 1982 7:03 Michigan State ..........Oct. 10, 1992 7:02 Notre Dame ..............Sept. 14, 1985 7:01 at Purdue ....................... Oct. 7, 2000 7:00 Penn State ...................Oct. 16, 1993 7:00 Notre Dame ..............Sept. 23, 1978 7:00 Minnesota ...................Oct. 31, 1998
Overtime GamesSince 1997
Games: 7Record: 6-1Home: 3-0 / Away: 2-1 / Neutral: 1-0Orange Bowl vs. Alabama, Jan. 1, 200035-34 Victory 1 OT (28-28 regulation tie)25-yard TD catch by Shawn Thompson
(Hayden Epstein PAT); Alabama scored TD but missed PAT
Penn State, Oct. 12, 200227-24 Victory, 1 OT (21-21 regulation tie)Held PSU to a field goal; Chris Perry scored
on a 3-yard run for the winMichigan State, Oct. 30, 200445-37 Victory, 3 OTs (27-27 regulation tie)24-yard TD catch by Braylon Edwards
and two-point conversion by Tim Massaquoi in third overtime; Michigan State was unable to answer and game ended on fourth-down incompletion
at Michigan State, Oct. 1, 200534-31 Victory, 1 OT (31-31 regulation tie)MSU missed a 37-yard field goal attempt;
Garrett Rivas converted on a 35-yard field goal attempt for the win
at Iowa, Oct. 22, 200523-20 Victory, 1 OT (17-17 regulation tie)Iowa kicked a 28-yard field goal; Jerome
Jackson scored on a one-yard run for the win
at Michigan State, Oct. 3, 200926-20 Loss, 1 OT (20-20 regulation tie)Tate Forcier's third-down pass is intercept-
ed in the end zone; Larry Caper scored on a 23-yard run for the victory
Illinois, Nov. 6, 201067-65 Win, 3 OTs (45-45 regulation tie)
1
Michigan's Bowl History(Pre-Sugar Bowl)
MICHIGAN’S BOWL HISTORY2
Michigan’s Bowl HistoryResults (Won 19, Lost 21)
Date Bowl Rank* Opponent W/L Score CoachJan. 1, 1902 Rose Stanford W 49-0 Fielding YostJan. 1, 1948 Rose 2 / 8 Southern California W 49-0 Fritz CrislerJan. 1, 1951 Rose 9 / 5 California W 14-6 Bennie OosterbaanJan. 1, 1965 Rose 4 / 8 Oregon State W 34-7 Bump ElliottJan. 1, 1970 Rose 7 / 5 Southern California L 3-10 Bo Schembechler (1)Jan. 1, 1972 Rose 4 / 16 Stanford L 12-13 Bo SchembechlerJan. 1, 1976 Orange 5 / 3 Oklahoma L 6-14 Bo SchembechlerJan. 1, 1977 Rose 2 / 3 Southern California L 6-14 Bo SchembechlerJan. 2, 1978 Rose 4 / 13 Washington L 20-27 Bo SchembechlerJan. 1, 1979 Rose 5 / 3 Southern California L 10-17 Bo SchembechlerDec. 28, 1979 Gator 14 / - North Carolina L 15-17 Bo SchembechlerJan. 1, 1981 Rose 5 / 16 Washington W 23-6 Bo SchembechlerDec. 31, 1981 Bluebonnet 16 / 19 UCLA W 33-14 Bo SchembechlerJan. 1, 1983 Rose 19 / 5 UCLA L 14-24 Bo SchembechlerJan. 2, 1984 Sugar 8 / 3 Auburn L 7-9 Bo SchembechlerDec. 21, 1984 Holiday - / 1 Brigham Young L 17-24 Bo SchembechlerJan. 1, 1986 Fiesta 5 / 8 Nebraska W 27-23 Bo SchembechlerJan. 1, 1987 Rose 4 / 7 Arizona State L 15-22 Bo SchembechlerJan. 2, 1988 Hall of Fame - / - Alabama W 28-24 Bo Schembechler (2)Jan. 2, 1989 Rose 11 / 5 Southern California W 22-14 Bo SchembechlerJan. 1, 1990 Rose 3 / 12 Southern California L 10-17 Bo SchembechlerJan. 1, 1991 Gator 12 / 15 Mississippi W 35-3 Gary MoellerJan. 1, 1992 Rose 4 / 2 Washington L 14-34 Gary MoellerJan. 1, 1993 Rose 7 / 9 Washington W 38-31 Gary MoellerJan. 1, 1994 Hall of Fame 23 / - North Carolina State W 42-7 Gary MoellerDec. 30, 1994 Holiday 20 / 10 Colorado State W 24-14 Gary MoellerDec. 28, 1995 Alamo 14 / 19 Texas A&M L 20-22 Lloyd CarrJan. 1, 1997 Outback 15 / 16 Alabama L 14-17 Lloyd CarrJan. 1, 1998 Rose 1 / 8 Washington State W 21-16 Lloyd CarrJan. 1, 1999 Citrus 15 / 11 Arkansas W 45-31 Lloyd CarrJan. 1, 2000 Orange 8 / 5 Alabama W 35-34 OT Lloyd CarrJan. 1, 2001 Citrus 17 / 20 Auburn W 31-28 Lloyd CarrJan. 1, 2002 Citrus 17 / 8 Tennessee L 17-45 Lloyd CarrJan. 1, 2003 Outback 12 / 22 Florida W 38-30 Lloyd CarrJan. 1. 2004 Rose 4 / 1 Southern California L 14-28 Lloyd CarrJan. 1, 2005 Rose 13 / 6 Texas L 37-38 Lloyd CarrDec. 28, 2005 Alamo 20 / - Nebraska L 28-32 Lloyd CarrJan. 1, 2007 Rose 3 / 8 Southern California L 18-32 Lloyd CarrJan. 1, 2008 Capital One - / 9 Florida W 41-35 Lloyd CarrJan. 1, 2010 Gator - / 21 Mississippi State L 14-52 Rich Rodriguez* Ranking from Associated Press (U-M followed by opponent).1 - The night before the 1970 Rose Bowl, Schembechler suffered a heart attack, which kept him in a hospital during the game. Defensive coordinator Jim Young assumed the coaching responsibilities for the game.2 - Offensive coordinator Gary Moeller assumed coaching responsibilities as Schembechler remained in Ann Arbor after having quadruple heart bypass surgery in early December.
Bowl Appearances & RecordBowl Games W L YearsAlamo 2 0 2 1995, 2005Bluebonnet 1 1 0 1981Capital One (Citrus) 4 3 1 1999, 2001, 2002, 2008Fiesta 1 1 0 1986Gator 3 1 2 1979, 1991, 2010Hall of Fame (Outback) 4 3 1 1988, 1994, 1997, 2003Holiday 2 1 1 1984, 1994Orange 2 1 1 1976, 2000Rose 20 8 12 1902, 1948, 1951, 1965,
1970, 1972, 1977, 1978, 1979, 1981, 1983, 1987, 1989, 1990, 1992, 1993, 1998, 2004, 2005, 2007
Sugar 1 0 1 1984Total 38 18 20
3BOWL GAME HISTORY
Bowl Game Honors
Chris Perry, 2003 Outback Bowl Most Valuable Player
PlayerName Year*Bump Elliott 1989Neil Snow 1990Bob Chappuis 1992Butch Woolfolk 1998Mel Anthony 2002
CoachName Year*Bo Schembechler 1993
*denotes year inducted
Rose Bowl Hall of Fame
Mel Anthony, 2002 Rose Bowl Hall of Fame Inductee
Individual Bowl Game MVPs/Player(s) of the Game
Bowl Name Award1902 Rose Bowl Neil Snow, FB Player of the Game1948 Rose Bowl Bob Chappuis, HB Player of the Game1951 Rose Bowl Don Dufek, FB Player of the Game1965 Rose Bowl Mel Anthony, FB Player of the Game1979 Rose Bowl Rick Leach, QB Co-Player of the Game 1979 Gator Bowl John Wangler, QB & Anthony Carter, WR Michigan Co-Players of the Game1981 Rose Bowl Butch Woolfolk, TB Player of the Game1981 Bluebonnet Bowl Butch Woolfolk, TB Most Valuable Player1986 Fiesta Bowl Jamie Morris, TB Offensive Player of the Game1986 Fiesta Bowl Mark Messner, DL Defensive Player of the Game1988 Hall of Fame Bowl Jamie Morris, TB Most Valuable Player1989 Rose Bowl Leroy Hoard, FB Player of the Game1991 Gator Bowl Michigan's Offensive Line Most Outstanding Players (Dean Dingman, Tom Dohring, Greg Skrepenak, Matt Elliott, Steve Everitt)1993 Rose Bowl Tyrone Wheatley, RB Player of the Game1994 Hall of Fame Bowl Tyrone Wheatley, RB Most Valuable Player1994 Holiday Bowl Todd Collins, QB Most Valuable Player1998 Rose Bowl Brian Griese, QB Most Valuable Player1999 Citrus Bowl Anthony Thomas, RB Most Valuable Player, Offensive MVP Sam Sword, ILB Michigan Defensive MVP2000 Orange Bowl David Terrell, WR Most Valuable Player2001 Citrus Bowl Anthony Thomas, RB Most Valuable Player, Offensive MVP Eric Wilson, DL Michigan Defensive MVP2002 Citrus Bowl B.J. Askew, RB Michigan Offensive MVP Larry Foote, ILB Michigan Defensive MVP2003 Outback Bowl Chris Perry, RB Most Valuable Player2005 Rose Bowl LaMarr Woodley, DE/OLB Defensive Player of the Game2005 Alamo Bowl Leon Hall, CB Defensive Most Valuable Player Steve Breaston, WR/KR/PR Fred Jacoby Sportsmanship Award2008 Capital One Bowl Chad Henne, QB Most Valuable Player
Each year, the Big Ten champion earns the right to represent the conference against the Pacific-10 champion in the oldest bowl game in college football, the Rose Bowl. The 2007 contest will mark the 93rd Rose Bowl game. However, starting in 1998, due to the Bowl Championship Series, the Big Ten or Pac-10 representative may or may not be committed to the Rose Bowl if they are ranked either first or second nationally in the BCS Poll. The Big Ten and Pac-10 champions will meet if neither is playing for the national championship. In 2002, the Rose Bowl hosted the national title game featuring No. 1 Miami and No. 2 Nebraska, with the Hurricanes winning the national title. The 2006 game was also the national title game, with Texas upsetting the top-ranked USC Trojans for the national title.
The Rose Bowl game had featured Big Ten and Pac-10 teams since 1946, with the 55-year tradition being the longest of any conference bowl association.
The Rose Bowl arose out of quiet beginnings in Pasadena, Calif., a growing Southern California city of fewer than 5,000 people. Most of those who inhabited Pasadena at that time were transplants from the East and Midwest, where the winters were filled with cold temperatures and snow. In late 1889, one of the town’s leading citizens proposed to a group of fellow Valley Hunt Club members that it would be nice to have a small parade and display of athletic competitions on New Year’s Day. Remembering their times back East, the natives were anxious to show off the warm climate and draw tourists.
The original parade was a line of flower-adorned carriages, and the games consisted of foot races, a tug of war, jousts and a greased pig catching contest. The citizenry was pleased with the events, but the major problem of the next decade were a shortage of roses in 1892 and, a rule allowing women to wear split skirts (thereby allowing them to sit astride a horse when riding) in 1893.
By 1900, the Tournament of Roses committee began looking into secur-ing a sports attraction that would grab national interest. In 1901, the suggestion was made to invite two college football teams to compete
THE ROSE BOWL4
The Rose Bowl
in the postseason celebration. Michigan, “The Champion of the West” at 10-0, was selected to take on Pacific champion Stanford. For Michigan coach Fielding Yost, it was a dose of revenge, as he had been ousted from the Stanford coaching ranks in 1900 by a new rule that allowed only Stanford graduates to coach the team. Yost’s men blasted Stanford on Jan. 1, 1902, 49-0, in a game that was stopped with nine minutes remaining because of the immense score.
The final score led tournament officials to discontinue the football portion of the Tournament of Roses after that game, and settled on vari-ous other events to entertain the crowd. Polo took the game’s place in 1903, and after the committee’s pres-ident read “Ben-Hur” was replaced by chariot racing in 1904. After a chariot accident the previous year, two new events were introduced in 1913. A race between a camel and elephant headlined the tournament, followed by an ostrich race. The ostrich race was discontinued after 1913 as one of the jockeys in the race was thrown from his mount, and in an effort to capture the stray bird, was kicked across the track.
In 1915, Tournament of Roses Committee President Lewis Turner stated, “We better go back to foot-ball so we can give newspapermen from coast to coast something to
write about.” Washington State defeated Brown, 14-0 on Jan. 1, 1916 and the game has been going strong ever since.
Until 1923, the Tournament of Roses Committee selected the two teams that would compete in the New Year’s Day classic. From 1923-46, the West Coast representative was allowed to choose its Eastern opponent. The Big Ten sent a repre-sentative in 1921, when Ohio State lost to California, 28-0. However, fol-lowing the season, the Big Ten estab-lished a ban on postseason football games — a rule that lasted 26 years.
The Big Ten lifted the post-season ban Sept. 1, 1946, and a five-year pact was signed between the Big Ten and Pac-10 allowing Illinois to play UCLA in the 1947 Rose Bowl.
The agreement has been renewed several times since, including Big Ten decisions in 1951 and 1974 to allow a team to go to the Rose Bowl more than once every three years and two years, respectively.
The national and international awareness and attention given to the Rose Bowl is unequalled. Approximately 425 million television viewers worldwide watch the Rose Parade each year and more than 164 million people around the world view the game.
Michigan has participated in 19 Rose Bowl games and has won eight times, both numbers being the high-est of any Big Ten school.
Rose Bowl Stadium — Site of the “Granddaddy” of all bowl games. The University of Michigan and the University of Southern California played in the 75th Rose Bowl on Jan. 2, 1989.
The University of Michigan has made 19 trips to Pasadena to play in the Rose Bowl, beginning with the first one in 1902.
A polo match as the sporting highlight of the Tournament of Roses Parade in Pasadena had been satisfac-tory, but something more dramatic was needed in 1902. “Why not a foot-ball game?’’ offered one member of the committee, and immediately Tour nament President James Wagner started a series of correspondence with the “best team in the West’’—Fielding H. Yost’s Michi gan team.
Michigan was invited to play on January 1, 1902, against Stanford, champion of the “Pacific Coast Universities.’’ The Wolverines left Ann Arbor on Dec. 17 with temperatures below freezing and six inches of snow on the ground. Eight days later, Michigan arrived in Los Angeles and was greeted by 80-plus degrees and newspaper reports listing several rea-sons why Stanford should win.
New Year’s morning found the
5BOWL GAME HISTORY
Bowl Game Summaries
Michigan team outfitted in new uniforms with colorful Michi gan banners, riding a large carriage in the Rose Parade. Thousands jammed the parade route, and following the parade Pasadena experienced its larg-est traffic snarl ever as fans headed for the football grounds.
The city was a riot of color—mostly blue and gold, for by a strange coin-cidence, blue and gold were adopted as the year’s official colors of the Tournament. The color combination so closely resembled Mich i gan’s colors that some of the Stanford faithful, a bit miffed by what they thought was a show of support for their opponents, began to tear down the banners and streamers.
The crowd of 8,000 stormed Tournament Park, and the first 2,500 who arrived ran for the highest priced reserved seats. The rest, even
those holding tickets to the reserved section, were forced to stand on the dusty sidelines throughout the contest.
The game opened with a blistering sun moving the temperatures into the mid-80’s. The teams lined up at 2:57 p.m., and with Michigan defending the south goal, the Wolverines’ Everett Sweeley kicked off to open the first bowl game.
Stanford appeared every bit as capable as the papers reported, turn ing back the powerful Michi gan offense, time and again, early in the contest. In fact, the game’s first score did not come until 23 min utes into the first half. After a series of short gains moved the ball to the Stanford 30, halfback Wil lie Heston broke loose on a naked bootleg and picked up 21 yards on the first “big’’ play in Rose Bowl history. Three plays later, fullback Neil Snow bulled through the tir-ing Stanford line from the six. Bruce Shorts added the PAT to give Michigan a 6-0 lead.
Soon after Sweeley booted a 20-yard field goal, Michigan’s Chris Redden returned a weak Stanford punt 25 yards for a TD, giving the Wolverines a 17-0 halftime lead.
Under the sheer power of the Michigan 11, Stanford’s valiant defense began to crumble in the second half. The Wolver ines proved relentless, scoring on nearly every possession.
With eight minutes remaining in the game, Stanford captain Ralph
Fisher approached the Wolverine bench and offered to concede; Michigan consented.
The 49-0 victory capped one of the most unbelievable seasons in college football history, Michigan had out-scored its opponents, 550-0, winning 11 straight games. Willie Heston, too, made believers out of his West Coast critics. He gained 170 yards on 18 car-ries as the Wolverines recorded 527 yards on the ground.
The tournament association, though realizing a profit of $3,161.86, thought the wide difference in the score would make an annual game unappealing to spectators. The fol-lowing year they replaced the football game with a chariot race, and it would be 14 years before the Rose Bowl would again feature a post-parade football game.
The First Rose Bowl Champions
Top row: Left to right—Crafts (Mgr.), Dan McGugin, George Gregory, Fielding H. Yost (Coach), Herb Graver, Athletic Director Charles Baird, trainer Keene Fitzpatrick. Middle row: Ebin Wilson, Neil Snow, Hugh White, Bruce Shorts, Willie Heston. Front row: Everett Sweeley, Boss Weeks, Curtis Redden, Arthur Reddner, Al Herrnstein.
THE LINEUPSMichigan StanfordRedden ..................... LE ....................... PrestonWhite (C) ...................LT ....................... TraegerMcGugin ..................LG ...................RooseveltGregory ..................... C .................................LeeWilson .......................RG ............... ThompsonShorts ........................RT .................McFaddenSweeley ....................RE ........................CooperWeeks .........................Q .......................... TarpeyHeston ......................LH...........................SlakerHerrnstein ...............RH ...................Fisher (C)Snow ............................F ....................McGilvray
SCORINGFirst Half
M Snow, 6-yard run (Shorts kick)M Sweeley, 20-yard field goalM Redden, 25-yard punt return (Shorts
kick)Second Half
M Snow, 2-yard run (kick failed)M Redden, 25-yard fumble return
(Shorts kick)M Snow, 8-yard run (kick failed)M Snow, 17-yard run (kick failed)M Snow, 4-yard run (Shorts kick)M Herrnstein, 21-yard run (kick failed)
Team Stats UM SUFirst Downs 27 5Net Yards Rushing 527 67Rushing Attempts 90 24Punts/Avg 21/38.9 16/34.9Fumbles 1 9
Leading Rushers: Heston (M) 18-170; Snow (M) 107 yards; Herrnstein (M) 97 yards.
Leading Punters: Sweeley (M) 21-819; Fisher (S) 5-160; McFadden (S) 4-119.
Substitutions: Michigan—none.Stanford—Sefton, end; Hannemen, tackle; Van Sickle, guard; Allen, backfield
vs. StanfordPasadena, CaliforniaJanuary 1, 1902Attendance: 8,000
Michigan 17 32 — 49
Stanford 0 0 — 0
1902 Rose Bowl
BOWL GAME SUMMARIES6
three TD passes from three different passers, including tosses of 18 yards from Chappuis, 45 yards from Hank Fonde, and 29 yards from Howard Yerges as Michigan rolled to a 49-0 victory. The score stood as USC’s largest margin of defeat until 1966. In the game, Michigan shattered nine Rose Bowl records and accu-mulated 491 yards to the Trojans’ 133. Jim Brieske’s record of seven PATs remains unbroken.
In a special Associated Press poll following the game, Michigan replaced Notre Dame as the 1947 National Champion by a 226-119 margin.
Led by All-Americans Bob Chappuis and Bump Elliott, Michigan led the nation in total offense (412.7 yards/game) and passing average (173.9 yards/game). Chappuis, runner-up in the Heisman Trophy balloting, was the Big Ten leader in total offense for the sec-ond straight year. Elliott, the team’s only two-way player, was named Most Valuable Player for Michigan and the Big Ten after leading the league in scoring.
When the Wolverines arrived in Pasadena, they were 15-point favor-ites and Crisler felt it was necessary to call a team meeting to stifle over-confidence. Ten minutes into the game, on Michigan’s second posses-sion, Jack Weisenburger spun across the line from the one to cap an 11-play, 64-yard drive and initiate the day’s scoring. In the second quarter, Weisenburger gained another one-yard touchdown, and Chappuis jump-passed to Elliott from the 11-yard line to give the Maize and Blue a 21-0 halftime lead.
In the second half, Weisen burger collected his third touchdown of the game and the Wolverines recorded
vs. SouthernCaliforniaPasadena, CaliforniaJanuary 1, 1948Attendance: 87,516
Michigan 7 14 7 21-49
USC 0 0 0 0- 0
First Quarter M Weisenburger, 1-yard run (Brieske
kick)Second Quarter
M Weisenburger, 1-yard run (Brieske kick)
M Bump Elliott, 11-yard pass from Chappuis (Brieske kick)
Third Quarter M Yerges, 18-yard pass from Chappuis
(Brieske kick)Fourth Quarter
M Weisenburger, 1-yard run (Brieske kick)
M Derricotte, 45-yard pass from Fonde (Brieske kick)
M Rifenburg, 29-yard pass from Yerges (Brieske kick)
Team Stats UM USCFirst Downs 21 10Net Yards Rushing 268 91Net Yards Passing 223 42Total Plays 72 55Total Yards 491 133PA/PC/Int 27/17/1 11/6/1Punts/Avg. 4/38.3 8/43.8Return Yards 60 16Fumbles/Lost 2/1 4/2Penalties/Yards 4/40 1/10
SCORING
Rushing — (M): Chappuis 13-91; Weisenburger 20-91; Ford 2-21; Derricotte 3-8; Peterson 1-4; Elliott 7-53; Yerges 1-0; (SC): Garlin 5-25; Betz 4-16.
Passing — (M): Chappuis 14-24-139; Fonde 1-1-45; Yerges 1-1-29; Derricotte 1-1-10; (SC): Powers 4-5-22; Robertson 1-1-22.
Receiving –- (M): Rifenburg 4-62; Mann 4-55; Yerges 4-29; C. Elliott 2-26; Derricotte 1-45; Hilkene 2-6.
1948 Rose Bowl
In 1950, the Wolverines struggled through the regular season, but won the final game at Ohio State to earn the right to travel to Pasadena. Michigan’s 5-3-1 squad was slated to face the California Golden Bears, a 9-0-1 club rated fourth in the nation and making its third con-secutive Rose Bowl appearance. The Bears were favored to win, and many of the 98,393 fans who filled the stadium had hopes of watching the Pacific Conference end its four-game losing streak.
On the second play of the game, California’s Pete Schabarum ran around the left end 73 yards into the end zone, only to see it nulli-fied on an illegal motion penalty. Cal pounded on the Michigan defense until early in the second quarter when QB Jim Marinos threw a 39-yard scoring strike to Bob Cummings. Les Richter missed the extra point, and California led 6-0. Late in the half, the Bears had moved to the Michigan 11-yard line and appeared ready to bring one more score into the locker-room, but the Wolverines had other plans, stopping Schabarum three yards short of the goal on fourth down.
At halftime, California held a 192-65 advantage in offensive yardage and a 10-2 edge in first downs, but
vs. CaliforniaPasadena, CaliforniaJanuary 1, 1951Attendance: 98,939
Michigan 0 0 0 14-14
California 0 6 0 0- 6
1951 Rose Bowl
the Wolverines instigated a new defensive formation during the intermission. Head coach Bennie Oosterbaan told his troops that “vic-tory is still ours,’’ renewing the team’s faith in Michigan tradition and spirit, and the Wolverines returned to the field primed for victory.
Michigan was held scoreless until the fourth quarter when team MVP Don Dufek ran four identical plays starting from the four-yard line, finally scoring on fourth-and-one. The Wolverines extended their lead later in the quarter as Dufek again scored, this time from seven yards out. Michigan completely reversed Cal’s first half domination by out-dis-tancing the Bears 15-2 in first downs and 226-52 in total yardage during the half as the Wolverines won their third Rose Bowl in as many tries, 14-6.
Second Quarter C Cummings, 39-yard pass from Marinos
(Richter kick failed)Fourth Quarter
M Dufek, 1-yard run (Allis kick)M Dufek, 7-yard run (Allis kick)
Team Stats UM UCFirst Downs 17 12Net Yards Rushing 145 175Net Yards Passing 146 69Total Plays 60 59Total Yards 291 244PA/PC/Int 21/15/2 8/4/0Punts/Avg. 2/32.5 4/35.7Return Yards 21 17Fumbles/Lost 2/2 2/2Penalties/Yards 2/20 6/50
SCORING
Rushing — (M): Dufek 23-113; Koceski 7-19; Ortmann 5-6; Putich 3-4; Bradford 1-2. (C): Olszewski 16-58; Schabarum 15-57; Monachino 12-47; Marinos 3-(-6); Robison 2-10; Pappa 2-13; Ogden 1-(-4).
Passing — (M): Ortmann 15-19-146; Putich 0-1-0; Dufek 0-1-0. (C): Marinos 4-7-69; Scharbarum 0-1-0.
Receiving — (M): Dufek 5-61; Perry 3-29; Koceski 3-18; Pickard 2-24; Allis 1-11; Putich 1-3.
7BOWL GAME HISTORY
Second Quarter OSU McDougal, 5-yard pass from
Brothers (Clark kick)M Anthony, 84-yard run (kick
failed)M Ward, 43-yard run (pass failed)
Third Quarter M Anthony, 1-yard run (Timberlake
run)M Anthony, 7-yard run (Timberlake
kick)Fourth Quarter
M Timberlake, 24-yard run (Timberlake kick)
Team Stats UM OSUFirst Downs 18 14Net Yards Rushing 332 64Net Yards Passing 83 179Total Plays 62 64Total Yards 415 243PA/PC/Int 11/8/0 33/19/0Punts/Avg. 5/33.6 9/43.5Return Yards 133 89Fumbles/Lost 2/1 1/1Penalties/Yards 6/55 5/57
SCORING
Rushing — (M): Anthony 13-123; Ward 10-88; Timberlake 12-57; Fisher 5-30; Detwiler 5-16; Sygar 1-8; Lee 1-5; Wells 1-3; Gabler 1-1; Volk 1-1; Dehlin 1-0. (OSU): Shaw 4-28; Watkins 8-24; Washington 3-15; Queen 4-0; Brothers 12-(-3).
Passing — (M): Timberlake 7-10-77; Evashevski 1-1-6; (OSU): Brothers 9-17-89; Queen 10-16-90
Receiving — (M): Henderson 4-34; Defuller 1-30; Farabee 1-8; Kirby 1-6; Anthony 1-5 (OSU): Moreland 4-29; Watkins 3-43; Grim 3-42; Miller 3-21; Frketich 2-23; Shaw 1-9; McDougal 1-5; Sullivan 1-5; Crowston 1-2.
kicked the extra point for Oregon State’s 7-0 start on its upset bid. Three possessions later, Wolverine tailback Mel Anthony broke free virtually untouched for 84 yards and the score. On the Wolverines’ next possession, Carl Ward rambled 43 yards around the right end to put Michigan in the lead for good. Bob Timberlake’s pass to Ben Farabee was broken up in the end zone, but the Wolverines still held a 12-7 advantage going into the locker room.
Anthony paced the third quarter attack after recovering a blocked Beaver punt, and extending the Wolverine lead with one- and seven-yard scores. Timberlake added a 24-yard TD run down the sideline in the fourth quarter to close the scoring and give Michigan a 34-7 triumph.
Anthony earned Player of the Game kudos for his efforts, and the Wolverines raised their postseason record to four victories against no losses.
After finishing no higher than fifth in the Big Ten during the previous seven years, all the pieces finally fell into place for the 1964 Wolverines. Air Force and Navy were forced to the air in the first two games, throw-ing a combined total of 75 passes. Michigan then ran off six victories in seven Big Ten games, dropping a one-point contest to Purdue, and shutting out Northwestern and Ohio State. The Wolverines’ 8-1 record earned them the conference cham-pionship, and the team headed to Pasadena, breaking a drought of 14 years.
After USC upset top-ranked Notre Dame in the regular-season finale, it appeared that the Trojans would be Michigan’s New Year’s Day opponent. However, the Pac Eight Conference instead ruled in favor of the Oregon State Beavers, who had tied Southern Cal for the conference lead. The fourth-ranked Wolverines were installed as 11-point favorites over the eighth-ranked Beavers as Oregon State brought an 8-2 mark into the game.
After a scoreless first quarter, the Beavers broke open the scor-ing with a five-yard pass from Paul Brothers to Doug McDougal early in the second period. Steve Clark
vs. OregonStatePasadena, CaliforniaJanuary 1, 1965Attendance: 100,243
Michigan 0 12 15 7-34
OSU 0 7 0 0- 7
1965 Rose Bowl
In Bo Schembechler’s debut at Michigan Stadium, the Wol verines outrushed Vanderbilt 367-55 en route to a 42-14 triumph, begin-ning a new era in Michigan football. Heading into the season’s final game, the 7-2 Wolverines were slated to meet the top-ranked and undefeated Ohio State Buckeyes. Michigan responded by pounding out 266 yards on the ground and 108 through the air, while intercept-ing six Buckeye passes before the largest crowd ever to see a college football game up to that date. It also snapped OSU’s 22-game win-ning streak, and earned U-M the Big Ten’s Rose Bowl berth.
Facing the Wolverines in Pasadena was the University of Southern California. The Trojans compiled a 9-0-1 record and were ranked fourth in the polls. USC, coached by John McKay, was led by Pac Eight rushing leader Clarence Davis. The 1970 game marked the fourth consecutive Rose Bowl appearance for the Trojans.
Fate was not with the Wolverines from the beginning of their California trip. While running in practice out on the coast, Glenn Doughty, Michi gan’s second-lead-ing rusher, injured his knee and was forced to undergo surgery. Then, the night before the game,
First QuarterUSC Ayala, 25-yard field goal
Second Quarter M Killian, 20-yard field goal
Third Quarter USC Chandler, 33-yard pass from Jones
(Ayala kick)
Team Stats UM USCFirst Downs 20 16Net Yards Rushing 162 195Net Yards Passing 127 128Total Plays 85 70Total Yards 289 323PA/PC/Int 32/14/1 17/10/0Punts/Avg. 6/36.2 5/40.6Return Yards 56 75Fumbles/Lost 1/0 2/0Penalties/Yards 2/20 6/38
SCORING
Rushing — (M): Moorhead 18-60; Taylor 18-56; Scheffler 9-29; Craw 6-15; (USC): Davis 15-76; Berry 23-65; Evans 6-28; Jones 7-17.
Passing — (M): Moorhead 14-32-127; (USC): Jones 10-17-128.
Receiving — (M): Mandich 8-79; Oldham 2-19; Harris 1-12; Hankwitz 1-7; B. Taylor 1-6; Craw 1-4; (USC): Chandler 3-78; Debrah 3-27; Evans 3-15; Davis 1-8.
1970 Rose Bowl
Schembechler suffered a heart attack which kept him off the sideline and in the hospital during the contest. Defensive coordinator Jim Young assumed the coaching responsibilities for the game, but the players were unable to shake off their discouragement by kickoff time.
Southern Cal opened the scoring in the first quarter with a 25-yard field goal by Ron Ayala. Michigan added a field goal of its own two possessions later as Tim Killian nailed one from 20 yards out, giv-ing the teams a 3-3 deadlock at halftime.
On third down with six yards to go late in the third quarter, Trojan quarterback Jimmy Jones hit Bob Chandler 13 yards downfield. Chandler broke several Wolverine tackles, scampered another 20 yards, and gave USC its margin of victory. Michigan saw fourth quarter drives stall at the Trojan 13, nine, and finally the 38 as time ran out, and returned to Ann Arbor with its first post- season defeat ever.
vs. Southern CaliforniaPasadena, CaliforniaJanuary 1, 1970Attendance: 103,878
Michigan 0 3 0 0- 3
USC 3 0 7 0-10
BOWL GAME SUMMARIES8
Facing fourth down on its own 33-yard line, Stanford used a fake punt to spring Brown for a 31-yard gain. Several plays later, Brown again broke free, this time for 24 yards and the score that tied the contest at 10 apiece. Minutes later, when Coin’s 42-yard field goal attempt fell short, Indian Jim Ferguson caught and intended to return the ball, but Ed Shuttlesworth dropped him in the end zone to give Michigan two points on the safety and a 12-10 advantage. Following a Michigan punt, the Indians took over on their 22-yard line, and Bunce proceeded to complete five of his next six passes to move his squad down the field. With 16 seconds remaining in the game, Ralston sent Garcia in for one final play. The kick sailed 31 yards straight over the crossbar, and Stanford claimed a narrow victory, 13-12, on the 70th anniversary of their stunning loss to U-M in the first Rose Bowl game.
By 1971, Bo had the foundation in place for a Big Ten dynasty. After stopping the Buckeyes, 10-7, in the regular season finale Michigan completed its first undefeated and untied season since 1948 and prepared to meet Stanford in Pasadena.
Stanford entered the contest with an impressive 8-3 record despite the loss of Heisman Trophy winner Jim Plunkett to graduation the previous spring. John Ralston’s Indians thrived on the talents of quarterback Don Bunce and run-ning back Jackie Brown.
Dana Coin made a 30-yard field goal in the second quarter to produce the only points scored by either team in the first half. When the gun sounded after 30 minutes, Michigan held a 3-0 edge as they left the soggy Rose Bowl turf for the locker room.
Stanford egressed from the lock-er room to start the third period and held the Wolverines inches short of the game’s first touchdown with a dramatic goal line stand. The Indians gained control of the ball and marched down the field where soccer-style kicker Rod Garcia added a field goal of his own, this one from 42 yards away. Early in the fourth quarter, Michigan full-back Fritz Seyferth plunged across from the one-yard line, and the Wolverines regained the lead, 10-3.
vs. StanfordPasadena, CaliforniaJanuary 1, 1972Attendance: 103,154
Michigan 0 3 0 9-12
Stanford 0 0 3 10-13
Second Quarter M Coin, 30-yard field goal
Third Quarter S Garcia, 42-yard field goal
Fourth Quarter M Seyferth, 1-yard run (Coin kick)S Brown, 24-yard run (Garcia kick)M Safety-Ferguson tackled in end zone by ShuttlesworthS Garcia, 31-yard field goal
Team Stats UM SUFirst Downs 16 22Net Yards Rushing 264 93Net Yards Passing 26 290Total Plays 85 67Total Yards 290 383PA/PC/Int 11/3/1 44/24/0Punts/Avg. 7/38.9 4/41.5Return Yards 122 65Fumbles/Lost 2/1 4/4Penalties/Yards 2/23 3/14
SCORING
Rushing— (M): W. Taylor 32-82; Shuttlesworth 13-62; Slade 13-41; Doughty 11-56; (S): Brown 6-60; Winesberry 4-15; Sanderson 5-16.
Passing— (M): Slade 3-10-26; Cipa 0-1-0; (S): Bunce 24-44-290
Receiving— (M): Doughty 2-13; Seymour 1-13; (S): Winesberry 8-112; Scott 5-55; Brown 5-30; Moore 3-52; Sanderson 3-45
1972 Rose Bowl
Under pressure from the confer-ence coaches, led by Michigan’s Bo Schembechler, the Big Ten finally lifted its long-standing policy of lim-iting post-season games to only the Rose Bowl. As a consequence, once the Wolverines lost their only regu-lar-season game to top-ranked Ohio State, Michigan accepted an invita-tion to meet the Oklahoma Sooners in Miami’s Orange Bowl.
The fourth-ranked Wolverines left for Miami armed with Gordie Bell, who led the nation’s second-leading rushing team with 121.4 yards per game, and under the guidance of freshman field general Rick Leach. Oklahoma came in as defending Associated Press National Champions despite making its first postseason appearance since 1972, due to two years of NCAA and Big Eight probation. The Sooners’ 10-1 record placed them second in both wire service polls, and they marked Mich igan’s first experience against a wishbone offense since meeting UCLA three years earlier.
The first quarter was a defensive battle, with the Wolverines putting together the only substantial drive, starting at the Michigan five-yard line and stalling at the Oklahoma 38. Following Bob Wood’s attempt-ed 51-yard field goal, the Sooners opened the scoring with succes-sive passes of 40 yards from Steve
Second Quarter O Brooks, 39-yard run (DiRienzo kick)
Fourth Quarter O Davis, 9-yard run (DiRienzo kick)M Bell, 2-yard run (Leach run failed)
Team Stats UM OUFirst Downs 12 16Net Yards Rushing 169 282Net Yards Passing 33 63Total Plays 72 70Total Yards 202 345PA/PC/Int 20/2/3 5/3/0Punts/Avg. 10/38.6 9/34.9Return Yards 52 16Fumbles/Lost 1/0 4/3Penalties/Yards 5/24 9/90
SCORING
Rushing— (M): Leach 13-62; G. Bell 18-53; Lytle 10-32; J. Smith 5-18; Elzinga 6-4; (O): Washington 17-73; Culbreath 11-63; Davis 19-55; Brooks 1-39; Littrell 11-28; Peacock 6-24
Passing— (M): Leach 2-15-33; Elzinga 0-4-0; G. Bell 0-1-0; (O): Davis 3-5-63
Receiving— (M): G. Bell 1-17; K. Johnson 1-16; (O): T. Owens 3-63
vs. OklahomaMiami, FloridaJanuary 1, 1976Attendance: 80,307
Michigan 0 0 0 6- 6
Oklahoma 0 7 0 7-14
1976 Orange Bowl
Davis to Tinker Owens and a 39-yard reverse by Billy Brooks for the score.
The Wolverines drove as far as the Oklahoma nine-yard line in the third quarter, before being thwarted by a pass interception in the end zone. On the first play of the fourth quar-ter, Davis ran 10 yards around the left end to increase the Sooner lead to 14-0. Michigan finally got on the scoreboard following an Okla homa fumble on its own two. Bell carried it over on the next play, but Leach’s two-point conversion attempt was stopped. The Wolverines were only able to make it as far as midfield for the duration of the game, and the Sooners went on to a 14-6 victory.
Oklahoma was led by the defen-sive efforts of Leroy and Dewey Selmon (10 and 13 tackles, respec-tively) and, following Ohio State’s 23-10 loss in the Rose Bowl to UCLA, was named national champion in both polls. Leroy Selmon went on to become the first draft choice in the NFL college draft later that spring.
9BOWL GAME HISTORY
play with 1:28 left in the quarter. The conversion was good, and USC held a 7-6 advantage at the half.
The game returned to the defenses in the second half. The Wolverines tallied just four first downs, and the Trojans used a relentless ground game to grind their way deep into Michigan territory in the fourth quarter. White scored on a seven-yard run with three minutes to go, but the Wolverines made it close by charg-ing back to the USC 17 before run-ning out on downs in the closing seconds.
Bell, the top pick in the 1977 NFL draft, left the game early in the first quarter with a head injury and was replaced by the freshman White, who went on to win the Heisman Trophy three seasons later. The game also marked Lytle’s last in a Wolverine uniform as he led all Michigan rushers with 67 yards to up his then school record to 3,317 yards. USC finished No. 2 in the final football polls behind the Pittsburgh Panthers. The Wolverines finished No. 3 in the rankings, their highest finish under Bo Schembechler to date.
By defeating Ohio State, 22-0, in the regular season finale, Michigan posted its largest margin of victory in the series in 30 years and handed the Buckeyes their first shutout in 112 games, a streak that began in 1964. The Wolverines tied OSU for first-place in the Big Ten with a 10-1 record, and earned their first Rose Bowl berth since 1971. At season’s end, Michigan led the nation in total offense (448.1 yards per game), scoring offense (38.7 points) and scoring defense (7.2 points).
In Pasadena, the third-ranked Wolverines were slated to face No. 2 Southern California, a team with equally impressive credentials. The Trojans were stocked with players such as quarterback Vince Evans, running backs Ricky Bell and Charles White, linebacker Clay Matthews, and were coached by John Robinson. USC promised to provide Michigan with quite a chal-lenge on New Year’s Day.
It took until midway through the second quarter for either team to put points on the scoreboard. The Wolverines scored first when Rob Lytle smashed over the goal line from one yard out. Bob Wood’s extra point attempt was blocked, and Southern Cal used the momen-tum to march 80 yards on the fol-lowing drive, tying the score with Evans rolling in on a fourth-and-one
vs. Southern CaliforniaPasadena, CaliforniaJanuary 1, 1977Attendance: 106,182
Michigan 0 6 0 0- 6
USC 0 7 0 7-14
Second Quarter M Lytle, 1-yard run (B. Wood kick
blocked)USC Evans, 1-yard run (Walker kick)
Fourth Quarter USC White, 7-yard run (Walker kick)
Team Stats UM USCFirst Downs 12 19Net Yards Rushing 155 200Net Yards Passing 76 181Total Plays 57 75Total Yards 231 381PA/PC/Int 12/4/0 20/14/1Punts/Avg. 5/45.0 3/29.7Return Yards 64 17Fumbles/Lost 4/2 2/1Penalties/Yards 2/20 6/55
SCORING
Rushing — (M): Lytle 18-67; R. Davis 10-39; Leach 13-34; Huckleby 3-10; J. Smith 1-5; (USC): White 32-114; Tatupu 7-60; Evans 8-23; Bell 4-16; Farmer 3-7.
Passing — (M): Leach 4-12-76; (USC): Evans 14-20-181
Receiving — (M): J. Smith 2-52; G. Johnson 2-24; (USC): Diggs 8-98; M. Robinson 2-42; Tatupu 2-7; Simmrin 1-27; Gay 1-7.
1977 Rose Bowl
With a defense featuring Curtis Greer and Chris Godfrey on the line, Mel Owens at outside line-backer, and Dwight Hicks and Mike Harden in the backfield, the Wolverines held all but three of their opponents under 10 points during the 1977 season. Michigan had won 10 of 11 games and out-scored its opposition by a three-to-one margin heading into the Rose Bowl to face the University of Washington Huskies.
Michigan failed to get out of the gate quickly enough and even a 20-point second half could not res-cue the Wolverines. A first half low center snap resulted in a 13-yard loss on a fourth down punt and gave Washington field position early. Ten plays later, quarterback Warren Moon scored from two yards out. A field goal and Moon’s second TD put the Huskies up 17-0 at halftime.
Moon’s 28-yard scoring pass to Spider Gaines after Washington had stopped Michigan on the Husky three-yard line appeared to put the game away in the third
vs. WashingtonPasadena, CaliforniaJanuary 2, 1978Attendance: 105,312
Michigan 0 0 7 13-20
Washington 7 10 10 0-27
1978 Rose Bowl
quarter, but Wolverine quarterback Rick Leach launched one of the finest aerial assaults in the history of this classic contest. First, he fired a Rose Bowl record TD pass of 76 yards to Curt Stephenson. Washington countered with an 18-yard field goal, but Leach complet-ed four straight passes, and Russell Davis scored from the two. Later in the fourth quarter, Leach fired first down passes of 11 and 12 yards to Ralph Clayton, then connected with Stanley Edwards, filling in for the injured Harlan Huckleby, for 32 yards and a TD.
Leach led another dramatic drive to the Washington eight-yard line, but a diving interception by line-backer Michael Jackson stopped Michigan and preserved the 27-20 Washington win.
First Quarter W Moon, 2-yard run (Robbins kick)
Second Quarter W Robbins, 30-yard field goalW Moon, 1-yard run (Robbins kick)
Third Quarter W Gaines, 28-yard pass from Moon
(Robbins kick)M Stephenson, 76 yard pass from
Leach (Willner kick)W Robbins, 18-yard field goal
Fourth Quarter M R. Davis, 2-yard run (Willner kick)M Edwards, 32-yard pass from Leach
(kick failed)
Team Stats UM UWFirst Downs 22 17Net Yards Rushing 149 164Net Yards Passing 239 234Total Plays 75 72Total Yards 388 398PA/PC/Int 27/14/2 24/13/2Punts/Avg. 4/42.5 5/39.0Return Yards 124 92Fumbles/Lost 2/1 0/0Penalties/Yards 3/11 6/47
SCORING
Rushing — (M): R. Davis 18-79; Edwards 15-74; Clayton 2-12; Leach 9-5; Anderson 1-(-13); R. Smith 3-(-8); (W): Steele 13-77; Gipson 15-48; Rowland 8-32.
Passing — (M): Leach 14-27-239; (W): Moon 12-23-188; Wilson 1-1-46
Receiving — (M): Clayton 5-84; R. Davis 3-26; Edwards 2-41; R. White 2-8; R. Smith 1-4; Stephenson 1-76; (W): Gaines 4-122; Greenwood 3-28; Gipson 2-24; Stevens 1-46; Steele 1-8; Rowland 1-3; K. Richardson 1-3.
BOWL GAME SUMMARIES10
fumble recovery on the one-yard line. However, the line judge deter-mined that White had crossed the goal line before losing control of the ball and signalled for the touch-down that put USC up by 11. Late in the half, the Trojans intercepted a Rick Leach pass and set up a Frank Jordan field goal from 35 yards away to increase their lead to 17-3 at halftime.
It didn’t take long after leaving the locker room for the Wolverines to narrow the score. Midway through the third period, Leach tossed a 44-yard scoring strike to tailback Roosevelt Smith to close within seven points. Michigan held the strong USC offense scoreless for the remainder of the game, but was unable to put more points on the board as the score stayed unchanged for the duration. Playing in his third straight Rose Bowl, Leach set career records for total plays (94), total yards running and passing (523), and most yards pass-ing (452) in the New Year’s game. Leach shared Most Valuable Player honors with USC’s White.
After shutting out the Fighting Illini of Illinois in the season opener, the Wolverines won nine of their next 10 games, including their third straight victory over Ohio State, and qualified for their third Rose Bowl in as many years.
Michigan played one of its fin-est defensive games in years, but a combination of circumstances and a relentless Southern California ground attack lifted the Trojans to a 17-10 victory in the 65th annual Rose Bowl Classic in Pasadena. An intercepted pass returned to the Wolverine 16-yard line set up USC’s first touchdown of the game, a Paul McDonald to Hoby Brenner pass covering nine yards.
Michigan later drove to the Trojan 21-yard line, but a dropped pass stalled the Wolverines’ prog-ress, and allowed Gregg Willner to put the first “Big Blue” points on the board with a 36-yard field goal in the second quarter. USC extended its lead moments later on one of the more controversial calls in Rose Bowl history. On second down at the Michigan three-yard line, Trojan tailback Charles White dove through the heart of the offensive line in an attempt to score. During the ensuing contact, White lost the ball and Wol verine linebacker Jerry Meter came up with an ap parent
vs. Southern CaliforniaPasadena, CaliforniaJanuary 1, 1979Attendance: 105,629
Michigan 0 3 7 0-10
USC 7 10 0 0-17
First Quarter USC Brenner, 9-yard pass from McDonald
(Jordan kick)Second Quarter
M Willner, 36-yard field goalUSC White, 3-yard run (Jordan kick)USC Jordan, 35-yard field goal
Third Quarter M R. Smith, 44-yard pass from Leach
(Willner kick)
Team Stats UM USCFirst Downs 12 14Net Yards Rushing 99 134Net Yards Passing 137 23Total Plays 62 63Total Yards 236 157PA/PC/Int 22/10/2 9/4/0Punts/Avg. 8/29.5 9/38.6Return Yards 51 80Fumbles/Lost 2/0 2/1Penalties/Yards 4/30 2/21
SCORING
Rushing — (M): Huckleby 9-28; Davis 8-28; Leach 12-22; R. Smith 10-22; Woolfolk 1-(-1); (USC): C. White 32-99; Cain 14-90; McDonald 8-(-55).
Passing — (M): Leach 10-21-137; Jackson 0-1-0; (USC): McDonald 4-9-23.
Receiving — (M): R. Smith 4-58; Clayton 2-40; G. Johnson 2-23; Huckleby 1-7; (USC): C. White 2-2; Garcia 1-12; Brenner 1-9.
1979 Rose Bowl
“Bo Schembechler is looking up into football’s valhalla and saying, ‘Thank you, Fielding Yost, thank you, Fielding Yost for that one’. . . They aren’t even going to try the extra point. Who cares! Who gives a damn! I’ve never been so happy in all my cotton-pickin’ 59 years.” So said the Wolverines’ all-time No. 1 cheerleader, Bob Ufer, describing the mayhem following “the great-est play in 100 years of Michigan football.” Anthony Carter’s dra-matic, game-winning reception against Indiana was easily the sea-son highlight of the 8-3 Wolverines as they headed to the Gator Bowl to oppose North Carolina’s 7-3-1 Tar Heels.
Quarterback John Wangler opened the game with a 47-yard pass completion to Carter, but 20 yards in penalties took Michigan out of field goal range, giving the Wolverines a preview of events to come. Bryan Virgil booted a 20-yard field goal early in the sec-ond quarter and Wangler, hitting receivers at will, threw 53 yards to Carter for a 9-0 lead after Michigan missed the extra point. On the next series, Wangler was tackled by UNC linebacker Lawrence Taylor on a sprint out, suffering a severe knee injury, ending his playing time that night. Up to that point,
Second QuarterM Virgil, 20-yard field goalM Carter, 53-yard pass from Wangler
(kick failed)NC Paschal, 1-yard run (Hayes kick)
Third QuarterNC Farris, 12-yard pass from Kupec
(Hayes kick)Fourth Quarter
NC Hayes, 32-yard field goalM Carter, 30-yard pass from Dickey
(Dickey pass failed)
Team Stats UM UNCFirst Downs 18 20Net Yards Rushing 152 169Net Yards Passing 328 161Total Plays 68 79Total Yards 480 330PA/PC/Int 26/17/2 28/19/0Punts/Avg. 6/35.1 6/45.4Return Yards 39 68Fumbles/Lost 2/2 3/2Penalties/Yards 8/87 8/74
SCORING
Rushing — (M): Woolfolk 16-63; Smith 8-51; Dickey 11-42; Edwards 4-15; (NC): Lawrence 23-118; Paschal 14-49
Passing — (M): Wangler 6-8-203; Dickey 11-18-125 (NC): Kupec 18-28-161
Receiving — (M): Carter 4-141; Woolfolk 5-43; Marsh 3-46; Betts 3-41; (NC): Lawrence 5-38; Chatham 5-37
vs. North CarolinaJacksonville, FloridaDecember 28, 1979Attendance: 70,407
Michigan 0 9 0 6-15
UNC 0 7 7 3-17
1979 Gator Bowl
he had accumulated 203 yards through the air. North Carolina finally scored on a one-yard plunge by Doug Paschal late in the quarter, and trailed 9-7 at the half.
Midway through the third quar-ter, the Tarheels took control of the game, driving 97 yards in 15 plays behind the running of Amos Lawrence, and scoring on a 12-yard pass from Matt Kupec to Phil Farris. North Carolina added a field goal with 7:31 remaining in the game to move ahead 17-9. However, the Wolverines never gave up, and with 1:28 to go, backup quarter-back B.J. Dickey, Wangler’s replace-ment, connected with A.C. on a 30-yard bomb to bring the game to within two. In an attempt to tie, Dickey’s pass to Carter in the endzone failed, and Michigan fell short. Hindering the Wolverines throughout the game were two lost fumbles, two pass intercep-tions, the loss of Wangler and 87 yards in penalties.
11BOWL GAME HISTORY
drive to open the second half. John Wangler connected with Anthony Carter for a seven-yard score, widening the Michigan margin to 17-6 with three minutes remaining in the third quarter. From there, the Wolverine defense took over with Keith Bostic forcing an interception and limiting the Huskies to 23 yards in total offense until the game’s final minutes. Michigan clinched the victory on Stan Edwards’ one-yard TD dive with four minutes remaining in the game to provide the final margin.
Butch Woolfolk’s 182 yards rush-ing earned him game MVP honors, while Don Bracken’s 73-yard punt in the first quarter set a Rose Bowl record. The season that had looked so bleak after a 1-2 beginning thus concluded with nine straight ‘M’ wins.
The Wolverines may have started slowly in 1980, but by October, nobody was able to stop them. Beginning with the Illinois game on October 25, Michigan put together a streak of 15 consecutive scoreless quarters, shutout Indiana, Wisconsin, and Purdue, won the Big Ten title outright for the first time since 1971, and took a string of 18 straight quarters without allowing a touchdown into the Rose Bowl to face the Washington Huskies.
The Huskies compiled more total yards against the Michigan defense, 374, than any team had all season, but the Wolverines con-tinued their consecutive no-touch-down string, and Bo Schembechler won his first Rose Bowl in six tries.
Washington dominated the game early, and on its second drive, the Huskies reached the Michigan one-yard line. But the Wolverines then stonewalled tailback Toussiant Tyler on fourth down and took the momentum from Washington. Butch Woolfolk put Michigan in the lead with a six-yard TD burst near halftime, and despite Chuck Nelson’s two field goals, the Wolverines remained in command the rest of the way.
Ali Haji-Sheikh’s 25-yard field goal capped a six-minute, 83-yard
vs. WashingtonPasadena, CaliforniaJanuary 1, 1981Attendance: 104,863
Michigan 0 7 10 6-23
Washington 0 6 0 0- 6
Second Quarter W Nelson, 35-yard field goalM Woolfolk, 6-yard run (Haji-Sheikh
kick)W Nelson, 26-yard field goal
Third Quarter M Haji-Sheikh, 25-yard field goalM Carter, 7-yard pass from Wangler
(Haji-Sheikh kick)Fourth Quarter
M Edwards, 1-yard run (kick failed)
Team Stats UM UWFirst Downs 23 20Net Yards Rushing 292 92Net Yards Passing 145 282Total Plays 80 69Total Yards 437 374PA/PC/Int 20/12/0 39/23/2Punts/Avg. 6/47.3 5/39.2Return Yards 22 120Fumbles/Lost 0/0 2/1Penalties/Yards 3/37 5/32
SCORING
Rushing— (M): Woolfolk 26-182; Edwards 19-68; Carter 4-33; Ricks 6-21; (W): Stevens 17-59; Tyler 10-45
Passing— (M): Wangler 12-20-145; (W): Flick 23-39-282
Receiving— (M): Carter 5-68; Betts 3-21; Mitchell 2-36; (W): Allen 6-101; Bayle 6-45; Skansi 4-61; Stevens 3-16
1981 Rose Bowl
In the game billed as a “mini-Rose Bowl,” the 8-3 Wolverines came out smelling sweet on New Year’s eve. Michigan’s defense lim-ited the powerful UCLA attack to 195 total yards and held the Bruins to just 33 yards on the ground. The Wolverines led the entire game, beginning with Ali Haji-Sheikh’s 24-yard field goal, set up by Butch Woolfolk’s 52-yard run. With one minute remaining in the first quarter, quarterback Steve Smith spotted Anthony Carter behind the Bruin secondary, for a 50-yard scoring bomb that upped the lead to 10-0. Michigan dominated the rest of the half, yielding only 58 total yards to UCLA. But 12 penal-ties kept the Maize and Blue off the scoreboard the rest of the half.
The Bruins narrowed the gap to 10-7, scoring on their first possession of the third quarter, but the Wolverines responded immediately, marching 52-yards before Haji-Sheikh kicked a 47-yard field goal, the longest of his career. UCLA again drove into Michigan territory, but two penal-ties and Winfred Carraway’s sack of Bruin quarterback Tom Ramsey ended the march, and the Pacific-10 runners-up never again had
First Quarter M Haji-Sheikh, 24-yard field goalM Carter, 50-yard pass from Smith
(Haji-Sheikh kick)Third Quarter
UCLA Townsell, 17-yard pass from Ramsey (Johnson kick)
M Haji-Sheikh, 47-yard field goalFourth Quarter
M Woolfolk, 1-yard run (run failed)UCLA Wrightman, 9-yard pass from Ramsey
(Johnson kick)M Smith, 9-yard run (Haji-Sheikh
kick)M Dickey, 5-yard run (Haji-Sheikh
kick)
Team Stats UM UCLAFirst Downs 25 14Net Yards Rushing 320 33Net Yards Passing 168 162Total Plays 70 59Total Yards 488 195PA/PC/Int 16/10/0 26/12/2Punts/Avg. 5/39.6 8/47.8Return Yards 46 60Fumbles/Lost 1/1 1/0Penalties/Yards 15/148 9/94
SCORING
Rushing— (M): Woolfolk 27-186; Smith 10-64; Ricks 8-20; (UCLA): Nelson 18-33
Passing— (M): Smith 9-15-152; Dickey 1-1-16; (UCLA): Ramsey 12-25-162; Bono 0-1-0
Receiving— (M): Carter 6-127; Bean 2-33; Woolfolk 2-8; (UCLA): Carney 5-89; Twonsell 3-37; Wrightman 2-14
vs. UCLAHouston, TexasDecember 31, 1981Attendance: 50,107
Michigan 10 0 3 20-33
UCLA 0 0 7 7-14
1981 Bluebonnet Bowl
a chance to take the lead. The Wolverines moved 74 yards end-ing in Woolfolk’s one-yard TD run. After UCLA cut the lead to 19-14, Michigan drove 80 yards in seven plays with Smith scoring from nine yards out on the option play to clinch the victory. Reserve quar-terback B.J. Dickey’s touchdown run in the final minute iced the triumph.
Woolfolk closed his brilliant career at Michigan by gaining 186 yards rushing, bringing his four-year total to 3,861 and earn-ing game MVP honors. Smith’s 152 passing yards gave him Michigan’s single-season record with 1,661 yards, and added to his total offense mark. Anthony Carter grabbed six receptions for 127 yards, and the Wolverines left Houston looking forward to the New Year.
BOWL GAME SUMMARIES12
with a 39-yard field goal. However, the Wolverines stormed back after the intermission and drove 55 yards for a touchdown. Hall passed the final yard to fullback Eddie Garrett in the third quarter to bring U-M within three points at 10-7.
On the next drive the Bruins took control with Ramsey leading the way, passing for 33 yards and run-ning for 20 in an 80-yard TD drive. With UCLA up 17-7 and nine min-utes left to play, the Wolverines took over deep in their own territory. Here Hall showed his inexperience by lobbing a pass into the hands of Bruin Blanchard Montgomery. The 230-pound linebacker galloped 11 yards into the end zone to seal the Wolverines’ fate.
After Hall passed to fullback Dan Rice for a one-yard touchdown in the fourth quarter, the score read 24-14 in UCLA’s favor. Michigan could not muster another scoring drive, and UCLA took home the roses.
Michigan dominated the Big Ten in 1982, rolling through its confer-ence schedule and winning the title outright in the second-to-last-game against Purdue. Even a loss to Ohio State in the regular season finale could not take the roses from the Wolver ines as they prepared to face the UCLA Bruins in Pasadena. The game featured a rematch of the previous season’s Bluebonnet Bowl participants, and gave the Maize and Blue an opportunity to avenge the 31-27 loss suffered at the hands of the Bruins earlier in the season. This contest, however, would be played in the Rose Bowl, a stadium UCLA had claimed as its home field for the 1982 regular season.
A one-yard plunge by Tom Ramsey on UCLA’s second drive put the Bruins up 7-0 in the first quar-ter, a lead they never relinquished. In the second quarter, Wolverine quarterback Steve Smith ran an eight-yard option for a first down, but took a vicious hit from Bruin free safety Don Rogers. Smith left the game with a separated shoulder and did not return. Junior Dave Hall, with seven completions in 14 attempts for the season, finished the game in admirable fashion, but his inexperience hurt the Wolverines.
Late in the second quarter, kicker John Lee gave UCLA a 10-0 lead
vs. UCLAPasadena, CaliforniaJanuary 1, 1983Attendance: 104,991
Michigan 0 0 7 7-14
UCLA 7 3 7 7-24
First Quarter UCLA Ramsey, 1-yard run (Lee kick)
Second Quarter UCLA Lee, 39-yard field goal
Third Quarter M Garrett, 1-yard pass from Hall
(Haji-Sheikh kick)UCLA Andrews, 9-yard run (Lee kick)
Fourth Quarter UCLA Montgomery, 11-yard pass intercep-
tion return (Lee kick)M Rice, 4-yard pass from Hall (Haji-
Sheikh kick)
Team Stats UM UCLAFirst Downs 19 19Net Yards Rushing 110 181Net Yards Passing 209 162Total Plays 72 72Total Yards 319 343PA/PC/Int 34/19/3 25/18/0Punts/Avg. 6/40.3 6/32.2Return Yards 63 57Fumbles/Lost 1/1 1/0Penalties/Yards 3/17 2/10
SCORING
Rushing— (M):Ricks 23-88; S. Smith 3-15; Rogers 2-12; (UCLA): Nelson 11-48; Cephous 8-46; Andrews 12-42; Ramsey 10-25.
Passing— (M): Hall 13-24-155; S. Smith 6-9-54; Carter 0-1-0; (UCLA): Ramsey 18-25-162.
Receiving— (M): Dunaway 5-110; Carter 5-59; Rice 4-17; Ricks 2-4; (UCLA): Bergmann 6-48; Townsell 4-45; Carney 2-33; Bruno 2-11.
1983 Rose Bowl
Buoyed by back-to-back shutouts of Michigan State and Northwestern and a last-sec-ond victory over Iowa, the 1983 Wolverines charged to a second-place finish in the Big Ten, suffer-ing its only conference setback to the Illinois squad that went on to play in the Rose Bowl. By holding off a late Ohio State comeback bid in the season finale, the Wolverines raised their record to 9-2 and gained a trip to New Orleans to meet the Auburn Tigers in the Sugar Bowl.
Steve Smith led a powerful offensive attack early in the game during which Michigan held the ball for over nine minutes of the first quarter and gained 116 yards to the Tigers’ 61. The Wolverines’ second offensive drive in the game was highlighted by a 19-yard Smith to Triando Markray comple-tion and 38 yards on four carries by Rick Rogers. Smith’s four-yard keeper midway through the first quarter gave the Wolverines a lead they would keep for 52 minutes of the 60-minute contest.
Each team showed a strong defense for the remainder of the half, and Michigan took its 7-0 lead into the locker room.
Campbell attempted only two passes in the second half and handed off 42 times to backs Lionel James, Bo Jackson, and Tommy Agee, who together col-
First Quarter M S. Smith, 4-yard run (Bergeron
kick)Third Quarter
A DelGreco, 31-yard field goalFourth Quarter
A DelGreco, 32-yard field goalA DelGreco, 19-yard field goal
Team Stats UM AUFirst Downs 12 21Net Yards Rushing 118 301Net Yards Passing 125 21Total Plays 56 73Total Yards 243 322PA/PC/Int 25/9/1 6/2/1Punts/Avg. 8/38.3 4/42.0Return Yards 13 8Fumbles/Lost 2/1 4/3Penalties/Yards 6/49 3/15
SCORING
Rushing— (M):Rogers 17-86; Garrett 5-18; S. Smith 9-14; (A): Jackson 22-130; Agee 16-93; James 18[83; Collins 2-1
Passing— (M): S. Smith 9-25-125; (A): Campbell 2-6-21
Receiving— (M): Markray 3-68; Bean 3-37; Nelson 3-20; (A): James 1-15; Jackson 1-6
vs. AuburnNew Orleans, LouisianaJanuary 2, 1984Attendance: 77,893
Michigan 7 0 0 0- 7
Auburn 0 0 3 6- 9
1984 Sugar Bowl
lected 306 yards on the ground.While Michigan’s offense was
thwarted time and time again, the Tigers ran all over the tiring Wolverine defense, controlling the ball for over 23 minutes of the second half. After a 26-yard Don Bracken punt—one of a sea-son-high eight punts—Auburn marched 68 yards, all on the ground, to set up a 31-yard Al DelGreco field goal.
The Tigers got a break when Smith was hit as he re leased the ball and Auburn’s Gregg Carr grabbed it at the Michigan 41-yard line. Seven plays later, Del Greco chalked up his second three-point-er, a 32-yarder.
After another Michigan punt, Auburn took over on its own 39-yard line. The Tigers ran a ball con-trol offense, using 15 rushing plays and 7:21 off the clock in reaching the Wolverines’ one-yard line with 27 seconds to play in the game. Michigan called a timeout, but DelGreco booted the 19-yard field goal to send the Wolverines back to Ann Arbor with a taste of New Orleans but no sugar.
13BOWL GAME HISTORY
minute, and Lee Johnson booted a 31-yard field goal giving the Cougars a slim 10-7 halftime lead.
Michigan went ahead late in the third quarter, moving 47 yards after Tim Anderson blocked Johnson’s field goal attempt and Chris Zurbrugg threw a 10-yard TD pass to Bob Perryman. Early in the fourth quarter, Bob Bergeron pushed the Michigan lead to 17-10 with a 32-yard field goal. Then Bosco went to work, driving BYU for two late TDs—the last coming with just 1:23 to play—and the win.
In collecting its 24th con-secutive victory, BYU put together some impressive offensive figures (483 yards in total offense, 32 first downs) and went on to claim the national champion ship.
After upsetting top-ranked Miami in the season opener, Michigan’s fortunes looked bright for 1984. But when quarterback Jim Harbaugh broke his arm against Michigan State, it took a great effort for the Wolverines to limp to a 6-5 record. Despite their less-than-spectacular season mark, Michigan found itself paired against No. 1-ranked Brigham Young in the Holiday Bowl. The Wolverines accepted the oppor-tunity, and ended the season just how they had started—facing the nation’s top-ranked team.
Aided by six Brigham Young turnovers and a blocked field goal attempt, Michigan held a 17-10 lead early in the fourth quarter. But BYU quarterback Robbie Bosco, hampered by an injured left knee and ankle suffered in the first stanza, led the Cougars to 80- and 83-yard TD drives to give BYU a 24-17 victory.
After a scoreless first quarter, BYU jumped on the scoreboard when Kelly Smith capped an 11-play, 80-yard drive with a five-yard TD run. The Wolverines knotted the score at seven after Rick Rogers scampered in from five yards out with 1:13 left in the half. But Bosco led BYU down the field in the last
vs. Brigham YoungSan Diego, CaliforniaDecember 21, 1984Attendance: 61,243
Michigan 0 7 7 3-17
BYU 0 10 0 14-24
Second Quarter BYU K. Smith, 5-yard run (Johnson kick)M Rogers, 5-yard run (Bergeron kick)BYU Johnson, 31-yard field goal
Third Quarter M Perryman, 10-yard pass from
Zurbrugg (Bergeron kick)Fourth Quarter
M Bergeron, 32-yard field goalBYU Kozlowski, 7-yard pass from Bosco
(Johnson kick)BYU K. Smith, 13-yard pass from Bosco
(Johnson kick)
Team Stats UM BYUFirst Downs 13 32Net Yards Rushing 120 112Net Yards Passing 82 371Total Plays 64 76Total Yards 202 483PA/PC/Int 15/7/1 49/35/3Punts/Avg. 7/39.1 1/45.0Return Yards 35 35Fumbles/Lost 2/0 4/3Penalties/Yards 11/112 9/82
SCORING
Rushing— (M): Perryman 13-110; Rogers 19-60; (B): Heimuli 16-82
Passing— (M): Zurbrugg 7-15-82; (B): Bosco 30-42-343; Fowler 5-7-28
Receiving— (M): Bean 3-46; Perryman 2-15; (B): Mills 11-103; K. Smith 10-88; Heimuli 4-40; Bellini 3-48; Haysbert 3-42
1984 Holiday Bowl
The surprising 9-1-1 Wolverines — equipped with the nation’s top scoring defense — found them-selves matched against Nebraska in the Fiesta Bowl.
After a 21-yard run by Jamie Morris set up a 42-yard field goal by Pat Moons to open the scoring, the Cornhuskers got rolling. Nebraska used 10 plays to move 74 yards for the touchdown that gave Nebraska a 7-3 lead early in the second quarter. McCathorn Clayton hit Doug DuBose in the endzone from five yards out for the score. The Cornhuskers added another tally when a 15-yard run by fullback Tom Rathman set up DuBose’s second touchdown of the game, giving Nebraska a 14-3 half-time lead.
In the second half, an inspired Wolverine defense began forc-ing turnovers to help U-M climb back into contention. On its third play from scrimmage, Nebraska’s DuBose fumbled, and Michigan’s Jeff Akers recovered. A 19-yard run by Jamie Morris set up Gerald White’s one-yard dive for a TD, pulling the Wolverines to within 14-10 early in the third quarter. Another fumble by Nebraska, this one by Clayton, was recovered by Michigan’s Mark Messner on the next series, and White’s 19-yard run set up a one-yard plunge by Harbaugh to give
First Quarter M Moons, 42-yard field goal
Second Quarter N DuBose, 5-yard pass from Clayton
(Klein kick)N DuBose, 3 yard run (Klein kick)
Third Quarter M White, 1-yard run (Moons kick)M Harbaugh, 1-yard run (Moons kick)M Moons, 19-yard field goalM Harbaugh, 2-yard run (Moons kick)
Fourth Quarter N Taylor, 1-yard run (Klein kick)N Safety-Robbins steps out of endzone
Team Stats UM UNFirst Downs 16 20Net Yards Rushing 171 304Net Yards Passing 63 66Total Plays 65 75Total Yards 234 370PA/PC/Int. 16/6/0 15/6/1Punts/Avg. 5/43.8 3/40.3Return Yds. 3 20Fumbles/Lost 2/0 6/3Penalties/Yards 8/43 7/46
SCORING
Rushing— (M): Morris 22-156; White 13-38; (N): Clayton 14-68; DuBose 17-99; Rathman 9-47; Sheppard 7-13; Taylor 10-76
Passing— (M): Harbaugh 6-15-63; (N): Clayton 4-6-51; Taylor 2-9-15
Receiving— (M): Kattus 3-38; Jokisch 1-15; Morris 2-10; (N):Frain 3-46;
Smith 1-8
vs. NebraskaTempe, ArizonaJanuary 1, 1986Attendance: 72,454
Michigan 3 0 24 0-27
Nebraska 0 14 0 9-23
1986 Fiesta Bowl
the Maize and Blue the lead at 17-14. The Wolverine defense forced Nebraska to punt on the next series, and Dave Arnold rushed in untouched to block his third punt of the season to set up a short Moons field goal. The Wolverines scored again on their next possession when a 14-yard run by Morris set up Harbaugh’s sec ond TD of the after-noon, giving Michigan a seemingly comfortable 27-14 lead.
The excitement was not quite finished, thanks to an elusive fresh-man quarterback for Nebraska. Steve Taylor moved the Cornhuskers 77 yards in four minutes to cut the Michigan lead to 27-21. With the Wolverines in a hole late in the game, Schembechler elected to take an intentional safety, and Nebraska was unable to mount a drive on its final possession.
The win gave Schembechler his third bowl victory in six years, and vaulted Michigan to the No. 2 spot (behind Oklahoma) in the final polls.
BOWL GAME SUMMARIES14
drive that commenced when Jeff Van Raaphorst passed to Bruce Hill for the Sun Devils’ first touchdown. As the teams took to the locker room, the Wolverines held a 15-13 advantage.
Opening the second half, Arizona State launched an 80-yard drive. Van Raaphorst again found Hill in the end zone, and after the two-point conversion failed, Michigan trailed by four. The Wolverines only touched the ball twice in the entire quarter, and netted just 22 yards, all from Harbaugh's pass completion in the third quarter. With 14:16 to go in the game, Bostrom added a 25-yard field goal and Arizona State had all the points needed for the victory.
Despite the disappointment of the final game, the 1986 season was a good one for Michigan Football. Wolverine fans were treated to the 32nd Big Ten title in school history, Bo Schem bechler’s 200th career victory to pass Fielding H. Yost as the winningest coach in Michigan history.
The Maize and Blue returned to the grass of the Rose Bowl after a four-year drought to face seventh-ranked Arizona State. The Sun Devils rolled to the Pac-10 title by running through its schedule unbeaten before slipping in their final game against Arizona.
Michigan made its first drive look easy. After Jim Harbaugh passed 24 yards to Greg McMurtry on the second play from scrimmage, the Wolverines quickly moved into scor-ing position. Jamie Morris took the handoff at the 18-yard line, broke two tackles, and smashed into the end zone. On the point-after attempt, the Sun Devils were caught when kicker Mike Gillette took the snap and passed to Gerald White in the end zone while the rest of the team re main ed huddled to the side. As the ecstatic Wolverine contingent cheered, the scoreboard flashed the score: Michigan 8, ASU 0.
Early in the second quarter, the Sun Devils’ Kent Bostrom booted a 37-yard field goal. Michigan roared right back by powering the ball to the two-yard line before Harbaugh plunged to paydirt. Gillette kicked the conversion, and Michigan led 15-3. After adding a 27-yard field goal, Arizona State used the last four min-utes of the half to mount a 60-yard
vs. Arizona StatePasadena, CaliforniaJanuary 1, 1987Attendance: 103,168
Michigan 8 7 0 0-15
Arizona St. 0 13 6 3-22
First Quarter M Morris, 18-yard run (White 2-yard
pass from Gillette)Second Quarter
ASU Bostrom, 37-yard field goalM Harbaugh, 2-yard run (Gillette
kick)ASU Bostrom, 27-yard field goalASU Hill, 4-yard pass from Van Raaphorst
(Bostrom kick)Third Quarter
ASU Hill, 1-yard pass from Van Raaphorst (Pass failed)
Fourth Quarter ASU Bostrom, 25-yard field goal
Team Stats UM ASUFirst Downs 13 22Net Yards Rushing 59 188Net Yards Passing 172 193Total Plays 52 81Total Yards 225 381PA/PC/Int 23/13/3 30/16/0Punts/Avg. 6/40.8 4/39.0Return Yards 11 8Fumbles/Lost 3/0 1/0Penalties/Yards 6/42 6/26
SCORING
Rushing— (M):Morris 16-47; Perryman 5-14; G. White 1-2; Harbaugh 7-(-10); (A): Harris 23-109; Williams 18-69; Day 2-9
Passing— (M): Harbaugh 13-23-172; (A): Van Raaphorst 16-30-193
Receiving— (M): Morris 4-47; McMurtry 3-59; G. White 3-23; Jokisch 1-22; Higgins 1-15; (A): Cox 6-104; Hill 4-30; Harris 3-34
1987 Rose Bowl
For the second time in his 19-year reign, Bo Schembechler would not be on the sidelines for a Michigan bowl game. Schem bechler under-went quad ru ple heart bypass sur-gery in early December so offensive coordinator Gary Moeller was given the task of preparing the Wolverines for Alabama.
The Crimson Tide took the open-ing kickoff and moved the ball to Michigan’s 34-yard line, where they had to settle for a 51-yard Philip Doyle field goal. In the second quarter, Jamie Morris broke a tackle for a 25-yard touchdown run, giv-ing the Wolverines their first lead of the game. On Michigan’s next possession, Morris again broke a tackle, then ran over a defender for a 14-yard TD run and the Wolverines went into the locker room with a 14-3 half time lead.
Michigan began the second half where it left off as Morris broke loose for a 77-yard TD run, lifting U-M to a comfort able 21-3 margin. Following Morris’ run, the Crimson Tide launched a 72-yard drive in just under five minutes that culminated in a 16-yard touch down pass from Jeff Dunn to Howard Cross.
After a Michigan punt, Alabama marched 85 yards, capped by Bobby Humphrey’s one-yard TD run, cut-ting the Wolverine lead to five points
First QuarterA Dole, 51-yard field goal
Second Quarter M Morris, 25-yard run (Gillette kick)M Morris, 14-yard run (Gillette kick)
Third Quarter M Morris, 77-yard run (Gillette kick)A Cross, 16-yard pass from Dunn (run
failed)Fourth Quarter
A Humphrey, 1-yard run (Doyle kick)A Humphrey, 17-yard run (Dunn pass to
Whitehurst)M Kolesar, 20-yard pass from Brown
(Gillette kick)
Team Stats UM UAFirst Downs 12 28Net Yards Rushing 278 191Net Yards Passing 68 269Total Plays 49 81Total Yards 346 460PA/PC/Int 17/6/0 40/23/1Punts-Avg 6/42.5 4/42.5Return Yards 133 81Fumbles/Lost 0/0 1/1Penalties/Yards 4/30 1/5
SCORING
Rushing— (M): Morris 23-234; Bunch 3-16; Brown 2-1; Taylor 3-11; Hoard 1-16; (A): Humphrey 27-149; Allen 3-6; K. Goode 6-14; Dunn 7-13; Wright 2-2; P. Goode 4-7
Passing— (M): Brown 13-4-72; Taylor 4-2-(-4); (A): Dunn 40-23-269
Receiving— (M): Morris 2-(-4); Callo way 1-14; J. Brown 1-7; McMurtry 1-31; Kolesar 1-20; (A): Whitehurst 6-85; Cross 6-81; Humphrey 5-34; P. Goode 2-20; Wright 1-18; Stafford 2-21; Allen 1-10
vs. AlabamaTampa, FloridaJanuary 2, 1988Attendance: 60,156
Michigan 0 14 7 7-28
Alabama 3 0 6 15-24
1988 Hall of Fame Bowl
with 13 minutes left in the game. Two more times Michigan’s offense was held and Alabama was again able to drive against the Wolverine defense, this time for 79 yards, cul-minating in a 17-yard scoring run by Humphrey. Ala bama’s two-point conversion was successful and the Tide took the lead, 24-21, with just under five minutes remaining.
Facing fourth-and-three from the 20-yard line late in the fourth quar-ter, Brown lofted a 20-yard pass that John Kolesar pulled down in the corner of the end zone for a touch-down and ended Michigan’s most exciting scoring drive of the season. In the game’s waning moments, Ala-bama’s desperation pass was inter-cepted by cornerback David Arnold to seal the win.
Jamie Morris’ 234 yards rush-ing set a Hall of Fame Bowl and Michigan bowl record. He also broke the Wol ver ines’ single season rush-ing record with a total of 1,703 yards and ended his career with 4,393 rushing yards, third-best in Big Ten history.
15BOWL GAME HISTORY
Coming off one of the toughest Ohio State games in recent history, many questioned whether or not Michigan could withstand a USC team that led the Pac-10 in rushing defense, total defense and was offen-sively led by Rodney Peete, the 1988 Heisman Trophy runner-up.
Michigan’s first possession was highlighted by a 21-yard comple-tion from Demetrius Brown to John Kolesar on the fourth play of the drive. U-M controlled the ball for 7:51 on 13 plays until it was stopped by the Trojan defense. Mike Gillette was called in to cap the drive with a 49-yard field goal with 4:07 remaining in the quarter.
At the beginning of the second quarter, the Trojan offense came to life. USC moved from its own 46-yard line to the Wolverine 22. Each side turned the ball over, however, before the Trojans scored the game’s first touchdown on a one-yard run by Peete. USC began its second TD drive with 7:06 remaining in the half, ending with Peete’s four-yard scor-ing run.
The opening minutes of the second half saw Brown’s 22-yard scramble to the six, followed by his touchdown toss to Chris Calloway two plays later. U-M was unsuccess-ful on the two-point conversion, leaving the score at 14-9.
In the final minutes of the third quarter, the Michigan offense, led by
vs. Southern CaliforniaPasadena, CaliforniaJanuary 2, 1989Attendance: 101,688
Michigan 3 0 6 13-22
USC 0 14 0 0-14
First Quarter M Gillette, 49-yard field goal
Second Quarter USC Peete, 1-yard run (Rodriguez kick)USC Peete, 4-yard run (Rodriguez kick)
Third Quarter M Calloway, 6-yard pass from Brown
(Run failed)Fourth Quarter
M Hoard, 1-yard run (Pass failed)M Hoard, 1-yard run (Gillette kick)
Team Stats UM USCFirst Downs 19 15Net Yards Rushing 208 138Net Yards Passing 144 158Total Plays 72 60Total Yards 352 296PA/PC/Int 24/11/0 21/15/2Punts-Avg 4/34.8 4/50.3Return Yards 41 8Fumbles/Lost 1/1 3/3Penalties/Yards 4/20 4/30
SCORING
Rushing— (M): Hoard 19-142; Boles 14-49; D. Brown 11-1; Kolesar 1-16; Bunch 3-0; (USC): Emanuel 16-55; Peete 9-42; Holt 9-33; Ervins 5-8
Passing— (M): Brown 24-11-144; (USC): Peete 21-15-158
Receiving— (M): D. Walker 3-54; Kolesar 3-49; McMurtry 2-25; Boles 1-6; Calloway 1-6; Hoard 1-4; (USC): Affholter 5-56; Jackson 3-23;Wellman 2-47; Holt 2-12; Galbraith 1-11; Emanuel 1-6; Ervins 1-3
1989 Rose Bowl
running backs Tony Boles and Leroy Hoard, put together the longest drive of the game, amassing 64 of the 92 yards gained by U-M. A 23-yard pass from Brown to Derrick Walker put the Wolverines on the one-yard line, and Hoard took it in for the score. Michigan again failed on the two-point try, leaving the Trojans just one point behind with plenty of time left in the final quarter.
With 5:28 left to play in the game, the Wolverines sensed their third bowl victory in four years. On the very first play, Hoard exploded for a 61-yard run to the Trojan nine-yard line. On fourth-and-goal, Hoard scored to give Michigan a seven-point lead that became eight after Gillette’s extra point with 1:57 remaining.
Peete then led the Trojans down the field in an attempt to tie the game, but linebacker John Milligan picked off an errant pass with 50 seconds remaining to secure a Wolverine win.
The victory gave Schem bechler his second win in Pasa dena and the Wolverines a 9-2-1 season re cord, fin-ishing with a No. 4 nation al ranking by the Associated Press.
Every Rose Bowl is a grand spectacle of the best college football has to offer, but the 1990 clash between Michigan and Southern California had added luster as it was the last game in Bo Schembechler’s 27-year coaching career.
The first quarter was dominated by the defenses, as neither team was able to put any points on the scoreboard. USC opened the scor-ing in the second quarter on a one-yard touchdown run by quarter-back Todd Marinovich. Michigan answered USC’s score midway through the second quarter. Leroy Hoard ripped off a 46-yard run and Michael Taylor connected with Greg McMurtry for 20 yards to get down to the Trojan eight-yard line. J.D. Carlson’s 19-yard field goal cut USC’s lead to 7-3 with 6:28 left. The Trojans closed out the first half scoring on a 34-yard Quin Rodriguez field goal that pushed USC’s halftime lead to 10-3.
The Wolverines played an inspired third quarter, limiting the Trojans to just 27 yards while scor-ing the tying touchdown. Michigan scored on its second drive of the quarter as Allen Jefferson scored from two yards out to tie the game at 10.
The game’s pivotal play came on a fourth-and-two from the
vs. Southern CaliforniaPasadena, CaliforniaJanuary 1, 1990Attendance: 103,450
Michigan 0 3 7 0-10
USC 0 10 0 7-17
1990 Rose Bowl
Michigan 46 with 12:00 left in the contest. On that play, Wolverine punter Chris Stapleton’s fake punt gained 24 yards, but a hold-ing penalty and a subsequent unsportsmanlike conduct penalty pushed Michigan back to its own 21 and eliminated the first down. Southern Cal took advantage of Michigan’s misfortune, marching 75 yards in 13 plays for the game-winning TD.
Despite the Rose Bowl defeat, the Wolverines had their first 10-win season (10-2) since 1986, and earned their second consecutive outright Big Ten Championship. Bo Schembechler ended his coach-ing career as the winningest coach in Michigan football history with a 194-48-5 record.
Second QuarterUSC Marinovich, 1-yard run (Rodriguez kick)M Carlson, 19-yard field goalUSC Rodriguez, 34-yard field goal
Third QuarterM Jefferson, 2-yard run
(Carlson kick)Fourth Quarter
USC Ervins, 14-yard run (Rodriguez kick)
Team Stats UM USCFirst Downs 11 23Net Yards Rushing 119 181Net Yards Passing 115 178Total Plays 52 78Total Yards 234 359PA/PC/Int 20/10/0 31/22/1Punts-Avg 7/35.9 4/39.3Return Yards 11 68Fumbles/Lost 2/0 0/0Penalties/Yards 8/62 8/87
SCORING
Rushing— (M): Hoard 17-108; Bunch 16-9; Taylor 8-35; Jefferson 1-2 (USC): Ervins 30-126; Holt 8-35; Marinovich 9-20
Passing— (M): Taylor 10-19-115; Hoard 0-1-0 (USC): Marinovich 22-31-178
Receiving— (M): McMurtry 4-56; Hoard 3-15; Calloway 2-33; Bunch 1-11 (USC): Jackson 5-56; Ervins 5-44; Holt 3-25; Griffin 3-22; Scott 3-19; Wallace 1-8; Wellman 1-6; Galbraith 1-(-2)
BOWL GAME SUMMARIES16
terback Tom Luke was intercepted by Todd Plate at the Michigan 37. After a three-yard Ricky Powers run and an 11-yard Grbac-to-Howard completion, the Wolverines had a first down on the Ole Miss 49-yard line. On the next play, Powers blasted up the middle for a gain of 44 yards and a first down at the Rebel five. Bunch pounded into the end zone on the next play, giving Michigan a comfortable 28-3 lead.
As the third stanza was nearing completion, Grbac connected with Derrick Alexander over the middle for a 33-yard touchdown—Grbac’s fourth of the game, and a Michigan single bowl record. That closed the scoring, giving Michigan a resound-ing 35-3 win.
Offensive linemen Dean Ding-man, Tom Dohring, Greg Skre penak, Matt Elliott and Steve Everitt were named the game’s Most Valuable Players for leading the offense to a Michigan single game record 715 total yards.
Gary Moeller’s Wolverines gained a share of the Big Ten title in his first season, as U-M met Mississippi in the Gator Bowl.
After both teams exchanged early turnovers, Michigan opened the scoring when Elvis Grbac threw deep down the right side of the field to Des mond Howard, for a career-long 63-yard touchdown reception. J.D. Carlson’s extra point gave Michigan a 7-0 lead with 1:04 left in the first quarter.
Mississippi scored its only points of the game in the second quarter when Brian Lee kicked a career-long and Gator Bowl record 51-yard field goal to trim the margin to 7-3.
Following a 32-yard Howard return of the ensuing kickoff, Jon Vaughn sprinted around left end for a gain of 37 yards and a first down at the Rebel 31. Five plays later, Grbac threw seven yards to Jarrod Bunch for a 14-3 halftime lead. Grbac’s touchdown pass, his 19th of the sea-son, broke Jim Har baugh’s Michigan single season record for touchdown passes thrown (18 in 1985).
Early in the third quarter, Grbac threw a screen pass to Howard who eluded the Mississippi defense en route to a 50-yard touchdown recep-tion and a 21-3 Michigan lead with 10:53 left in the third quarter.
Later in the quarter, Ole Miss quar-
vs. MississippiJacksonville, FloridaJanuary 1, 1991Attendance: 68,927
Michigan 7 7 21 0-35
Mississippi 0 3 0 0- 3
First Quarter M Howard, 63-yard pass from Grbac
(Carlson kick)Second Quarter
MS Lee, 51-yard field goalM Bunch, 7-yard pass from Grbac
(Carlson kick)Third Quarter
M Howard, 50-yard pass from Grbac (Carlson kick)
M Bunch, 5-yard run (Carlson kick)M Alexander, 33-yard pass from
Grbac (Carlson kick)
Team Stats UM MSFirst Downs 35 20Net Yards Rushing 391 93Net Yards Passing 324 215Total Plays 85 67Total Yards 715 308PA/PC/Int 32/20/2 31/17/4Punts-Avg 2-24.5 5-38.0Return Yards 65 192Fumbles/Lost 2/1 4/2Penalties/Yards 6/69 4/49
SCORING
Rushing — (M): Vaughn, 15-128; Powers, 14-112; Bunch, 11-54; Legette, 5-54; Howard, 1-19; Washington, 3-15; Watson, 1-5; Jefferson, 3-4; (MS): Baldwin, 8-53; Thigpen, 6-32; Billing, 2-6; Courtney, 1-6; Luke, 14-5; Shows, 5-(-9)
Passing — (M): Grbac, 16-25-296; Sollom, 4-7-28; (MS): Shows, 12-20-150; Luke, 5-11-65
Receiving — (M): Howard, 6-167; Alexander, 2-50; VanDyne, 3-32; Bunch, 2-22; Burch, 1-12; Vaughn, 1-10; Owen, 1-9; Powers, 1-8; Johnson, 2-7; Diebolt, 1-7; (MS): Roberts, 4-67; Brownlee, 4-58; Owens, 3-42; Small, 1-25; Baldwin, 2-15; Holder, 1-11; Thigpen, 1-6; Courtney, 1-3
1991 Gator Bowl
With a fourth consecutive Big Ten title locked up, the Michigan Wolverines ventured to Pasa dena hoping to add a Rose Bowl title and possible national championship to their already impressive list of accolades. Thus far, the 1991 season had seen Desmond Howard win the Heisman Trophy and Erick Anderson garner the first Butkus Award in school history. How ever, standing in the way of Gary Moeller’s team were the Wash ington Hus kies, a team boasting the nation’s top-ranked defense.
After a scoreless first quarter, the Huskies went ahead as Billy Joe Hobert faked to Beno Bryant and ran off left tackle for two yards and the touchdown. How ard, an electri-fying player, would then add anoth-er clip to his collegiate highlight film on Michi gan’s ensuing drive as he snared a leaping, 35-yard reception over eventual NFL first round selec-tion Dana Hall. Three plays later, Elvis Grbac connected with Walter Smith on a nine-yard scoring pass. Two Travis Hanson field goals made the score 13-7 Huskies at halftime.
Washington extended its lead in the third quarter on an 80-yard touchdown drive. Hobert completed a five-yard TD toss to Mark Bruener and the two-point conversion to
Second Quarter WA Hobert, 2-yard run (Hanson kick)M Smith, 9-yard pass from Grbac
(Carlson kick)WA Hanson, 24-yard field goalWA Hanson, 23-yard field goal
Third Quarter WA Breuner, 5-yard pass from Hobert
(Pierce, pass from Hobert) Fourth Quarter
WA Pierce, 2-yard pass from Hobert (Kick failed)
WA Bailey, 38-yard pass from Brunell (Hanson kick)
M Wheatley, 53-yard run (Carlson kick)
Team Stats UM UWFirst Downs 10 19Net Yards Rushing 72 123Net Yards Passing 133 281Total Plays 61 85Total Yards 205 404PA/PC/Int 28/14/1 42/25/1Punts-Avg 10-37.8 6-41.8Return Yards 144 95Fumbles/Lost 3/0 0/0Penalties/Yards 8/62 6/50
SCORING
Rushing — (M): Wheatley, 9-68; Johnson, 4-30; Howard, 1-15; Powers, 10-10; Collins, 1-( - 9); Grbac, 8—( - 42) (WA): Bryant, 15-38; Barry, 13-37; Kaufmann, 6-26; M. Jones, 3-22; Turner, 1-3; Hobert 4-( - 1); Brunell, 1-( - 2) Passing — (M): Grbac, 13-26-130; Collins, 1-2-3; (WA): Hobert, 18-34-192; Brunell, 7-8-89Receiving — (M): Howard, 1-35; Wheatley, 3-30; VanDyne, 4-22; R. Powers, 3-18; McGee, 1-14; W. Smith, 1-9; J. Johnson, 1-5 (WA): Bailey, 6-126; Pierce, 7-86; Bryant, 5-22; Gaspard, 1-5; McKay, 1-12; M. Jones, 2-7; Turner, 1-6; Bruener, 1-5; Barry, 1-2
vs. WashingtonPasadena, CaliforniaJanuary 1, 1992Attendance: 103,566
Michigan 0 7 0 7-14
Washington 0 13 8 13-34
1992 Rose Bowl
Aaron Pierce.Facing a 21-7 deficit, the
Wolverines were again unable to manage a first down and were forced to punt. Excellent field posi-tion awaited the Washington offense again, with the ball resting on the Michigan 48. On the second play of the final quarter, Hobert gave a play-action fake and found Pierce in the back of the endzone for a two-yard touchdown. The Wolverines found themselves trailing 27-7.
Michigan started the next drive at its own 29-yard line, and moved the ball out to the 38-yard line before a Grbac keeper on fourth-and-one was stopped. Washington took only six seconds to find the endzone again, as Mark Brunell hit Mario Bailey streaking down the right side for the Huskies final score of the game.
Tyrone Wheatley, a freshman, capped off an outstanding afternoon (68 yards on nine carries) and closed the scor ing on a 53-yard touchdown run, and J.D. Carlson’s 126th con-secutive PAT.
17BOWL GAME HISTORY
mission.Wheatley then went to work,
taking advantage of a key block by All-American Steve Everitt on an 88-yard touchdown run -- his sec-ond long scoring play and a new Rose Bowl record. But the Huskies were far from through. They put together 10 straight points and went ahead 31-24 until Wheatley responded. His third touchdown run of the game -- a 24-yard scam-per on a draw play -- tied the game at 31 and swung the momentum back to Michigan.
The Wolverines’ game-winning score came on an 80-yard drive, as Grbac, facing third and short from the Huskies’ 15-yard line, found McGee at the two. McGee fell into the endzone for the only score of the fourth quarter, the winning points in Michigan’s thrilling 38-31 victory.
For the second consecutive sea-son, the Michigan Wolverines and Washington Huskies celebrated the New Year together at the Rose Bowl. The Huskies were search-ing for an unprecedented third straight Rose Bowl victory, while the Wolverines were looking to avenge a 34-14 Rose Bowl defeat to Washington in 1992.
Trailing 7-3, the Wolverines energized their fans on a 49-yard touchdown pass from Elvis Grbac to Tony McGee, which capped a six-play, 69-yard drive and provid-ed Michigan the lead after the first quarter. On its next possession, Michigan opened up a 17-7 lead as Tyrone Wheatley, on his way to a 235-yard rushing per formance, sprinted un touched 56 yards for a touchdown.
In this offensive showdown, the Huskies responded with two straight touchdowns -- a 64-yard touchdown pass from Mark Brunell to Jason Shelley, and an 18-yard touchdown strike from Brunell to Mark Bruener. Washington took a 21-17 lead into the halftime inter-
vs. WashingtonPasadena, CaliforniaJanuary 1, 1993Attendance: 94,236
Michigan 10 7 14 7-38
Washington 7 14 10 0-31
First Quarter M Elezovic 41-yard field goalWA Turner, 1-yard run (Hanson kick)M McGee, 49-yard pass from Grbac
(Elezovic kick)Second Quarter
M Wheatley, 56-yard run (Elezovic kick)
WA Shelley, 64-yard pass from Brunell (Hanson kick)
WA Bruener, 18-yard pass from Brunell (Hanson kick)
Third Quarter M Wheatley, 88-yard run (Elezovic
kick)WA Kaufman, 1-yard run (Hanson kick)WA Hanson, 44-yard field goalM Wheatley, 24-yard run (Elezovic
kick)Fourth Quarter
M McGee, 15-yard pass from Grbac (Elezovic kick)
Team Stats UM UWFirst Downs 16 19Net Yards Rushing 308 105Net Yards Passing 175 308Total Plays 66 74Total Yards 483 413PA/PC/Int 30/17/0 31/18/0Punts/Avg 6/37.0 5/39.2Return Yards 28 19Fumbles/Lost 1/0 1/1Penalties/Yards 8/72 5/43Time of Possession 28:12 31:48
SCORING
Rushing — (M): Wheatley 15-235; E. Davis 9-35; R. Powers 9-28; Legette 5-12; Grbac 1-(-2) (WA): Kaufman 20-39; Brunell 10-32; Turner 5-18; Thomas 2-8; Jones 2-4; Barry 4-4 Passing —-(M): Grbac 17-30-175 (WA): Brunell 18-30-308; Bjornson 0-1-0 Receiving — (M): McGee 6-117; Smith 3-19; Alexander 3-18; Hayes 1-10; Malveaux 1-5; Wheatley 2-4; Legette 2-4 (WA): Shelley 3-100; Bruener 4-85; D. Barry 2-61; Mack 2-33; Kralik 2-16; Jones 2-10; Turner 1-4; Kaufman 2-(-1)
1993 Rose Bowl
The 1994 Hall of Fame Bowl opened the New Year’s Day bowl festivities with an 11 a.m. kickoff in unusually wet conditions for the Tampa, Fla., site. By the time the rain subsided and the other New Year’s Day bowl games were set to begin, Mich igan was well on its way to a 42-7 trouncing of North Carolina State. Tyrone Wheatley, in his third consecutive tremendous bowl out-ing, was named the game’s MVP after compiling 124 rushing yards on 18 carries, in cluding touchdown runs of 26 and 18 yards.
Michigan opened the scoring early in the second quarter -- the first points in what would become consecutive 21-point quarters. Wheatley took a pitch from Todd Collins on a sweep to the right and blazed down the sidelines for a 21-yard score. On their subsequent pos-session, the Wolfpack were forced to punt, and Derrick Alexander made N.C. State pay. He fielded the punt at Michigan’s 21-yard line and burst up the middle of the field unchallenged for a 79-yard touchdown -- the longest punt return in Hall of Fame Bowl history.
The Wolverines put away the
Second QuarterM Wheatley, 26-yard run (Elezovic
kick)M Alexander, 79-yard punt return
(Elezovic kick)M Toomer, 31-yard pass from T.
Collins (Elezovic kick) 21-0Third Quarter
M Thompson, 43-yard interception return (Elezovic kick), 28-0
M Wheatley, 18-yard run (Elezovic kick)
NCS Fitzgerald, 12-yard pass from Bender (Videtich kick),35-7
M Powers, 16-yard run (Elezovic kick)
Team Stats UM NCSFirst Downs 21 18Net Yards Rushing 265 117Net Yards Passing 201 195Total Plays 67 74Total Yards 466 312PA/PC/Int 23/12/0 38/19/4Punts/Avg 6/47.0 6/42.0Return Yards 155 5Fumbles/Lost 1/0 4/2Penalties/Yards 5/35 3/15Time of Possession 27:29 32:31
SCORING
Rushing — (M): Wheatley 18-124; E. Davis 7-36; R. Powers 4-33; Buff 3-26; Biakabutuka 5-22; Foster 2-10; Ritchie 3-9; Collins 1-4; J. Carr 1-1; (NCS) Downs 13-102; George 3-21; Brown 7-11; Harvey 10-0; Fitzgerald 1-0; Goines 1-(-5); Bender 1-(-12)Passing — (M): T. Collins 11-22-189; J. Carr 1-1-12; (NCS): Harvey 13-27-108; Bender 6-10-87; Goines 0-1-0Receiving — (M): D. Jones 2-65; W. Smith 3-48; Toomer 2-44; Hayes 2-27; Richards 1-12; E. Davis 2-5; (NCS): Goines 7-72; Downs 4-34; Schultz 2-31; Hinton 2-25; George 2-16; Futzgerald 1-12; Brown 1-5
vs. North Carolina StateTampa, FloridaJanuary 1, 1994Attendance: 52,649
Michigan 0 21 21 0-42
N.C. State 0 0 7 0- 7
1994 Hall of Fame Bowl
game late in the half. Closing a 13-play, 85-yard drive, Collins, on fourth-and-10 from the Wolf pack 31, found Amani Toomer in the right corner of the endzone for a score. The conversion gave the Wolverines a 21-0 lead.
The scoring continued for Michigan in the third quarter, as it strung together two more touch-downs—on Clarence Thompson’s 43-yard interception return and Wheatley’s 18-yard scoring run -- before N.C. State finally broke the shutout with a touchdown of its own. Wheatley’s score -- his sixth bowl touchdown over the past three seasons -- was the 35th rushing TD of his career, breaking Rick Leach’s school record for career rushing TDs. It was also Wheatley’s 40th career touchdown, tying him with Anthony Carter for the most career TDs by a Wolverine. Ricky Powers closed the game’s scoring with a 16-yard TD run with 3:13 left in the third.
BOWL GAME SUMMARIES18
Michigan, who had taken its lumps on the defensive side of the ball during a 7-4 regular season, stuffed Colorado State when it recorded a 24-14 win at Jack Murphy Stadium that helped ease the sting of some painful late-season losses.
CSU nearly mirrored the Wolverines in total yardage (341-340), but gained just 51 yards rushing against a Michigan defense that forced four turnovers and had a key goal-line stand in the second half.
U-M struck first on the game’s open-ing drive on Todd Collins’ four-yard TD pass to Amani Toomer with 8:51 left in the opening quarter. The Rams took the ensuing kickoff and turned in a nine-play, 66-yard drive to tie the game, 7-7. The drive was culminated by Paul Turner’s 32-yard TD reception.
All-American Remy Hamilton booted a 34-yard field goal with 2:46 remaining in the first quarter to put Michigan ahead 10-7. A blocked punt by freshman Chris Howard gave U-M the ball deep in Rams territory with less than two minutes left before halftime. Collins then connected with Mercury Hayes for a 16-yard TD strike to put U-M ahead 17-7 with 1:28 left in the half.
The Wolverines forced a turnover on CSU’s first drive of the second half, taking over on the Rams’ 17-yard line.
vs. ColoradoStateSan Diego, CaliforniaDecember 30, 1994Attendance: 59,453
Michigan 10 7 7 0-24
Colorado St. 7 0 0 7-14
First Quarter M Toomer, four-yard pass from
Collins (Hamilton kick)CSU Turner, 32-yard pass from Hill
(McDougal kick)M Hamilton, 34-yard field goal
Second quarterM Hayes, 16-yard pass from Collins
(Hamilton kick)Third quarter
M Wheatley, three-yard run (Hamilton kick)
Fourth quarterCSU Burkett, 18-yard pass from Hill
(McDougal kick)
Team Stats UM CSUFirst Downs 18 20Net Yards Rushing 179 51Net Yards Passing 162 289Total Plays 60 75Total Yards 341 340PA/PC/Int 24/14/3 40/22/2Punts/Avg. 5/28.0 4/35.5Return Yards 74 117Fumbles/Lost 0/0 2/2Penalties/Yards 11/97 8/72Time of Possession 27:40 32:20
SCORING
Rushing — (M): Wheatley 16-80; Biakabutuka 9-70; E. Davis 1-13; Howard 3-9; Hayes 1-8; Floyd 1-2; Collins 6-(-3). (CSU): Watson 17-47; Ward 1-8; Carn 1-4; Brown 3-(-3); Hill 14-(-5).Passing — (M): Collins 14-24-162. (CSU): Hill 22-40-289. Receiving — (M): Toomer 5-63; Hayes 3-41; Foster 2-32; Richards 2-20; Wheatley 1-5; Cooper 1-1. (CSU): Shull 3-101; Burkett 5-62; Turner 4-62; Olsen 3-29; Watson 6-23; Ward 1-12.
1994 Holiday Bowl
Tyrone Wheatley made short work four plays later with a three-yard plunge into the endzone. That gave U-M a 24-7 lead with 11:58 left in the third quarter.
Midway through the third quarter, a 42-yard pass play helped CSU move the ball from its own 13-yard line to inside the Wolverine 10. A pair of pass interference calls against U-M gave the Rams seven plays to attempt to go eight yards into the endzone.
Four plays from the Michigan two-yard line turned up nothing for Colorado State, as a two-yard loss and incomplete pass on fourth down helped the Wolverines turn away the high-scoring Rams.
Michigan held a 24-7 advantage after three quarters and held that lead until 1:18 remained in the game. CSU finally cracked the stubborn U-M defense with an 18-yard TD pass by Anthony Hill to complete the scoring.
Collins threw for 162 yards (14-for-24) and two touchdowns, earning the game’s offensive MVP honors. The Michigan defense tallied 11 tackles for loss, driving the CSU offense back 61 yards.
to settle for a Remy Hamilton 26-yard field goal to close the gap to 16-13.
The Aggies again extended their lead to six early in the fourth quarter, then held off an ineffective Wolverine offense. After a 31-yard interception return gave the Aggies possession at the Michigan four-yard line, Bryant kicked a 37-yard field goal to put Texas A&M ahead, 22-13, with 23 sec-onds remaining.
The Wolverines showed strokes of brilliance in the final seconds, with Griese completing long passes to Mercury Hayes and Toomer, the latter going for 44 yards and a touchdown. The onside kick was unsuccessful, and the Aggies ran out the clock to hand U-M a 22-20 defeat.
For the game, Griese completed nine-of-23 passes for 182 yards. Five of those passes went to Toomer, who tallied 135 yards and two touch-downs. Michigan managed only 129 yards on the ground, an Alamo Bowl-record 94 coming from Biakabutuka and 36 from Clarence Williams.
Aggies placekicker and Alamo Bowl offensive MVP Kyle Bryant boot-ed a Michigan-opponent record five field goals in the game (27, 49, 47, 31 and 37 yards), and a Wolverine rally ran out of time at the third Alamo Bowl game.
Midway through the first quarter, Tshimanga Biakabutuka’s fumble was recovered by the Aggies on U-M's five-yard line. Two plays later, Eric Bernard took it in to give Texas A&M a 7-0 lead.
The Wolverines responded quick-ly. Aided by 35 yards in Aggie penal-ties, Michigan went 77 yards in two plays to tie the game. The drive was capped off by a 41-yard Brian Griese to Amani Toomer touchdown pass.
After the two teams traded field goals, the two defenses settled in, holding their opposition scoreless on the next four possessions. On its final possession of the half, Texas A&M drove to the Michigan 32-yard line, where Bryant kicked a career-best 49-yard field goal at the gun to give the Aggies a 13-10 halftime lead.
Texas A&M extended the lead with a 47-yard field goal with 5:34 left in the third quarter. Michigan took the kickoff at the 19-yard line and ran the ball down to the Texas A&M four-yard line in 11 plays. The Wolverines had
1995 Alamo Bowl
vs. Texas A&MSan Antonio, TexasDecember 28, 1995Attendance: 64,597
Michigan 7 3 3 7-20
Texas A&M 10 3 3 6-22
First QuarterA&M Bernard, nine-yard run (Bryant kick)M Toomer, 41-yard pass from Griese
(Hamilton kick)A&M Bryant, 27-yard Field Goal
Second QuarterM Hamilton, 28-yard Field GoalA&M Bryant, 49-yard Field Goal
Third QuarterA&M Bryant, 47-yard Field GoalM Hamilton, 26-yard Field Goal
Fourth QuarterA&M Bryant, 31-yard Field GoalA&M Bryant, 37-yard Field GoalM Toomer, 44-yard pass from Griese
(Hamilton kick)
SCORINGTeam Stats UM A&MFirst Downs 19 17Net Yards Rushing 129 130Net Yards Passing 182 136Total Plays 61 67Total Yards 311 266PA/PC/Int 23/9/1 22/12/0Punts/Avg 7/36.0 5/43.0Return Yards 81 78Fumbles/Lost 2/1 2/1Penalties/Yards 6/60 11/110Time of Possession 28:53 31:07
Rushing — (M): Biakabutuka 24-94; Williams 7-36; Hayes 1-17; Griese 6-(-18); (A&M): Parker 21-56; Hardeman 6-41; Bernard 15-40; Connell 1-7; Pullig 2-(-14)
Passing — (M): Griese 9-23-182; (A&M): Pullig 12-22-136
Receiving — (M): Toomer 5-135; Hayes 2-35; Riemersma 1-10; Biakabutuka 1-2; (A&M): Hardeman 3-41; Connell 3-36; Parker 3-23; Sanders 2-30; Spiller 1-6
19BOWL GAME HISTORY
The highly-regarded defensive units of Michigan and Alabama were showcased in the New Year’s Day Outback Bowl, but it was a Crimson Tide offense that led ‘Bama to a 17-14 victory.
Michigan entered the game ranked 18th nationally in total defense while Alabama brought the No. 8 defense into the game.Neither unit disappointed.
The Wolverines held the Crimson Tide to 247 yards of total offense and effectively shut down Alabama for most of the game.
Alabama opened the game’s scor-ing with a 43-yard Jon Brock field goal just 2:07 into the game.
Remy Hamilton knotted the game for Michigan with a 44-yard field goal with 8:03 left in the first half, then gave the Wolverines the lead with a 22-yard field goal 20 seconds before the intermission.
The turning point came as Michigan, already leading 6-3 early in the fourth quarter, worked a drive deep into Alabama territory. On third-and-five, quarterback Brian Griese, who started his first game of the season, attempted a short pass across the middle, but was deflected and intercepted by Alabama line-backer Dwayne Rudd. Rudd turned upfield and raced to an Outback Bowl record 88-yard interception return. The score, which came with
vs. AlabamaTampa, FloridaJanuary 1, 1997Attendance: 53,161
Alabama 3 0 0 14-17
Michigan 0 6 0 8-14
First QuarterUA Brock, 43-yard field goal
Second QuarterM Hamilton, 44-yard field goalM Hamilton, 22-yard field goal
Fourth QuarterUA Rudd, 88-yard interception return
(Brock PAT)UA Alexander, 46-yard run (Brock PAT)M Shaw, nine-yard pass from Griese
(Floyd run)
Team Stats UM ALFirst Downs 22 13Net Yards Rushing 124 182Net Yards Passing 291 65Total Plays 79 53Total Yards 415 247PA/PC/Int 38/22/1 18/9/1Punts/Avg. 7/26.1 6/46.5Return Yards 90 9Fumbles/Lost 3/0 2/1Penalties/Yards 6/47 8/42Time of Possession 34:32 25:28
SCORING
Rushing — (M): C. Williams 12-58; Floyd 6-35; Howard 12-27; Griese 10-5; Shaw 1-(-1); (A): Alexander 9-99; Riddle 13-58; Foust 5-29; West 1-4; Kitchens 7-(-8)Passing — (M): Griese 37-21-287; Woodson 1-1-4; (A): Kitchens 18-9-65Receiving — (M): Shaw 6-84; Williams 5-113; Knight 3-41; Woodson 3-25; Streets 2-12; Tuman 1-6; Shea 1-6; Griese 1-4; (A): Alexander 3-4; Vaughn 2-27; Rutledge 1-13; Hape 1-12; Riddle 1-6; Hall 1-3
1997 Outback Bowl
12:13 left in the game, gave the Crimson Tide a 10-6 lead that they never relinquished.
Alabama put the game away two possessions later when running back Shaun Alexander dashed 46 yards to put the Crimson Tide up 17-6 with 2:15 left in the game.
Griese hit receiver Russell Shaw with a nine-yard touchdown pass to end a nine-play, 80-yard drive with 1:16 left. After a pass-interference call, fullback Chris Floyd ran the ball in for a two-point conversion to bring Michigan to within three, 17-14.
The Crimson Tide recovered the onside kick and ran out the clock.
Michigan finished the game with 415 yards in total offense, but it was unable to put the ball in the end-zone. Three times the Wolverines failed to score after moving within the Alabama 35-yard line.
Griese completed 21-of-37 passes for 287 yards. He threw one touch-down and one interception.
Lindell hit a 48-yard field goal. Holding a slim 21-16 lead, the Wolverines embarked on their most important drive of the season. U-M’s 16-play series consumed 6:56 and saw Griese direct four third-down conver-sions. After lining up to attempt a potential 47-yard field goal, Jay Feely received the direct snap and proceed-ed to pooch punt. Pinned deep at their seven-yard line with 29 seconds left, the Cougars added a little drama to the final moments. Leaf connected with Nian Taylor on a 46-yard pass play on third down to cross into Michigan territory. After a delay of game penalty, Leaf threw to Love Jefferson who lateralled the ball to Jason Clayton for a 36-yard gain to the U-M 16-yard line. WSU was unable to stop the clock as time ran out. Dhani Jones recorded two sacks and a team-high 10 tackles, while Charles Woodson stopped a WSU drive with an endzone interception and recorded four PBUs. Offensively, Streets caught four passes for 127 yards and two TDs, and Chris Howard gained 70 yards rushing on 19 carries.
Michigan claimed its 11th national title with a 21-16 victory over Washington State at the Rose Bowl. The Wolverines' No. 1-ranked defense held the high-powered Cougars' offense to their lowest scoring output of the season, while Rose Bowl MVP Brian Griese completed 18-of-30 passes for 251 yards and three TDs. WSU took a 7-0 first-quarter lead on a 15-yard touchdown pass from Ryan Leaf to wide receiver Kevin McKenzie. U-M tied the score at seven enter-ing the half as Griese threw a 53-yard touchdown pass to wideout Tai Streets. After a Michigan punt pinned Washington State at the one-yard line, Leaf led a go-ahead 99-yard third-quarter scoring drive that ended with a 14-yard reverse by wide receiver Michael Tims. James Hall kept the defi-cit at 13-7 by blocking the extra point attempt. The Wolverines' offense responded immediately as Griese and Streets connected on a 58-yard TD, their second long scoring play of the game. Kicker Kraig Baker hit the PAT to give Michigan its first lead, 14-13. After a defensive stop, U-M extend-ed its lead to 21-13 as Griese rolled right and found tight end Jerame Tuman for the game-winning 23-yard touchdown. WSU scored the games final points with 7:25 remaining as kicker Rian
1998 Rose Bowl
vs. Washington StatePasadena, CaliforniaJanuary 1, 1998Attendance: 101,219
Washington St. 7 0 6 3 -16
Michigan 0 7 7 7 -21
First QuarterWS McKenzie 15 pass from Leaf (Lindell kick)
Second QuarterM Streets 53 pass from Griese (Baker kick)
Third QuarterWS Tims 14 reverse (Lindell kick block)M Streets 58 pass from Griese (Baker kick)
Fourth QuarterM Tuman 23 pass from Griese (Baker kick)WS FG Lindell 48
SCORINGTeam Stats WSU UMFirst Downs 18 22Net Yards Rushing 28-67 41-128Net Yards Passing 331 251Total Plays 71 63Total Yards 398 379PA/PC/Int 35/17/1 30/18/1Punts/Avg 6/40.3 6/30.5Return Yards 1/2 5/56Fumbles/Lost 0/0 0/0Penalties/Yards 4/43 4/40Time of Possession 27:46 32:14
Rushing — (M): Howard 19-70, Thomas 7-20, Griese 7-13, C Williams 2-12, Floyd 4-7, Woodson 2-6; (WSU): Black 7-24, Gilmore 8-20, Tims 1-14, Leaf 10-6, Clayton 2-3.Passing — (M): Griese 18-30-1-251; (WSU): Leaf 17-35-1-331.Receiving — (M): Shaw 6-49, Streets 4-127, Tuman 2-33, Howard 2-13, Thomas 1-14, Woodson 1-7, Campbell 1-7, Williams 1-1; (WSU): Jackson 5-89, McKenzie 5-78, McWashington 2-41, Tims 2-9, Taylor 1-46, Gilmore 1-42, Jefferson 1-8, Clayton 0-18.
BOWL GAME SUMMARIES20
The Michigan football team became the first Big Ten team to win the Citrus Bowl in five years with a 45-31 victory over No. 11 Arkansas. Trailing 31-24 with just 5:49 left in the game, the Wolverines rallied with 21 points in a span of 4:02 to win their 15th bowl game all-time. Anthony Thomas led the Wolverines with three rushing touch-downs and 139 yards on the ground. Thomas was named Citrus Bowl Most Valuable Player for his perfor-mance, while linebacker Sam Sword was named the Michigan Defensive MVP by the media for his 11-tackle performance. The Wolverines scored the games first points with 6:29 left in the first quarter when Jay Feely connected on a 43-yard field goal. Arkansas took a 7-3 lead on a 35-yard TD pass from Clint Stoerner to Michael Williams in the second quarter. Michigan responded with a two-yard touchdown run from Anthony Thomas, and a 46-yard interception return for a touchdown by line-backer Ian Gold. After Arkansas’ Todd Latourette booted a 42-yard field goal to trim the Wolverine lead to 17-10, Michigan marched 69 yards in
vs. ArkansasOrlando, FloridaJanuary 1, 1999Attendance: 67,584
Arkansas 0 10 14 7-31
Michigan 3 21 0 21-45
1999 CompUSA Citrus Bowl
just 1:38 and capped the drive with a five-yard touchdown run by Thomas. The Wolverines took a 24-10 lead into halftime.
The Razorbacks scored three con-secutive second half touchdowns to take a 31-24 lead midway through the fourth quarter.
Trailing for the first time since an early 7-3 deficit, Michigan responded with three consecutive touchdowns of its own. Anthony Thomas tied the game at 31, on a one-yard run.
After the Wolverine defense forced the Razorbacks to punt on their next possession, Brady found DiAllo Johnson in the endzone from 21 yards out with 2:25 remaining.
U-M cornerback James Whitley sealed the victory with 1:47 remain-ing, intercepting a Stoerner pass and returning it 26 yards for a touch-down.
Second QuarterAL Alexander 5-yard run (Pflugner
kick)AL Alexander 6-yard run (Pflugner
kick)M Terrell 27-yard pass from Brady
(Epstein kick)Third Quarter
M Terrell 57-yard pass from Brady (Epstein kick)
AL Alexander 50-yard run (Pflugner kick)
AL Milons 62-yard punt return (Pflugner kick)
M Terrell 20-yard pass from Brady (Epstein kick)
M Thomas 3-yard run (Epstein kick)
OvertimeM Thompson 25-yard pass from
Brady (Epstein kick)AL Carter 21-yard pass from Zow
(Pflugner kick failed)
Team Stats UM ALFirst Downs 18 12Net Yards Rushing 23-37 37-184Net Passing Yards 369 121Total Plays 70 57Total Yards 406 305A/PC/Int. 47/35/0 20/13/0Punts/Avg. 8/43.4 9/34.4Return Yards 115 182Fumbles/Lost 2/1 1/0Penalties/Yards 10/115 18/132Time of Possession 32:08 27:52
SCOriNg
rushing — (M):Thomas 18-40; Henson 1-8; Gold 1-5; Brady 3-(-16). (AL): Alexander 25-161; Watts 4-15; Milons 2-11; Bohanon 1-4; McClintock 3-3; Zow 2-(-10).Passing — (M): Brady 34-46-0-369; Henson 1-1-0-0. (AL): Zow 7-14-0-86; Watts 6-6-0-35.receiving — (M): Terrell 10-150; Shea 7-50; Walker 6-65; Thomas 4-2; Thompson 3-47; Knight 3-28; Joppru 1-24; Johnson 1-3. (AL): Carter 4-38; Milons 4-15; Alexander 2-21; Bowens 1-22; Jones 1-16; Buchanan 1-9.
2000 FedEx Orange Bowl
vs. AlabamaMiami, FloridaJanuary 1, 2000Attendance: 70,461
Michigan 0 7 21 0 7-35
Alabama 0 14 14 0 6-34
Michigan erased a pair of 14-point deficits in winning a thrilling 35-34 overtime game against Alabama in the 2000 FedEx Orange Bowl at Pro Player Stadium. The Wolverines played in, and won, their first over-time contest in school history. With the score knotted at 28 at the end of regulation, Michigan scored on its initial play of overtime when quarterback Tom Brady found tight end Shawn Thompson on a 25-yard TD pass. Kicker Hayden Epstein hit the extra point to give U-M a 35-28 lead, its first of the contest. On Alabama’s first possession of overtime, Andrew Zow hit Antonio Carter with a 21-yard TD pass on the second play of the drive. However, Alabama’s Ryan Pflugner pushed the extra point attempt wide right and Michigan claimed the victory. Sophomore wide receiver David Terrell was named Orange Bowl MVP after setting career bests in receiving yards (150) and receiving touch-downs (three) as well as equaling his career-high in receptions (10). Brady capped his career with a career-best four TD passes on 34-of-46 passing for a UM bowl record 369 yards. During regulation, Michigan trimmed the deficit to 14-7 with 58
seconds left in the first half when Brady hit Terrell on a 27-yard scoring strike. Michigan held Alabama on its first offensive possession of the second half and marched 59 yards to even the score at 14. The Crimson Tide responded with back-to-back touch-downs from Shaun Alexander and Freddie Milons. Michigan closed the gap when Brady and Terrell connected on a 20-yard TD pass with 5:42 left in the third quarter. After holding Alabama on its next possession, Michigan tied the game (28-28) as junior tailback Anthony Thomas scored on a three-yard run. The Wolverines dominated the fourth quarter, but a fumble heading into the endzone for the go-ahead score and a blocked 36-yard field goal attempt on the final play of reg-ulation, sent the game into overtime.
First QuarterM Feely 43-yard field goal
Second QuarterAR M. Williams 35 pass from Stoerner
(Latourette kick)M Thomas 2-yard run (Feely kick)M Gold 46-yard interception return
(Feely kick)AR Latourette 42-yard field goalM Thomas 5-yard run (Feely kick)
Third QuarterAR Chukwuma 2-yard run (Latourette kick)AR Chukwuma 1-yard run (Latourette kick)
Fourth QuarterAR Davenport 9 pass from Stoerner
(Latourette kick)M Thomas 2-yard run (Feely kick)M D. Johnson 21 pass from Brady
(Feely kick)M Whitley 26 -yard interception
return (Feely kick)
Team Stats AR UMFirst Downs 20 21Net Yards Rushing 40-116 46-204Net Passing Yards 232 230Total Plays 61 67Total Yards 348 434PA/PC/Int. 42/17/2 30/16/2Punts/Avg. 7/33.9 5/40.0Return Yards 81 78Fumbles/Lost 0-0 1-1Penalties/Yards 4/31 12/104Time of Possession 28:43 31:17
Rushing — (M): Thomas 21-132, C. Williams 19-72, Coleman 1-3, Brady 5-(-3); (AR): Chukwuma 17-56, Hill 13-35, Stoerner 8-14, Branch 1-9, Norman 1-2.Passing — (M): Brady 14-27-2-209; (AR): Stoerner 17-42-2-232.Receiving — (M): Streets 7-129, C. Williams 2-15, Shea 2-10, Terrell 1-26, D. Johnson 1-21, Thomas 1-12, Campbell 1-11, Knight 1-6; (AR): M. Williams 7-90, Lucas 3-63, Smith 3-19, Morreale 1-36, Hill 1-14, Davenport 1-9, Chukwuma 1-1.
SCOriNg
21BOWL GAME HISTORY
2001 Capital One Florida Citrus Bowl
An efficient passing offense and a relentless ground attack led Michigan to a 31-28 victory over Auburn in the 2001 Florida Citrus Bowl. Drew Henson completed 15-of-20 passes for 294 yards and a pair of touchdowns, while tailback Anthony Thomas rushed 32 times for 182 yards and two touchdowns.
On its second possession, Michigan brought a trick out of the bag, using a flea-flicker to fool the Tigers’ defense and score a 31-yard touchdown pass from Henson to David Terrell. This 76-yard drive in 70 seconds set Michigan’s efficient tempo for the game.
Auburn struck back early in the second quarter when senior quar-terback Ben Leard hooked up with wideout Ronney Daniels on a 19-yard touchdown pass. Leard hit Clifton Robinson for a 20-yard touchdown on the Tigers’ next drive. Leard threw for 394 yards on the day, mostly in an effort to keep up with the Wolverine offense.
Michigan scored the next three touchdowns of the game due in large part to Thomas’ brutish run-ning. He racked up two touchdowns and became U-M’s all-time leading rusher and scorer.
In the midst of the Wolverines’ offensive explosion, sophomore
vs. AuburnOrlando, FloridaJanuary 1, 2001Attendance: 66,928
Michigan 7 14 10 0-31 Auburn 0 14 7 7-28
safety Julius Curry and senior safety DeWayne Patmon each made key interceptions to halt Auburn drives into Michigan territory. Other defen-sive stars for the Wolverines included junior linebackers Eric Brackins and Larry Foote with 13 and eight tackles, respectively, and senior lineman Eric Wilson with six tackles and a sack.
Though Leard and junior running back Rudi Johnson tried to bring Auburn back, junior kicker Hayden Epstein connected on a 41-yard field goal towards the end of the third-quarter, giving U-M a 31-21 lead. Auburn added another late touch-down, but Michigan recovered an onside kick with 2:22 remaining and held on for the victory.
M Terrell 31-yard pass from Henson (Epstein kick)
AU Daniels 19-yard pass from Leard (Duval kick)
AU Robinson 20-yard pass from Leard (Duval kick)
M Askew 4-yard pass from Henson (Epstein kick)
M Thomas 11-yard run (Epstein kick)M Thomas 25-yard run (Epstein kick)AU Johnson 12-yard run (Duval kick)M Epstein 41-yard field goalAU Green 21-yard pass Leard
(Duval kick)
Team Stats AU UMFirst Downs 23 21Rushed-Yards 35-92 42-159Passing Yards 394 294Passes 28-37-2 15-20-0Total Offense 72-486 63-453Sacked-Yards Lost 2-15 5-45Punts 3-42.7 4-43.5Return Yards 91 78Fumbles-Lost 2-1 2-1Penalties-Yards 7-60 2-20Third Down Conv. 8-14 5-12Time of Possession 30:03 29:57
Rushing — (M): Thomas 32-182; Bellamy 3-16; Cross 1-0; Henson 6-(-36). (AU): Johnson 25-85; Evans 3-16; Robinson 1-4; Carter 2-(-2); Leard 4-(-11).Passing — (M): Henson 15-20-0-294; Thomas 0-1-0-0. (AU): Leard 28-37-2-394.Receiving — (M):Terrell 4-136; Walker 4-100; Thomas 4-32; Askew 3-26. (AU) Daniels 7-98; Willis 5-69; Evans 4-51; Green 4-49; Robinson 3-70; Carter 3-42; Johnson 2-15.
SCORING
2002 Capital One Florida Citrus Bowl
vs. TennesseeOrlando, FloridaJanuary 1, 2002Attendance: 59,653
Michigan 0 10 0 7-17 Tennessee 10 14 7 14-45
Tennessee won the first-ever meeting between the two schools and in the process ended Michigan’s streak of four straight Jan. 1 bowl victories with a 45-17 win on New Year’s Day. Tennessee scored the first 17 points of the game, then added another 21 unanswered points to start the second half.
B.J. Askew was named U-M’s Offensive MVP and senior linebacker Larry Foote garnered the Defensive MVP by the media. UT quarterback Casey Clausen was named the game’s Most Valuable Player.
Askew gained 71 rushing yards on nine carries and added a 14-yard touchdown on a screen pass. Marquise Walker caught five passes for 100 yards and junior/sophomore quarterback John Navarre completed 21-of-39 passes for 240 yards and two TDs.
Foote recorded a team-high nine tackles and two pass breakups with outside linebacker Victor Hobson adding eight stops.
Tennessee jumped out to a 17-0 lead on a 32-yard field goal by Alex Walls, a three-yard slant to Kelley Washington and Clausen’s one-yard scramble to begin the second quar-ter.
Michigan trimmed the deficit to 17-7 as Navarre completed a 14-yard
screen pass to Askew for a touch-down. The punt rush team set up U-M’s best field position of the game by forcing a six-yard punt by the Volunteers.
UT answered on the ensuing pos-session as Clausen scored his second straight TD on a one-yard keeper.
Utilizing their two-minute offense, the Wolverines moved inside the 10-yard line but settled for a 28-yard field goal by Hayden Epstein with 37 seconds left in the half.
The Volunteers struck quickly in the third quarter as Clausen com-pleted a 64-yard TD pass to Witten that gave UT a 31-10 lead.
Tennessee scored a pair of touchdowns in the fourth quarter as Washington caught a 37-yard TD reception and Travis Stephens scored on a three-yard run.
The Wolverines found the end zone with 9:32 remaining as Navarre completed a 24-yard TD pass to wide receiver Calvin Bell.
SCORING
T Walls 32-yard field goalT Washington 3-yard pass from Clausen
(Walls kick)T Clausen 1-yard run (Walls kick)M Askew 14-yard pass from Navarre
(Epstein kick)T Clausen 1-yard run (Walls kick)M Epstein 28-yard field goalT Witten 64-yard pass from Clausen
(Walls kick)T Washington 37-yard pass from
Clausen (Walls kick)T Stephens 3-yard run (Walls kick)M Bell 24-yard pass from Navarre
(Epstein kick)
Team Stats UM UTFirst Downs 20 22Rushed-Yards 31-103 37-97Passing Yards 240 406Passes 39-21-1 35-27-0Total Offense 70-343 72-503Sacked-Yard Lost 4-18 4-22Punts 7-277 5-159Return Yards 139 121Fumbles-Lost 4-2 3-1Penalties-Yards 6-42 3-32Third Down Conv. 6-16 7-13Time of Possession 25:47 34:13
Rushing — (M): Askew 9-71; Perry 17-39; Bell 1-11; Navarre 4-(-18). (T): Stallworth 2-44; Stephens 16-38; Scott 1-21; Fleming 2-5; Davis 3-4; Bartholomew 1-1; Tinsley 1-(-1); Houston 2-(-1); Clausen 9-(-14).Passing — (M): Navarre 39-21-1-240. (T): Clausen 34-26-0-393; Washington 1-1-0-13.Receiving — (M): Walker 5-100; Joppru 5-45; Seymour 4-35; Bell 2-29; Askew 2-23; Perry 2-3; Butler 1-5. (T): Stallworth 8-119; Witten 6-125; Washington 6-70; Graham 2-28; Brown 2-5; Parker 1-22; Stephens 1-19; Finlayson 1-18.
BOWL GAME SUMMARIES22
2003 Outback Bowl
vs. FloridaTampa, FloridaJanuary 1, 2003Attendance: 65,101
Florida 0 16 7 7-30 Michigan 7 14 14 3-38
Michigan claimed a 38-30 victory in a back-and-forth affair against No. 22 Florida in the 2003 Outback Bowl at Raymond James Stadium.
Tailback Chris Perry earned Outback Bowl MVP honors after setting a bowl game record and a modern era U-M bowl record with four touchdowns. Perry matched his career high with 28 carries for 85 yards and four TDs, and added a career-best six receptions for 108 yards. Quarterback John Navarre completed 21-of-36 passes for a career-high 319 yards and one score.
Victor Hobson tallied a career-best 12 tackles and two tackles for loss, and secured the win with an inter-ception on Florida’s final drive. Michigan took advantage of a Florida turnover as Perry scored on a four-yard touchdown run late in the first quarter. U-M gained possession at the Florida three-yard line after recovering an errant shotgun snap. Florida, however, answered to take a 13-7 lead early in the second quar-ter on a pair of TD runs by tailback Ernest Graham. U-M took control of the game on a 12-play scoring drive as Perry leaped over the goal line on a fourth-down play from the one-yard line. The Gators regained the lead, 16-14, with 1:37 left in the first half as placekicker Matt Leach connected on a 29-yard field goal, but Michigan responded to take a 21-16 halftime
advantage as Navarre completed an eight-yard touchdown pass to Bellamy with 27 seconds left. Florida scored on its opening pos-session of the second half to gain a 23-21 lead. The Wolverines answered the Gators’ TD and took the lead for good, 28-23, on a seven-yard TD run by Perry. U-M extended its lead to 35-23 as Perry scored his fourth TD of the game, a 12-yard run through the middle of the defense. Florida trimmed the deficit to 35-30 with 8:21 remaining as Grossman fired a three-yard TD pass to tight end Aaron Walker. On the Gator’s next possession, a Hobson sack forced Florida to punt the ball away. U-M got the ball back and extended its lead to 38-30 with 2:20 left as kicker Adam Finley con-nected on a 33-yard field goal. The Gators attempted to mount one final drive to tie the game. After reaching the Wolverine 37-yard line, Florida tried a wide receiver reverse pass, but it was intercepted by Hobson to seal Michigan’s victory.
SCORING
M Perry 4-yard run (Finley kick)F Graham 2-yard run (Leach kick)F Graham 1-yard run (Carthon rush
failed)M Perry 1-yard run (Finley kick)F Leach 29-yard field goalM Bellamy 8-yard pass from Navarre
(Finley kick)F Ratliff 33-yard pass from Grossman
(Leach kick)M Perry 7-yard run (Finley kick)M Perry 12-yard run (Finley kick)F Walker 3-yard pass from Grossman
(Leach kick)M Finley 33-yard field goal
Team Stats UF UMFirst Downs 28 17Rushed-Yards 43-183 37-104Passing Yards 323 319Passes 42-21-1 37-21-0Total Offense 85-506 74-423Sacked-Yards Lost 4-20 1-4Punts 8-257 9-347Return Yards 111 116Fumbles-Lost 2-2 1-0Penalties-Yards 6-38 3-23Third Down Conv. 5-14 3-15Time of Possession 27:21 32:39
Rushing — (M): Perry 28-85, Bellamy 2-20, Askew 2-9, Team 3-(-4), Navarre 2-(-6). (F): Graham 22-120, Carthon 6-56, Grossman 11-23, Ratliff 2-7, Fason 1-0, Team 1-(-23). Passing — (M): Navarre 36-21-0-319, Team 1-0-0-0. (F): Grossman 41-21-0-323, Brown 1-0-1-0. Receiving — (M): Perry 6-108, Joppru 6-80, Edwards 4-110, Bellamy 2-11, Askew 2-6, Gonzales 1-4. (F): Jacobs 7-88, Carthon 3-65, Kight 3-52, Small 3-37, Walker 2-11, Ratliff 1-33, Troupe 1-27, Green 1-10.
2004 Rose Bowl
vs. Southern CaliforniaPasadena, CaliforniaJanuary 1, 2004Attendance: 93,849
USC 7 7 14 0-28 Michigan 0 0 7 7-14
Top-ranked Southern California aired it out in a 28-14 win against No. 4 Michigan in the 90th Rose Bowl game, claimed its ninth Associated Press national title.
USC quarterback Matt Leinart, who was voted the game's most valuable player, completed 23 of his 34 pass attempts for 327 yards and three touchdowns. USC managed to score four receiving touchdowns on Michigan's top rated pass defense.
U-M quarterback John Navarre finished his career by completing 27 of his 46 passes for 271 yards and a touchdown. Navarre was sacked a season-high nine times. Tailback Chris Perry carried 23 times for 85 yards and one score. Braylon Edwards added 10 catches for 107 yards.
The Wolverines threatened on their opening possession of the game, as they moved from their own 20 to the Trojans' 21. However fresh-man kicker Garrett Rivas' 48-yard field goal attempt was blocked by USC Shaun Cody. The Trojans took over and needed just four plays to score. The TD came on a 25-yard strike down the left hashmarks to Keary Colbert.
Michigan began its next-to-last drive of the first half at its own 6. The Wolverines gained a first down, but on third-and-18 from their 9, Navarre's pass bounced off Edwards' heel and into the hands of USC line-backer Lofa Tatupu. On third down
from the six, Leinart tossed a soft pass to LenDale White in the left flat and he scrambled into the end zone for a 14-0 lead at the half. Behind 21-0 early in the third quarter, Michigan answered with a 16-play, 76-yard drive. On second down from the USC five-yard line, Navarre fired a strike to tight end Tim Massaquoi. The touchdown pass was the 72nd of Navarre's career, break-ing a tie with Elvis Grbac for the U-M all-time passing TD lead. The Trojans answered with an eight-play, 72-yard drive to take a 28-7 lead. The Mike Williams took a reverse pitch and fired a 15-yard strike to a wide-open Leinart. Michigan opened the fourth quar-ter with an 11-play, 85-yard drive to cut the USC lead to 28-14 with 11:06 remaining. From the two-yard line, Perry took a toss from Navarre and followed his blockers around the right side for the TD. Leinart then fumbled a snap, which resulted in a turnover. Michigan was unable to take advan-tage and turned the ball over on downs. The Trojans ran out the clock.
SCORINGSC Colbert 25-yard pass from Leinart (Killeen kick)SC White six-yard pass from Leinart (Killeen kick)SC Colbert 47-yard pass from Leinart (Killeen kick)M Massaquoi five-yard pass from Navarre (Rivas kick)SC Leinart 15-yard pass from Williams (Killeen kick)M Perry two-yard run ( Rivas kick)
Team Stats USC UMFirst Downs 19 25Rushed-Yards 25-68 38-49Passing Yards 342 271Passes 35-24-0 46-27-1Total Offense 60-410 84-320Sacked-Yards Lost 1-11 9-69Punts 3-46.7 4-44.0Return Yards 75 48Fumbles-Lost 2-1 3-0Penalties-Yards 3-22 2-10Third Downs 6-11 9-19Possession Time 25:34 34:26
Rushing — (SC): Bush 8-41, White 8-26, Dennis 7-17, Leinart 2-(-16). (M): Perry 23-85, Breaston 2-21, Rembert 1-1, Navarre 12-(-58). Passing — (SC): Leinart 34-23-0-327, Williams 1-1-0-15. (M): Navarre 46-27-1-271.Receiving — (SC): Williams 8-88, Colbert 6-149, Bush 2-42, Hancock 2-8, White 2-4, Guenther 1-19, Leinart 1-15, Smith 1-9, Kirtman 1-8. (M): Edwards 10-107, Breaston 6-61, Avant 4-61, Ecker 3-31, Perry 2-1, Massaquoi 1-5, Thompson 1-5.
23BOWL GAME HISTORY
2005 Rose Bowl
vs. TexasPasadena, CaliforniaJanuary 1, 2005Attendance: 93,468
Texas 7 7 7 17-38 Michigan 0 14 17 6-37
Dusty Mangum’s 37-yard field goal as time expired gave No. 6 Texas a 38-37 win over the No. 13 Michigan in the 91st Rose Bowl Game. Braylon Edwards led U-M with 10 catches for 109 yards and three touchdowns. Edwards became the Big Ten’s career receiving TD leader, closing his career with 39 scores to surpass the 37 TDs attained by for-mer Wolverine Anthony Carter (1979-82). After an early Texas touchdown, Edwards evened the score at 7-7 with 12:08 left in the second quarter on a 39-yard TD pass from Chad Henne along the left side of the Texas end zone. Edwards’ scored was the 37th of his career, tying the Big Ten and U-M school record. The four-play scor-ing drive covered 50 yards in 1:39. Hart had runs of five, three and three yards to move the chains prior to the score. Texas regained the lead at 14-7, then U-M took advantage of the game’s first turnover and knotted the score at 14 prior to half as Henne tossed an eight-yard TD pass to Edwards. The Wolverines gained their first lead of the game at 6:29 of the third quarter, 28-21, as Henne tossed a nine-yard TD pass to Edwards on a slant pass. U-M’s balanced scoring drive moved 77 yards in 10 plays, with 40 yards coming through the air and 32 on the ground.
After a Michigan field goal, Texas quarterback Vince Young scored his third rushing TD of the game, a 10-yard run at 9:51 of the fourth quarter, and trimmed the deficit to 31-28. The Wolverines boosted their lead to 34-28 with 6:09 left as Rivas converted a 32-yard field goal. U-M answered the UT score, moving 60 yards in 11 plays. However Texas quickly drove down the field for another score, taking a 35-34 lead. Breaston began the Wolverines’ next drive with a 53-yard kickoff return. It was his sixth kickoff return of the game for a total of 221 yards, setting Michigan and Rose Bowl records. Hart carried for 18 yards in the next three plays, ending on the 25-yard line, where Rivas completed the drive with a 42-yard field goal. This was his third field goal of the game, tying the Rose Bowl record. Mangum capped the Longhorns’ 10-play winning drive with his 37-yard field goal as time expired.
SCORINGUT Young 20-yard run (Mangum kick)M Edwards 39-yard pass from Henne (Rivas kick)UT Thomas 11-yard pass from Young (Mangum kick)M Edwards 8-yard pass from Henne (Rivas kick)UT Young 60-yard run (Mangum kick)M Breaston 50-yard pass from Henne (Rivas kick)M Edwards 9-yard pass from Henne (Rivas kick)M Rivas 44-yard field goalUT Young 10-yard run (Mangum kick)M Rivas 32-yard field goalUT Young 23-yard run (Mangum kick)M Rivas 42-yard field goalUT Mangum 37-yard field goal
Team Stats UT UMFirst Downs 25 17Rushed-Yards 46-264 31-125Passing Yards 180 227Passes 28-16-1 34-18-0Total Offense 74-444 65-352Sacked-Yards Lost 1-5 1-10Punts 4-39.8 5-42.0Return Yards 223 255Fumbles-Lost 1-1 1-0Penalties-Yards 5-40 9-67Third Downs 12-17 6-14Possession Time 32:40 27:20
Rushing — (UT): Young 21-192, Benson 23-70, Matthews 1-1, Taylor 1-1. (M): Hart 21-83, Martin 3-18, Edwards 2-17, Breaston 3-15, Henne 2-(-8). Passing — (UT): Young 28-16-1-180. (M): Henne 34-18-0-227.Receiving — (UT): Scaife 5-68, Thomas 4-54, Jeffrey 4-38, Matthews 1-8, Taylor 1-7, Jones 1-5. (M): Edwards 10-109, Breaston 3-77, Massaquoi 2-19, Ecker 2-18, Hart 1-4.
2005 Alamo Bowl
vs. NebraskaSan Antonio, TexasDecember 28, 2005Attendance: 62,016
Michigan 7 7 7 7-28 Nebraska 7 7 3 15-32
The Wolverines were edged by the Nebraska Cornhuskers in a back-and-forth shootout at the 2005 Alamo Bowl. Despite relentless defensive pressure by Michigan (14 tackles for loss), the resilient Husker offense put up enough points for the vic-tory. The San Antonio Alamodome saw two teams with a potent pass-ing attack, and a plethora of self-inflicted wounds. Michigan and Nebraska combined for 15 penalties and five turnovers in the game. The Cornhuskers’ Zac Taylor passed for 167 yards and three touchdowns, while Wolverine Chad Henne threw for 270 yards and 3 touchdowns. Both teams got on the board quickly, with touchdowns on each team's opening drive of the game. Quarterback Zach Taylor hit receiver Terrance Nunn on a slant for a 52-yard score. On the ensuing kickoff, Steve Breaston had an Alamo Bowl record 69-yard return to the Nebraska 30. Shortly thereafter, Michigan capitalized with a 13-yard pass from Henne to tight end Tyler Ecker, knotting the score at 7-7. Nebraska’s next two possessions ended in interceptions on consecu-tive plays by cornerback Leon Hall, the Alamo Bowl Defensive MVP. Michigan was able to convert on one of those turnovers with a 16-yard touchdown pass from Henne to tight end Mike Massey. The Huskers responded with a seven-play, 70-yard
touchdown drive, on a Nate Swift 14-yard touchdown catch. As a result, both teams headed into halftime tied at 14. With a 21-yard TD pass to Mario Manningham and a seven-yard touchdown scramble, Henne sparked 28-17 Wolverine lead with less than a quarter to play. Nebraska responded with a 31-yard touchdown run by Cory Ross to pull within three points, 28-25, with 8:08 remaining. Michigan turned the ball over three times in the final 16 minutes, twice on fumbles with under eight minutes remaining in the regula-tion and an end zone interception. Terrance Nunn caught his second score on a 13-yard reception for the winning margin following a ruled fumble that gave the Husker's pos-session at U-M's 17-yard line. Michigan’s remaining two pos-sessions were thwarted, including a desparation lateral play that nearly went the distance as time expired.
SCORINGN Nunn 52-yard pass from Taylor (Congdon kick)M Ecker 13-yard pass from Henne (Rivas kick)M Massey 16-yard pass from Henne (Rivas kick)N Swift 14-yard pass from Taylor (Congdon kick)N Congdon 20-yard field goalM Manningham 21-yard pass from Henne (Rivas kick)M Henne 7-yard run (Rivas kick)N Ross 31-yard run (Peterson pass from Taylor)N Nunn 13-yard pass from Taylor (Congdon kick)
Team Stats UM UNFirst Downs 23 16Rushed-Yards 42-130 37-151Passing Yards 270 167Passes 43-21-1 31-14-2Total Offense 85-400 68-318Sacked-Yards Lost 4-22 5-27Punts 7-34.9 8-51.5Return Yards 258 91Fumbles-Lost 4-2 0-0Penalties-Yards 6-49 9-76Third Downs 5-17 4-16Possession Time 31:21 28:39
Rushing — (M): Hart 19-74, Henne 13-38, Grady 5-17, Bass 3-4, Team 1-(-1), Breaston 1-(-2). (N): Ross 28-161, Lucky 1-3, Team 1-(-3), Taylor 7-(-10). Passing — (M): Henne 43-21-1-270. (N): 31-14-2-167.Receiving — (M): Avant 8-71, Manningham 3-28, Bass 3-24, Hart 2-35, Massey 2-18, Ecker 1-71, Bradley 1-15, Breaston 1-8. (N): Nunn 4-91, Swift 3-31, Hardy 3-27, Ross 3-8, Phillips 1-10.
BOWL GAME RECORDS24
2007 Rose Bowl
vs. USCPasadena, Calif.January 1, 2007Attendance: 93,852
USC 3 0 16 13-32 Michigan 0 3 0 14-18
Michigan was unable to overcome a pair of turnovers and 16 unan-swered points in the third quarter to Southern California, losing 32-18 in the 93rd Rose Bowl Game. The Trojans snapped a 3-3 halftime tie and scored 16 unanswered points in the third quarter following a pair of turnovers by the Wolverines. After a 26-yard field goal by Trojan kicker Mario Danelo, Michigan answered with one of its own, a 43-yard field goal by Garrett Rivas at 13:35 of the second quarter. Quarterback Chad Henne completed his first five passes of the drive for 50 yards before a pair of incom-plete passes ended the series at the Trojans’ 26-yard line. The Trojans threatened on the fol-lowing drive, but linebacker Shawn Crable stripped the ball from quarter-back Josh Booty and defensive tackle Alan Branch recovered at the U-M 21-yard line. Both teams were held scoreless for the remainder of the half, entering halftime with a 3-3 tie. The Trojans regained the lead in the third quarter, 10-3, on a two-yard touchdown pass from Booty to Chris McFoy. The USC lead was extended to 19-3 with a 22-yard hookup between Dwayne Jarrett and Booty and a 26-yard field goal by Danelo. Michigan kept hope alive early in the fourth quarter as Henne com-pleted an 11-yard touchdown pass to receiver Adrian Arrington. The scor-
ing drive covered 80 yards in eight plays, with Henne completing all six passes for 62 yards. Tailback Mike Hart rumbled into the end zone on the two-point conversion to trim the deficit to 19-11. The Trojans answered with a 62-yard touchdown pass on a fly pattern from Booty to Jarrett and a seven-yard touchdown pass from Booty to Steve Smith, increasing the advantage to 32-11. The Wolverines would only respond with a 41-yard scoring pass from Henne to receiver Steve Breaston.
SCORINGUSC Danelo 26-yard field goalU-M Rivas 43-yard field goalUSC McFoy 2-yard pass from Booty (Danelo kick)USC Jarrett 22-yard pass from Booty (Danelo kick failed)USC Danelo 26-yard field goalU-M Arrington 11-yard pass from Henne (Hart rush)USC Jarrett 62-yard pass from Booty (Danelo kick)USC Smith 7-yard pass from Booty (Danelo kick)U-M Breaston 41-yard pass from Henne (Rivas kick)
Team Stats USC U-MFirst Downs 21 19Rushed-Yards 23-48 27-12Passing Yards 391 309Passes 45-27-0 41-26-1Total Offense 68-439 68-321Sacked-Yards Lost 1-8 6-44Punts 4-35.2 6-41.8Return Yards 66 52Fumbles-Lost 1-1 1-10Penalties-Yards 3-27 2-20Third Downs 8-15 7-15Possession Time 30:02 29:58
Rushing — (USC): Gable 13-25, Bradford 4-19, Washington 2-8, Booty 4-(-4). (U-M): Hart 17-47, Minor 2-3, Manningham 1-2, Henne 1-(-40). Passing — (USC): Booty 45-27-0-391. (U-M): Henne 41-26-1-309.Receiving — (USC): Jarrett 11-205, Smith 7-108, Davis 3-39, McFoy 2-24, Gable 2-(-3), Brittingham 1-14, Bradford 1-4. (U-M): Breaston 7-115, Manningham 6-78, Arrington 4-34, Hart 2-(-2), Butler 1-5.
until eight seconds remained in the half. Henne hit Adrian Arrington, his favorite target of the game, on a one-yard out to give the squad a 21-14 halftime lead. Arrington finished his career-day collecting 153 yards and a pair of touchdowns on nine receptions. The Wolverines recovered their own kickoff to begin the second half, setting up Mike Hart’s second touchdown and a 28-14 lead. Florida responded with two scores to level the match at 28-28, but Michigan claimed a 31-28 edge with a 37-yard field goal. Florida regained the lead 35-31, but Michigan tallied ten unanswered points to close the contest. Michigan’s final touchdown resulted from a four play drive, highlighted by two spectacular Arrington catches for 37-yards and an 18-yard touchdown. Michigan drilled a 41-yard field goal between two Florida four-and-outs, sealing the Wolverine victory.
SCORING
2008 Capital One Bowl
vs. FloridaOrlando, Fla.January 1, 2008Attendance: 93,852
Michigan 7 14 7 13-41 Florida 7 7 14 7-35
In Lloyd Carr’s final game as Michigan’s head coach, the Wolverines battled to an emotional victory over ninth-ranked Florida in the 2008 Capital One Bowl. The game provided the graduating seniors their first post-season victory and improved Carr’s 13-year head coach-ing record to 122-40. Despite three turnovers inside the opposition’s 5-yard line, the Maize and Blue recorded a season-high in points scored with a 41-35 triumph over the Gators. An aggressive Wolverine attack, which finished with 524 yards of total offense, struck on its first possession. After storming down the field 93-yards, Chad Henne collaborated with Mario Manningham on a 21-yard connection, giving the team a 7-0 advantage. Henne completed 25-of-39 attempts for 373 yards and three touchdowns on the day, earning the game’s Most Valuable Player award. After Florida stalled on their first possession, the Gator’s answered with two consecutive scores to grasp a 14-7 lead, but Mike Hart evened the scoreboard with a 3-yard run in the second quarter. In his Michigan send-off, Hart carried the ball 32 times for 129 and two trips to the end zone. On the following drive, Terrance Taylor blocked a 35-yard field goal attempt, locking the score
U-M Manningham 21-yard pass fromHenne (Lopata kick)
UF Harvin 10-yard pass from Tebow(Ijjas kick)
UF Caldwell 18-yard pass from Tebow(Ijjas kick)
U-M Hart 3-yard run (Lopata kick)U-M Arrington 1-yard pass from Henne
(Lopata kick)U-M Hart 1-yard run (Lopata kick)UF Tebow 1-yard run (Ijjas kick)UF Caldwell 14-yard pass from Tebow
(Ijjas kick)U-M Lopata 37-yard field goalUF Harvin 10-yard run (Ijjas kick)U-M Arrington 18-yard pass from Henne
(Lopata kick)U-M Lopata 41-yard field goal
Team Stats U-M UFFirst Downs 28 18Rushed-Yards 47-151 32-230Passing Yards 373 169Passes 39-25-2 34-18-0Total Offense 86-524 66-399Sacked-Yards Lost 3-24 1-9Punt 2-44.5 3-39.3Return Yards 139 102Fumbles-Lost 4-2 1-0Penalties-Yards 8-65 9-49Third Downs 10-15 2-11Possession Time 32:18 27:42
Rushing — (U-M): Hart 32-129, Manningham 7-53, Minor 1-(-2), Team 3-(-5), Henne 4-(-24). (UF): Harvin 13-165, Tebow 16-57, Moore 2-9, Team 1-(-1). Passing — (U-M): Henne 39-25-2-373. (UF): Tebow 33-17-0-154, Henry 1-1-0-15..Receiving — (U-M): Arrington 9-153, Mathews 7-62, Manningham 5-78, Butler 1-65, Hart 1-7, Hemingway 1-4, Moundros 1-4. (UF): Harvin 9-77, Caldwell 4-40, Hernandez 3-31, Ingram 1-17, Murphy 1-4.
25BOWL GAME HISTORY
different receiver. The Bulldogs continued the scoring affair with 21 unanswered points to close out the first half, taking a 31-14 lead into the break. The Michigan defense forced the Bulldogs into their first punt of the game on the opening series of the second half, and receiver Junior Hemingway gave U-M excellent field position as he returned the punt 33 yards to the Bulldogs' 23-yard line. However, the Maize and Blue were unable to stage a comeback as MSU continued to score, closing out the game with six unanswered touchdown scores after the early Michigan lead to give the Bulldogs a 52-14 Gator Bowl victory.
SCORING
2011 Gator Bowl
vs. Mississippi St.Jacksonville, Fla.January 1, 2011Attendance: 77,497
Miss. St. 10 21 14 7-52 Michigan 14 0 0 0-14
The University of Michigan football team was unable to climb out from a first-half deficit at the 2011 Gator Bowl on New Year's Day, falling 52-14 to No. 21 Mississippi State at Everbank Field. The Wolverines were unable to even their all-time bowl record and finish the campaign with a 7-6 record. Michigan took the opening kickoff and marched 78 yards in 10 plays to take a 7-0 lead on a 10-yard pass from Denard Robinson to Roy Roundtree. Robinson had two huge runs during the drive, a run of 24 yards into Bulldogs territory and a 22-yard scamper to the 11-yard line, while completing all three passes for 27 yards. Mississippi State answered on its opening possession on a four-yard pass from Chris Relf to receiver Arceto Clark on third-and-goal. After holding the Wolverines on their second possession, the Bulldogs grabbed the lead, 10-7, on a 42-yard field goal by Derek Depasquale. The Wolverines took the ensuing kickoff and regained the lead, 14-10, on a 27-yard touchdown pass to Martavious Odoms with 34 seconds left in the first quarter. The five-play drive covered 72 yards in 100 seconds. Robinson completed all four passes for 72 yards, with each of the four completions coming to a
U-M Roundtree 10-yard pass from Robinson (Gibbons kick)MSU Clark 4-yard pass from Relf (DePasquale kick)MS DePasquale 42-yard field goalU-M Odoms 27-yard pass from Robinson (Gibbons kick)MSU Ballard 2-yard run (DePasquale kick)MSU Relf 1-yard run (DePasquale kick)MSU Sanders 15-yard pass from Relf (DePasquale kick)MSU Ballard 1-yard run (DePasquale kick)MSU Ballard 7-yard run (DePasquale kick)MSU Carr 31-yard pass from Relf (DePasquale kick)
Team Stats MSU U-MFirst Downs 26 17Rushed-Yards 58-204 25-88Passing Yards 281 254Passes 23-18-1 41-27-1Total Offense 81-485 66-342Sacked-Yards Lost 0-0 1-19Punt 2-94 1-11Return Yards 57 225Fumbles-Lost 0-0 1-1Penalties-Yards 3-23 5-40Third Downs 9-17 2-10Possession Time 35:15 24:45
Rushing — (MSU): Ballard 20-76, Perkins 9-40, Elliott 6-36, Relf 15-30, Marcus 7-24, Russell 1-(-2). (U-M): Robinson 11-59, Shaw 4-19, Smith 7-13, Toussaint 2-5, Grady 1-(-8). Passing — (MSU): Relf 23-18-1-281. (U-M): Robinson 41-27-1-254. Receiving — (MSU): Smith 4-46, Carr 3-65, Clark 3-45, Perkins 2-79, Sanders 2-23, Heavens 2-12, Ballard 2-11. (U-M): Rountree 9-53, Stonum 7-59, Hemingway 4-49, Koger 2-42, Smith 2-17, Odoms 1-27, Toussaint 1-5, Shaw 1-2.
BOWL GAME RECORDS26
Single Game Bowl RecordsRUSHING
MOST ATTEMPTS 32 Bill Taylor vs. Stanford, Rose Bowl ........................................................ 1-1-1972 32 Anthony Thomas vs. Auburn, Citrus Bowl ........................................ 1-1-2001 32 Mike Hart vs. Florida, Capital One Bowl............................................. 1-1-2008 28 Chris Perry vs. Florida, Outback Bowl ................................................. 1-1-2003 27 Butch Woolfolk vs. UCLA, Bluebonnet Bowl ............................... 12-31-1981 26 Butch Woolfolk vs. Washington, Rose Bowl...................................... 1-1-1981 24 Tim Biakabutuka vs. Texas A&M, Alamo Bowl ............................ 12-28-1995 23 Don Dufek vs. California, Rose Bowl ................................................... 1-1-1951 23 Lawrence Ricks vs. UCLA, Rose Bowl .................................................. 1-1-1983 23 Jamie Morris vs. Alabama, Hall of Fame Bowl ................................. 1-2-1988 23 Chris Perry vs. Southern California, Rose Bowl ............................... 1-1-2004
MOST YARDS GAINED 235 Tyrone Wheatley vs. Washington, Rose Bowl .................................. 1-1-1993 234 Jamie Morris vs. Alabama, Hall of Fame Bowl ................................. 1-2-1988 186 Butch Woolfolk vs. UCLA, Bluebonnet Bowl ............................... 12-31-1981 182 Butch Woolfolk vs. Washington, Rose Bowl...................................... 1-1-1981 182 Anthony Thomas vs. Auburn, Citrus Bowl ........................................ 1-1-2001 156 Jamie Morris vs. Nebraska, Fiesta Bowl .............................................. 1-1-1986
PASSING
MOST ATTEMPTED 46 Tom Brady vs. Alabama, Orange Bowl ............................................... 1-1-2000 46 John Navarre vs. Southern California, Rose Bowl........................... 1-1-2004 43 Chad Henne vs. Nebraska, Alamo Bowl ........................................ 12-28-2005 41 Chad Henne vs. Southern California, Rose Bowl ............................ 1-1-2007 41 Denard Robinson vs. Mississippi State, Gator Bowl ...........1-1-2011 39 John Navarre vs. Tennessee, Citrus Bowl ........................................... 1-1-2002 39 Chad Henne vs. Florida, Capital One Bowl ....................................... 1-1-2008 37 Brian Griese vs. Alabama, Outback Bowl ........................................... 1-1-1997 36 John Navarre vs. Florida, Outback Bowl ............................................ 1-1-2003 34 Chad Henne vs. Texas, Rose Bowl ........................................................ 1-1-2005 MOST COMPLETED 34 Tom Brady vs. Alabama, Orange Bowl ............................................... 1-1-2000 27 John Navarre vs. Southern California, Rose Bowl........................... 1-1-2004 27 Denard Robinson vs. Mississippi State, Gator Bowl ...........1-1-2011 26 Chad Henne vs. Southern California, Rose Bowl ............................ 1-1-2007 25 Chad Henne vs. Florida, Capital One Bowl ....................................... 1-1-2008 21 Brian Griese vs. Alabama, Outback Bowl ........................................... 1-1-1997 21 John Navarre vs. Tennessee, Citrus Bowl ........................................... 1-1-2002 21 John Navarre vs. Florida, Outback Bowl ............................................ 1-1-2003 21 Chad Henne vs. Nebraska, Alamo Bowl ........................................ 12-28-2005 18 Brian Griese vs. Washington State, Rose Bowl................................. 1-1-1998 18 Chad Henne vs. Texas, Rose Bowl ........................................................ 1-1-2005
HIGHEST COMPLETION PERCENTAGE (Minimum 10 at tempts) 78.9 Chuck Ortmann vs. California, Rose Bowl (15-19) ........................ 1-1-1951 75.0 Drew Henson vs. Auburn, Citrus Bowl (15-20) ................................ 1-1-2001 73.9 Tom Brady vs. Alabama, Orange Bowl (34-46) ................................ 1-1-2000 70.0 Bob Timberlake vs. Oregon State, Rose Bowl (7-10) .................... 1-1-1965 65.9 Denard Robinson vs. Mississippi St, Gator Bowl (27-41) ...1-1-2011 64.1 Chad Henne vs. Florida, Capital One Bowl (25-39) ........................ 1-1-2008 64.0 Elvis Grbac vs. Mississippi, Gator Bowl (16-25) .............................. 1-1-1991 63.4 Chad Henne vs. Southern California, Rose Bowl (26-41) ............. 1-1-2007 61.1 B.J. Dickey vs. North Carolina, Gator Bowl (11-18) ................... 12-28-1979 60.0 John Wangler vs. Washington, Rose Bowl (12-20) ........................ 1-1-1981 60.0 Steve Smith vs. UCLA, Bluebonnet Bowl (9-15) ........................ 12-31-1981 60.0 Brian Griese vs. Washington State, Rose Bowl (18-30) ................. 1-1-1998
MOST YARDS GAINED PASSING 373 Chad Henne vs. Florida, Capital One Bowl ....................................... 1-1-2008 369 Tom Brady vs. Alabama, Orange Bowl ............................................... 1-1-2000 319 John Navarre vs. Florida, Outback Bowl ............................................ 1-1-2003 309 Chad Henne vs. Southern California, Rose Bowl ............................ 1-1-2007 296 Elvis Grbac vs. Mississippi, Gator Bowl ............................................... 1-1-1991 294 Drew Henson vs. Auburn, Citrus Bowl ............................................... 1-1-2001 287 Brian Griese vs. Alabama, Outback Bowl ........................................... 1-1-1997 271 John Navarre vs. Southern California, Rose Bowl........................... 1-1-2004 270 Chad Henne vs. Nebraska, Alamo Bowl ........................................ 12-28-2005 254 Denard Robinson vs. Mississippi State, Gator Bowl ...........1-1-2011 MOST TOUCHDOWN PASSES THROWN 4 Elvis Grbac vs. Mississippi, Gator Bowl ............................................... 1-1-1991 4 Tom Brady vs. Alabama, Orange Bowl ............................................... 1-1-2000 4 Chad Henne vs. Texas, Rose Bowl ........................................................ 1-1-2005 3 Brian Griese vs. Washington State, Rose Bowl................................. 1-1-1998 3 Chad Henne vs. Nebraska, Alamo Bowl ........................................ 12-28-2005 3 Chad Henne vs. Florida, Capital One Bowl ....................................... 1-1-2008 2 Bob Chappuis vs. Southern Cal, Rose Bowl ...................................... 1-1-1948 2 Rick Leach vs. Washington, Rose Bowl ............................................... 1-2-1978 2 Dave Hall vs. UCLA, Rose Bowl .............................................................. 1-1-1983 2 Elvis Grbac vs. Washington, Rose Bowl .............................................. 1-1-1993 2 Todd Collins vs. Colorado State, Holiday Bowl ........................... 12-30-1994 2 Brian Griese vs. Texas A&M, Alamo Bowl ...................................... 12-28-1995 2 Drew Henson vs. Auburn, Citrus Bowl ............................................... 1-1-2001 2 John Navarre vs. Tennessee, Citrus Bowl ........................................... 1-1-2002 2 Chad Henne vs. Southern California, Rose Bowl ............................ 1-1-2007 2 Denard Robinson vs. Mississippi State, Gator Bowl ...........1-1-2011
MOST INTERCEPTIONS THROWN 3 Jim Harbaugh vs. Arizona State, Rose Bowl ..................................... 1-1-1987 3 Todd Collins vs. Colorado State, Holiday Bowl ........................... 12-30-1994 2 Rick Leach vs. Oklahoma, Orange Bowl ............................................. 1-1-1976 2 Rick Leach vs. Washington, Rose Bowl ............................................... 1-2-1978 2 Rick Leach vs. Southern California, Rose Bowl ................................ 1-1-1979 2 B.J. Dickey vs. North Carolina, Gator Bowl ................................... 12-28-1979 2 Dave Hall vs. UCLA, Rose Bowl .............................................................. 1-1-1983 2 Tom Brady vs. Arkansas, Citrus Bowl ................................................... 1-1-1999 2 Chad Henne vs. Florida, Capital One Bowl ....................................... 1-1-2008
27BOWL GAME HISTORY
RECEIVING
MOST PASSES CAUGHT 10 David Terrell vs. Alabama, Orange Bowl ............................................ 1-1-2000 10 Braylon Edwards vs. Southern California, Rose Bowl .................... 1-1-2004 10 Braylon Edwards vs. Texas, Rose Bowl ................................................ 1-1-2005 9 Adrian Arrington vs. Florida, Capital One Bowl .............................. 1-1-2008 9 Roy Roundtree vs. Mississippi State, Gator Bowl ...............1-1-2011 8 Jim Mandich vs. Southern California, Rose Bowl ........................... 1-1-1970 8 Jason Avant vs. Nebraska, Alamo Bowl ........................................ 12-28-2005 7 Tai Streets vs. Arkansas, Citrus Bowl ................................................... 1-1-1999 7 Aaron Shea vs. Alabama, Orange Bowl .............................................. 1-1-2000 7 Steve Breaston vs. Southern California, Rose Bowl ....................... 1-1-2007 7 Mario Manningham vs. Florida, Capital One Bowl ........................ 1-1-2008 7 Darryl Stonum vs. Mississippi State, Gator Bowl ................1-1-2011
MOST YARDS GAINED 167 Desmond Howard vs. Mississippi, Gator Bowl ................................ 1-1-1991 153 Adrian Arrington vs. Florida, Capital One Bowl .............................. 1-1-2008 150 David Terrell vs. Alabama, Orange Bowl ............................................ 1-1-2000 141 Anthony Carter vs. North Carolina, Gator Bowl ......................... 12-28-1979 136 David Terrell vs. Auburn, Citrus Bowl .................................................. 1-1-2001 135 Amani Toomer vs. Texas A&M, Alamo Bowl ................................ 12-28-1995 129 Tai Streets vs. Arkansas, Citrus Bowl ................................................... 1-1-1999 127 Anthony Carter vs. UCLA, Bluebonnet Bowl ............................... 12-31-1981 127 Tai Streets vs. Washington State, Rose Bowl .................................... 1-1-1998 117 Tony McGee vs. Washington, Rose Bowl ........................................... 1-1-1993
MOST TOUCHDOWN PASSES CAUGHT 3 David Terrell vs. Alabama, Orange Bowl ............................................ 1-1-2000 3 Braylon Edwards vs. Texas, Rose Bowl ................................................ 1-1-2005 2 Anthony Carter vs. North Carolina, Gator Bowl ......................... 12-28-1979 2 Desmond Howard vs. Mississippi, Gator Bowl ................................ 1-1-1991 2 Tony McGee vs. Washington, Rose Bowl ........................................... 1-1-1993 2 Amani Toomer vs. Texas A&M, Alamo Bowl ................................ 12-28-1995 2 Tai Streets vs. Washington State, Rose Bowl .................................... 1-1-1998 2 Adrian Arrington vs. Florida, Capital One Bowl .............................. 1-1-2008
PUNTING
MOST PUNTS 10 John Anderson vs. Oklahoma, Orange Bowl ................................... 1-1-1976 10 Eddie Azcona vs. Washington, Rose Bowl ......................................... 1-1-1992 8 Gregg Willner vs. Southern California, Rose Bowl .......................... 1-1-1979 8 Don Bracken vs. Auburn, Sugar Bowl ................................................. 1-1-1984 8 Hayden Epstein vs. Alabama, Orange Bowl ..................................... 1-1-2000 7 Barry Dotzauer vs. Stanford, Rose Bowl ............................................. 1-1-1972 7 Monte Robbins vs. Brigham Young, Holiday Bowl .................... 12-21-1984 7 Paul Peristeris vs. Texas A&M, Alamo Bowl .................................. 12-28-1995 7 Hayden Epstein vs. Tennessee, Citrus Bowl ...................................... 1-1-2002 7 Adam Finley vs. Florida, Outback Bowl .............................................. 1-1-2003 7 Ross Ryan vs. Nebraska, Alamo Bowl ............................................. 12-28-2005
HIGHEST AVERAGE YARDS PER PUNT (Minimum 3 punts) 47.3 Don Bracken vs. Washington, Rose Bowl (6-284) .......................... 1-1-1981 47.0 Chris Stapleton vs. N.C. State, Hall of Fame (6-282) ..................... 1-1-1994 45.0 John Anderson vs. Southern Calif., Rose Bowl (5-225) ................ 1-1-1977 44.0 Adam Finley vs. Southern California, Rose Bowl (4-176) .................. 1-1-2004 43.8 Monte Robbins vs. Nebraska, Fiesta Bowl (5-219) ........................ 1-1-1986 43.5 Hayden Epstein vs. Auburn, Citrus Bowl (4-174) ............................ 1-1-2001 43.4 Hayden Epstein vs. Alabama, Orange Bowl (8-347) ...................... 1-1-2000 42.5 John Anderson vs. Washington, Rose Bowl (4-170) ..................... 1-2-1978 42.5 Monte Robbins vs. Alabama, Hall of Fame (6-255) ....................... 1-2-1988 42.0 Adam Finley vs. Texas, Rose Bowl (5-210) ......................................... 1-1-2005
PUNT RETURNS
MOST RETURNS 7 Anthony Carter vs. UCLA, Bluebonnet Bowl ............................... 12-31-1981 7 Steve Breaston vs. Nebraska, Alamo Bowl ................................... 12-28-2005 6 Rick Sygar vs. Oregon State, Rose Bowl ............................................. 1-1-1965 5 Mike Jolly vs. Southern California, Rose Bowl ................................. 1-1-1979 4 Charles Woodson vs. Alabama, Outback Bowl ................................ 1-1-1997 4 Dwight Hicks vs. Washington, Rose Bowl ......................................... 1-2-1978
MOST YARDS RETURNED 79 Derrick Alexander vs. N.C. State, Hall of Fame Bowl ..................... 1-1-1994 72 Steve Breaston vs. Nebraska, Alamo Bowl ................................... 12-28-2005 50 Rick Sygar vs. Oregon State, Rose Bowl ............................................. 1-1-1965 46 Anthony Carter vs. UCLA, Bluebonnet Bowl ............................... 12-31-1981 34 Junior Hemingway vs. Mississippi State, Gator Bowl .........1-1-2011 31 DiAllo Johnson vs. Arkansas, Citrus Bowl .......................................... 1-1-1999 29 Julius Curry vs. Florida, Outback Bowl ............................................... 1-1-2003 28 Derrick Alexander vs. Washington, Rose Bowl ................................ 1-1-1993 24 Bob Mielke vs. Oregon State, Rose Bowl ........................................... 1-1-1965
KICKOFF RETURNS
MOST RETURNS 8 Todd Howard vs. Tennessee, Citrus Bowl .......................................... 1-1-2002 7 Martavious Odoms vs. Mississippi State, Gator Bowl ........1-1-2011 6 Steve Breaston vs. Texas, Rose Bowl ................................................... 1-1-2005 5 Ralph Clayton vs. Washington, Rose Bowl ........................................ 1-2-1978 5 Brandon Minor vs. Florida, Capital One Bowl .................................. 1-1-2008 4 Dave Rather vs. Stanford, Rose Bowl .................................................. 1-1-1972 4 Mercury Hayes vs. Texas A&M, Alamo Bowl ................................ 12-28-1995 4 Walter Cross vs. Alabama, Orange Bowl ............................................ 1-1-2000 4 Steve Breaston vs. Nebraska, Alamo Bowl ................................... 12-28-2005 4 Steve Breaston vs. Southern California, Rose Bowl ....................... 1-1-2007 3 Evan Cooper vs. Auburn, Sugar Bowl ................................................. 1-1-1984 3 Desmond Howard vs. Washington, Rose Bowl ............................... 1-1-1992 3 Tyrone Wheatley vs. Washington, Rose Bowl .................................. 1-1-1992 3 Mercury Hayes vs. Washington, Rose Bowl ...................................... 1-1-1993
MOST YARDS RETURNED 221 Steve Breaston vs. Texas, Rose Bowl ................................................... 1-1-2005 163 Martavious Odoms vs. Mississippi State, Gator Bowl ........1-1-2011 146 Steve Breaston vs. Nebraska, Alamo Bowl ................................... 12-28-2005 125 Todd Howard vs. Tennessee, Citrus Bowl .......................................... 1-1-2002 102 Ralph Clayton vs. Washington, Rose Bowl ........................................ 1-2-1978 98 Brandon Minor vs. Florida, Capital One Bowl .................................. 1-1-2008 87 Dave Rather vs. Stanford, Rose Bowl .................................................. 1-1-1972 83 Walter Cross vs. Alabama, Orange Bowl ............................................ 1-1-2000 80 Mercury Hayes vs. Texas A&M, Alamo Bowl ................................ 12-28-1995 61 Allen Jefferson vs. Alabama, Hall of Fame Bowl ............................. 1-2-1988
INTERCEPTIONS
MOST INTERCEPTIONS 2 Leon Hall vs. Nebraska, Alamo Bowl ............................................12-28-2005 1 Many players LAST: Cameron Gordon vs. Mississippi State, Gator Bowl .........1-1-2011
MOST YARDS RETURNED 46 Ian Gold vs. Arkansas, Citrus Bowl .....................................................1-1-1999 43 Clarence Thompson vs N.C. State, Hall of Fame Bowl ................1-1-1994 42 Victor Hobson vs. Florida, Outback Bowl ........................................1-1-2003 39 Julius Curry vs. Auburn, Citrus Bowl .................................................1-1-2001 36 David Arnold vs. Alabama, Hall of Fame Bowl ..............................1-2-1988 36 Otis Williams vs. Washington, Rose Bowl ........................................1-1-1992 26 James Whitley vs. Arkansas, Citrus Bowl .........................................1-1-1999 25 Mike Jolly vs. Washington, Rose Bowl ..............................................1-2-1978 23 Prescott Burgess vs. Texas, Rose Bowl ..............................................1-1-2005
BOWL GAME RECORDS28
TOTAL RETURNS
MOST RETURNS 11 Steve Breaston vs. Nebraska, Alamo Bowl .................................12-28-2005 8 Todd Howard vs. Tennessee, Citrus Bowl ........................................1-1-2002 7 Anthony Carter vs. UCLA, Bluebonnet Bowl .............................12-31-1981 7 Steve Breaston vs. Texas, Rose Bowl .................................................1-1-2005 7 Martavious Odoms vs. Mississippi State, Gator Bowl ......1-1-2011 6 Rick Sygar vs. Oregon State, Rose Bowl ...........................................1-1-1965 6 Ralph Clayton vs. Washington, Rose Bowl ......................................1-2-1978 6 Desmond Howard vs. Washington, Rose Bowl .............................1-1-1992 6 Mercury Hayes vs. Texas A&M, Alamo Bowl ..............................12-28-1995
MOST YARDS RETURNED 223 Steve Breaston vs. Texas, Rose Bowl .................................................1-1-2005 218 Steve Breaston vs. Nebraska, Alamo Bowl .................................12-28-2005 163 Martavious Odoms vs. Mississippi State, Gator Bowl ......1-1-2011 125 Todd Howard vs. Tennessee, Citrus Bowl ........................................1-1-2002 107 Derrick Alexander vs. N.C. State, Hall of Fame Bowl ...................1-1-1994 102 Ralph Clayton vs. Washington, Rose Bowl ......................................1-2-1978 98 Brandon Minor vs. Florida, Capital One Bowl ................................1-1-2008 87 Dave Rather vs. Stanford, Rose Bowl ................................................1-1-1972 83 Walter Cross vs. Alabama, Orange Bowl ..........................................1-1-2000 81 Mercury Hayes vs. Texas A&M, Alamo Bowl ..............................12-28-1995
TOTAL OFFENSE
MOST PLAYS 58 John Navarre vs. Southern California, Rose Bowl.........................1-1-2004 56 Chad Henne vs. Nebraska, Alamo Bowl ......................................12-28-2005 52 Denard Robinson vs. Mississippi State, Gator Bowl .........1-1-2011 50 Don Moorhead vs. Southern California, Rose Bowl ....................1-1-1970 49 Tom Brady vs. Alabama, Orange Bowl .............................................1-1-2000 48 Chad Henne vs. Southern California, Rose Bowl ..........................1-1-2007 43 John Navarre vs. Tennessee, Citrus Bowl .........................................1-1-2002 43 Chad Henne vs. Florida, Capital One Bowl .....................................1-1-2008 38 John Navarre vs. Florida, Outback Bowl ..........................................1-1-2003 37 Bob Chappuis vs. Southern California, Rose Bowl .......................1-1-1948 37 Brian Griese vs. Washington State, Rose Bowl...............................1-1-1998
MOST YARDS GAINED 353 Tom Brady vs. Alabama, Orange Bowl .............................................1-1-2000 349 Chad Henne vs. Florida, Capital One Bowl .....................................1-1-2008 313 John Navarre vs. Florida, Outback Bowl ..........................................1-1-2003 313 Denard Robinson vs. Mississippi State, Gator Bowl .........1-1-2011 308 Chad Henne vs. Nebraska, Alamo Bowl ......................................12-28-2005 296 Elvis Grbac vs. Mississippi, Gator Bowl .............................................1-1-1991 292 Brian Griese vs. Alabama, Outback Bowl .........................................1-1-1997 279 Bob Chappuis vs. Southern California, Rose Bowl .......................1-1-1948 269 Chad Henne vs. Southern California, Rose Bowl ..........................1-1-2007 264 Brian Griese vs. Washington State, Rose Bowl...............................1-1-1998 244 Rick Leach vs. Washington, Rose Bowl .............................................1-2-1978
ALL-PURPOSE
MOST PLAYS 36 Anthony Thomas vs. Auburn, Citrus Bowl ......................................1-1-2001 34 Chris Perry vs. Florida, Outback Bowl ...............................................1-1-2003 33 Mike Hart vs. Florida, Capital One Bowl...........................................1-1-2008 32 Bill Taylor vs. Stanford, Rose Bowl ......................................................1-1-1972 29 Butch Woolfolk vs. UCLA, Bluebonnet Bowl .............................12-31-1981 28 Don Dufek vs. California, Rose Bowl .................................................1-1-1951 27 Butch Woolfolk vs. Washington, Rose Bowl....................................1-1-1981 26 Jamie Morris vs. Nebraska, Fiesta Bowl ............................................1-1-1986
MOST YARDS GAINED315 Steve Breaston vs. Texas, Rose Bowl .................................................1-1-2005261 Tyrone Wheatley vs. Washington, Rose Bowl ................................1-1-1993230 Jamie Morris vs. Alabama, Hall of Fame Bowl ...............................1-2-1988226 Desmond Howard vs. Mississippi, Gator Bowl ..............................1-1-1991224 Steve Breaston vs. Nebraska, Alamo Bowl .................................12-28-2005214 Anthony Thomas vs. Auburn, Citrus Bowl ......................................1-1-2001198 Ralph Clayton vs. Washington, Rose Bowl ......................................1-2-1978195 Jamie Morris vs. Nebraska, Fiesta Bowl ............................................1-1-1986193 Chris Perry vs. Florida, Outback Bowl ...............................................1-1-2003190 Martavious Odoms vs. Mississippi State, Gator Bowl ......1-1-2011
SCORING
MOST POINTS SCORED24 Chris Perry vs. Florida, Outback Bowl ...............................................1-1-200318 Jack Weisenburger vs. Southern California, Rose Bowl .............1-1-194818 Mel Anthony vs. Oregon State, Rose Bowl .....................................1-1-196518 Jamie Morris vs. Alabama, Hall of Fame Bowl ...............................1-2-198818 Tyrone Wheatley vs. Washington, Rose Bowl ................................1-1-199318 Anthony Thomas vs. Arkansas, Citrus Bowl ....................................1-1-199918 David Terrell vs. Alabama, Orange Bowl ..........................................1-1-200018 Braylon Edwards vs. Texas, Rose Bowl ..............................................1-1-2005
MOST TOUCHDOWNS SCORED4 Chris Perry vs. Florida, Outback Bowl ...............................................1-1-20033 Jack Weisenburger vs. Southern California, Rose Bowl .............1-1-19483 Mel Anthony vs. Oregon State, Rose Bowl .....................................1-1-19653 Jamie Morris vs. Alabama, Hall of Fame Bowl ...............................1-2-19883 Tyrone Wheatley vs. Washington, Rose Bowl ................................1-1-19933 Anthony Thomas vs. Arkansas, Citrus Bowl ....................................1-1-19993 David Terrell vs. Alabama, Orange Bowl ..........................................1-1-20003 Braylon Edwards vs. Texas, Rose Bowl ..............................................1-1-2005
MOST FIELD GOALS SCORED3 Garrett Rivas vs. Texas, Rose Bowl ......................................................1-1-20052 Ali Haji-Sheikh vs. UCLA, Bluebonnet Bowl ...............................12-31-19812 Pat Moons vs. Nebraska, Fiesta Bowl ................................................1-1-19862 Remy Hamilton vs. Alabama, Outback Bowl ..................................1-1-19972 K.C. Lopata vs. Florida, Capital One Bowl ........................................1-1-2008
MOST FIELD GOALS ATTEMPTED3 Remy Hamilton vs. Alabama, Outback Bowl ..................................1-1-19973 Ali Haji-Sheikh vs. UCLA, Bluebonnet Bowl ...............................12-31-19813 Mike Gillette vs. Southern California, Rose Bowl ..........................1-2-1989
3 Garrett Rivas vs. Texas, Rose Bowl ......................................................1-1-2005 2 Dana Coin vs. Stanford, Rose Bowl ....................................................1-1-1972 2 Bob Wood vs. Oklahoma, Orange Bowl ...........................................1-1-1976 2 Pat Moons vs. Nebraska, Fiesta Bowl ................................................1-1-1986 2 Peter Elezovic vs. Washington, Rose Bowl ......................................1-1-1993 2 Jay Feely vs. Arkansas, Citrus Bowl ....................................................1-1-1999 2 Hayden Epstein vs. Auburn, Citrus Bowl .........................................1-1-2001 2 K.C. Lopata vs. Florida, Capital One Bowl ........................................1-1-2008
MOST POINT-AFTER-TOUCHDOWNS SCORED 7 Jim Brieske vs. Southern California, Rose Bowl .............................1-1-1948 6 Peter Elezovic vs. N.C. State, Hall of Fame Bowl ............................1-1-1994 6 Jay Feely vs. Arkansas, Citrus Bowl ....................................................1-1-1999 5 J.D. Carlson vs. Mississippi, Gator Bowl ............................................1-1-1991 5 Peter Elezovic vs. Washington, Rose Bowl ......................................1-1-1993 5 Hayden Epstein vs. Alabama, Orange Bowl ...................................1-1-2000 5 Adam Finley vs. Florida, Outback Bowl ............................................1-1-2003 5 K.C. Lopata vs. Florida, Capital One Bowl ........................................1-1-2008 4 Mike Gillette vs. Alabama, Hall of Fame Bowl ...............................1-2-1988 4 Hayden Epstein vs. Auburn, Citrus Bowl .........................................1-1-2001 4 Garrett Rivas vs. Texas, Rose Bowl ......................................................1-1-2005
29BOWL GAME HISTORY
TACKLES
MOST TACKLES 18 Garland Rivers vs. Brigham Young, Holiday Bowl ...................12-21-1984 18 Allen Bishop vs. Alabama, Hall of Fame Bowl ................................1-2-1988 16 Ron Simpkins vs. Washington, Rose Bowl.......................................1-2-1978 15 Cecil Pryor vs. Southern Cal, Rose Bowl ...........................................1-1-1970 15 Mike Mallory vs. Nebraska, Fiesta Bowl ...........................................1-1-1986 14 Sam Sword vs. Arkansas, Citrus Bowl ...............................................1-1-1999 13 Eric Brackins vs. Auburn, Citrus Bowl ................................................1-1-2001 13 Kenny Demens vs. Mississippi State, Gator Bowl .............1-1-2011 12 Mike Taylor vs. Southern California, Rose Bowl ............................1-1-1970 12 Mike Mallory vs. Auburn, Sugar Bowl ...............................................1-2-1984 12 Erick Anderson vs. Southern California, Rose Bowl .....................1-1-1989 12 Jarrett Irons vs. Colorado State, Holiday Bowl..........................12-30-1994 12 Ian Gold vs. Alabama, Orange Bowl ..................................................1-1-2000 12 Victor Hobson vs. Florida, Outback Bowl ........................................1-1-2003
SOLO TACKLES 15 Allen Bishop vs. Alabama, Hall of Fame Bowl ................................1-2-1988 13 Ron Simpkins vs. Washington, Rose Bowl.......................................1-2-1978 11 Sam Sword vs. Arkansas, Citrus Bowl ...............................................1-1-1999 10 David Folkertsma vs. Arizona State, Rose Bowl ............................1-1-1987 10 Vada Murray vs. Southern California, Rose Bowl ..........................1-1-1990 10 Jarrett Irons vs. Colorado State, Holiday Bowl..........................12-30-1994 10 Markus Curry vs. Southern California, Rose Bowl ........................1-1-2004 9 Kevin Brooks vs. UCLA, Rose Bowl .....................................................1-1-1983 9 Garland Rivers vs. Arizona State, Rose Bowl ..................................1-1-1987 9 Erick Anderson vs. Washington, Rose Bowl ....................................1-1-1992 9 Sam Sword vs. Alabama, Outback Bowl ..........................................1-1-1997 9 Ian Gold vs. Alabama, Orange Bowl ..................................................1-1-2000 9 LaMarr Woodley vs. Texas, Rose Bowl ...............................................1-1-2005 9 Kenny Demens vs. Mississippi State, Gator Bowl .............1-1-2011
TACKLES FOR LOSS
TACKLES FOR LOSS 5 Alan Branch vs. Nebraska, Alamo Bowl ......................................12-28-2005 4 James Hall vs. Arkansas, Citrus Bowl .................................................1-1-1999 4 Eric Wilson vs. Auburn, Citrus Bowl ...................................................1-1-2001 4 LaMarr Woodley vs. Texas, Rose Bowl ...............................................1-1-2005 3 Dhani Jones vs. Alabama, Orange Bowl ..........................................1-1-2000 3 Pierre Woods vs. Nebraska, Alamo Bowl ....................................12-28-2005 2 on 22 different occasions: Last: J.B. Fitzgerald vs. Mississippi State, Gator Bowl ......1-1-2011
SACKS
SACKS 3 Alan Branch vs. Nebraska, Alamo Bowl ......................................12-28-2005 2 Glen Steele vs. Alabama, Outback Bowl ..........................................1-1-1997 2 Dhani Jones vs. Washington State, Rose Bowl ..............................1-1-1998 2 James Hall vs. Arkansas, Citrus Bowl .................................................1-1-1999
PASS BREAKUPS
PASS BREAK-UPS 4 Marion Body vs. UCLA, Rose Bowl .....................................................1-1-1983 4 Charles Woodson vs. Washington State, Rose Bowl ....................1-1-1998 3 Brian Carpenter vs. Washington, Rose Bowl ..................................1-1-1981 3 Jerry Burgei vs. UCLA, Rose Bowl .......................................................1-1-1983 3 David Arnold vs. Alabama, Hall of Fame Bowl ..............................1-2-1988 3 Markus Curry vs. Southern California, Rose Bowl ........................1-1-2004 2 on 19 different cccasions: Last: Willis Barringer vs. Southern California, Rose Bowl ...........1-1-2007
Please Note: The Bowl Records do not in clude the 1902 Rose Bowl Statistics throughout this sec tion, except where in di cat ed.
BOWL GAME RECORDS30
MICHIGAN
SCRIMMAGE RUN 88 Tyrone Wheatley vs. Washington, Rose Bowl (TD) ......................... 1-1-1993 84 Mel Anthony vs. Oregon State, Rose Bowl (TD) .............................. 1-1-1965 77 Jamie Morris vs. Alabama, Hall of Fame Bowl (TD) ........................ 1-2-1988 61 Leroy Hoard vs. Southern California, Rose Bowl .............................. 1-2-1989 56 Tyrone Wheatley vs. Washington, Rose Bowl (TD) ......................... 1-1-1993 53 Tyrone Wheatley vs. Washington, Rose Bowl (TD) ......................... 1-1-1992 52 Butch Woolfolk vs. UCLA, Bluebonnet Bowl ................................. 12-31-1981 46 Leroy Hoard vs. Southern California, Rose Bowl .............................. 1-2-1990
PASSING PLAY 76 Rick Leach - Curt Stephenson vs. Washington, Rose (TD) ............ 1-2-1978 65 Chad Henne - Carson Butler vs. Florida, Capital One ..................... 1-1-2008 63 Elvis Grbac - Desmond Howard vs. Mississippi, Gator (TD) ......... 1-1-1991 59 Drew Henson - Marquise Walker vs. Auburn, Citrus ....................... 1-1-2001 58 Brian Griese - Tai Streets vs. Washington State, Rose (TD) ............ 1-1-1998 57 Tom Brady - David Terrell vs. Alabama, Orange (TD) ...................... 1-1-2000 53 Brian Griese - Tai Streets vs. Washington State, Rose (TD) ............ 1-1-1998 53 John Wangler - A. Carter vs. N. Carolina, Gator (TD) ................. 12-28-1979 52 Drew Henson - David Terrell vs. Auburn, Citrus................................ 1-1-2001
PUNT 73 Don Bracken vs. Washington, Rose Bowl ............................................ 1-1-1981 60 Chris Stapleton vs. N.C. State, Hall of Fame Bowl ............................ 1-1-1994 59 Monte Robbins vs. Nebraska, Fiesta Bowl .......................................... 1-1-1986 57 Hayden Epstein vs. Auburn, Citrus Bowl ............................................. 1-1-2001 56 Don Bracken vs. UCLA, Rose Bowl ......................................................... 1-1-1983 56 Monte Robbins vs. Alabama, Hall of Fame Bowl .............................. 1-2-1988
FIELD GOAL 49 Mike Gillette vs. Southern California, Rose Bowl ............................. 1-2-1989 47 Ali Haji-Sheikh vs. UCLA, Bluebonnet Bowl .................................. 12-31-1981 44 Remy Hamilton vs. Alabama, Outback Bowl .................................... 1-1-1997 44 Garrett Rivas vs. Texas, Rose Bowl ......................................................... 1-1-2005 43 Jay Feely vs. Arkansas, Citrus Bowl ........................................................ 1-1-1999 43 Garrett Rivas vs. Southern California, Rose Bowl ............................. 1-1-2007 42 Pat Moons vs. Nebraska, Fiesta Bowl .................................................... 1-1-1986 42 Garrett Rivas vs. Texas, Rose Bowl ......................................................... 1-1-2005
INTERCEPTION RETURN 46 Ian Gold vs. Arkansas, Citrus Bowl (TD) ............................................... 1-1-1999 43 Clarence Thompson vs. N.C. State, Hall of Fame Bowl ................... 1-1-1994 42 Victor Hobson vs. Florida, Outback Bowl ............................................ 1-1-2003 39 Julius Curry vs. Auburn, Citrus Bowl ..................................................... 1-1-2001 36 David Arnold vs. Alabama, Hall of Fame Bowl .................................. 1-2-1988 36 Otis Williams vs. Washington, Rose Bowl ............................................ 1-1-1992
KICKOFF RETURN 69 Steve Breaston vs. Nebraska, Alamo Bowl..................................... 12-28-2005 53 Steve Breaston vs. Texas, Rose Bowl ..................................................... 1-1-2005 45 Allen Jefferson vs. Alabama, Hall of Fame Bowl ............................... 1-2-1988 44 Mercury Hayes vs. Colorado State, Holiday Bowl ....................... 12-30-1994 44 Steve Breaston vs. Texas, Rose Bowl ..................................................... 1-1-2005 43 Steve Breaston vs. Texas, Rose Bowl ..................................................... 1-1-2005 41 Anthony Carter vs. UCLA, Rose Bowl .................................................... 1-1-1983 41 Martavious Odoms vs. Mississippi State, Gator Bowl .........1-1-2011
PUNT RETURN 79 Derrick Alexander vs. N.C. State, Hall of Fame Bowl ....................... 1-1-1994 34 Junior Hemingway vs. Mississippi State, Gator Bowl ..........1-1-2011 31 Charles Woodson vs. Alabama, Outback Bowl ................................. 1-1-1997 28 Derrick Alexander vs. Washington, Rose Bowl .................................. 1-1-1993 25 A.E. Herrnstein vs. Stanford, Rose Bowl ............................................... 1-1-1902 25 Steve Breaston vs. Nebraska, Alamo Bowl..................................... 12-28-2005 24 Bob Mielke vs. Oregon State, Rose Bowl ............................................. 1-1-1965
Bowl Game Longest PlaysOPPONENT
SCRIMMAGE RUN 66 Percy Harvin, Florida, Capital One Bowl ............................................... 1-1-2008 60 Vince Young, Texas, Rose Bowl (TD) ....................................................... 1-1-2005 50 Shaun Alexander, Alabama, Orange Bowl (TD) ................................. 1-1-2000 46 Shaun Alexander, Alabama, Outback Bowl (TD) ............................... 1-1-1997 42 Donte Washington, Tennessee, Citrus Bowl........................................ 1-1-2002 39 Billy Brooks, Oklahoma, Orange Bowl (TD) ........................................ 1-1-1976 36 Jackie Brown, Stanford, Rose Bowl......................................................... 1-1-1972 33 Ernest Graham, Florida, Outback Bowl ................................................. 1-1-2003 32 Shaun Alexander, Alabama, Orange Bowl ........................................... 1-1-2000
PASSING PLAY 81 Chris Relf - LaDarius Perkins, Mississippi State, Gator Bowl .......... 1-1-2011 64 Mark Brunell - Shelley, Washington, Rose Bowl ................................ 1-1-1993 64 Casey Clausen - Jason Witten, Tennessee, Citrus Bowl ................... 1-1-2002 62 Warren Moon - Spider Gaines, Washington, Rose Bowl ................. 1-2-1978 62 John David Booty - Dwayne Jarrett, USC, Rose Bowl (TD) ............ 1-1-2007 52 Zac Taylor - Terrence Nunn, Nebraska, Alamo Bowl ................... 12-28-2005 51 Rex Grossman - Ran Carthon, Florida, Outback Bowl ..................... 1-1-2003 47 Ben Leard - Ronney Daniels, Auburn, Citrus Bowl ............................ 1-1-2001 47 Matt Leinart- Keary Colbert, USC, Rose Bowl ..................................... 1-1-2004 46 Aaron Wilson - Kyle Stevens, Washington, Rose Bowl .................... 1-2-1978 46 Ryan Leaf - Nian Taylor, Washington State, Rose Bowl ................... 1-1-1998
PUNT 60 Hayden Stockton, Alabama, Outback Bowl ........................................ 1-1-1997 60 Chris Sperle, Southern California, Rose Bowl ..................................... 1-2-1989 59 Marty King, Southern California, Rose Bowl ....................................... 1-1-1979 59 Sam Koch, Nebraska, Alamo Bowl ..................................................... 12-28-2005 59 Sam Koch, Nebraska, Alamo Bowl ..................................................... 12-28-2005 58 Steve Streater, North Carolina, Gator Bowl .................................... 12-28-1979 56 Sam Koch, Nebraska, Alamo Bowl ..................................................... 12-28-2005 55 Kevin Buenafe, UCLA, Bluebonnet Bowl ......................................... 12-31-1981 55 Damon Duval, Auburn, Citrus Bowl ....................................................... 1-1-2001 55 Greg Woidneck, Southern California, Rose Bowl .............................. 1-1-2007
FIELD GOAL 51 Philip Doyle, Alabama, Hall of Fame Bowl ........................................... 1-2-1988 51 Brian Lee, Mississippi, Gator Bowl .......................................................... 1-1-1991 49 Kyle Bryant, Texas A&M, Alamo Bowl ............................................... 12-28-1995 48 Rian Lindell, Washington State, Rose Bowl ......................................... 1-1-1998 47 Kyle Bryant, Texas A&M, Alamo Bowl ............................................... 12-28-1995 44 Travis Hanson, Washington, Rose Bowl ................................................ 1-1-1993 43 Jon Brock, Alabama, Outback Bowl ....................................................... 1-1-1997 42 Derek DePasquale, Mississippi State, Gator Bowl ............................. 1-1-2011
INTERCEPTION RETURN 88 Dwayne Rudd, Alabama, Outback Bowl .............................................. 1-1-1997 50 Tyrone Ashley, Mississippi, Gator Bowl ................................................. 1-1-1991 44 Andre Williams, Texas A&M, Alamo Bowl ........................................ 12-28-1995 33 Ronnie Lott, Southern California, Rose Bowl ...................................... 1-1-1979 31 Dennis Smith, Southern California, Rose Bowl .................................. 1-1-1979
KICKOFF RETURN 55 Tyrone Ashley, Mississippi, Gator Bowl ................................................. 1-1-1991 53 Kyle Stevens, Washington, Rose Bowl ................................................... 1-2-1978 47 Napoleon Kaufman, Washington, Rose Bowl ..................................... 1-1-1993 40 Raymond Butler, Southern California, Rose Bowl ............................. 1-1-1979 40 Ramonce Taylor, Texas, Rose Bowl .......................................................... 1-1-2005 38 Napoleon Kaufman, Washington, Rose Bowl ..................................... 1-1-1992
PUNT RETURN 62 Freddie Milons, Alabama, Orange Bowl ............................................... 1-1-2000 49 Ray Horton, Washington, Rose Bowl ..................................................... 1-1-1981 28 Cortney Grixby, Nebraska, Alamo Bowl ........................................... 12-28-2005 26 Ray Mickens, Texas A&M, Alamo Bowl ............................................. 12-28-1995 24 Junior Seau, Southern California, Rose Bowl ...................................... 1-2-1990 23 Freddie Milons, Alabama, Orange Bowl ............................................... 1-1-2000 23 Brandon James, Florida, Capital One Bowl ......................................... 1-1-2008
31BOWL GAME HISTORY
Opponent Single Game Bowl RecordsRUSHING
MOST ATTEMPTS 32 Charles White, Southern California, Rose Bowl .....................1-1-1977 32 Charles White, Southern California, Rose Bowl .....................1-1-1979 30 Rickey Ervins, Southern California, Rose Bowl ......................1-2-1990 28 Cory Ross, Nebraska, Alamo Bowl ........................................12-28-2005 27 Bobby Humphrey, Alabama, Hall of Fame Bowl ...................1-2-1988 25 Shaun Alexander, Alabama, Orange Bowl ..............................1-1-2000 25 Rudi Johnson, Auburn, Citrus Bowl ...........................................1-1-2001
MOST YARDS GAINED 192 Vince Young, Texas, Rose Bowl ....................................................1-1-2005 165 Percy Harvin, Florida, Capital One Bowl ..................................1-1-2008 161 Shaun Alexander, Alabama, Orange Bowl ..............................1-1-2000 161 Cory Ross, Nebraska, Alamo Bowl ........................................12-28-2005 149 Bobby Humphrey, Alabama, Hall of Fame Bowl ...................1-2-1988 130 Bo Jackson, Auburn, Sugar Bowl ................................................1-1-1984 126 Rickey Ervins, Southern California, Rose Bowl ......................1-2-1990 120 Ernest Graham, Florida, Outback Bowl ....................................1-1-2003
PASSING
MOST ATTEMPTED 45 John David Booty, Southern California, Rose Bowl .............1-1-2007 44 Don Bunce, Stanford, Rose Bowl ................................................1-1-1972 42 Robbie Bosco, Brigham Young, Holiday Bowl ..................12-21-1984 42 Clint Stoerner, Arkansas, Citrus Bowl ........................................1-1-1999 41 Rex Grossman, Florida, Outback Bowl .....................................1-1-2003 MOST COMPLETED 30 Robbie Bosco, Brigham Young, Holiday Bowl ..................12-21-1984 28 Ben Leard, Auburn, Citrus Bowl ..................................................1-1-2001 27 John David Booty, Southern California, Rose Bowl .............1-1-2007 26 Casey Clausen, Tennessee, Citrus Bowl ....................................1-1-2002 24 Don Bunce, Stanford, Rose Bowl ................................................1-1-1972
HIGHEST COMPLETION PERCENTAGE (Min. 10 attempts) 78.3 Chris Relf, Mississippi State, Gator Bowl (18-23) ...................1-1-2011 76.5 Casey Clausen, Tennessee, Citrus Bowl (26-34) ....................1-1-2002 75.7 Ben Leard, Auburn, Citrus Bowl (28-37) ...................................1-1-2001 72.0 Tom Ramsey, UCLA, Rose Bowl (18-25) ..................................1-1-1983 71.4 Robbie Bosco, Brigham Young, Holiday Bowl (30-42) ..12-21-1984 71.4 Rodney Peete, Southern California, Rose Bowl (15-21) ....1-2-1989
MOST YARDS GAINED PASSING 394 Ben Leard, Auburn, Citrus Bowl ..................................................1-1-2001 393 Casey Clausen, Tennessee, Citrus Bowl ....................................1-1-2002 391 John David Booty, Southern California, Rose Bowl .............1-1-2007 343 Robbie Bosco, Brigham Young, Holiday Bowl ..................12-21-1984 331 Ryan Leaf, Washington State, Rose Bowl .................................1-1-1998
MOST TOUCHDOWN PASSES THROWN 4 John David Booty, Southern California, Rose Bowl .............1-1-2007 3 Ben Leard, Auburn, Citrus Bowl ..................................................1-1-2001 3 Casey Clausen, Tennessee, Citrus Bowl ....................................1-1-2002 3 Matt Leinart, Southern California, Rose Bowl ........................1-1-2004 3 Zac Taylor, Nebraska, Alamo Bowl ........................................12-28-2005 3 Tim Tebow, Florida, Capital One Bowl ......................................1-1-2008 3 Chris Relf, Mississippi State, Gator Bowl ..................................1-1-2011 2 Eight Times Last: Rex Grossman, Florida, Outback Bowl ...........................1-1-2003
MOST INTERCEPTIONS THROWN 3 Robbie Bosco, Brigham Young, Holiday Bowl ..................12-21-1984 3 Russ Shows, Mississippi, Gator Bowl .........................................1-1-1991 2 on 10 different occasions Last: Zac Taylor, Nebraska, Alamo Bowl ..............................12-28-2005
RECEIVING
MOST PASSES CAUGHT 11 David Mills, Brigham Young, Holiday Bowl ........................12-21-1984 11 Dwayne Jarrett, Southern California, Rose Bowl ..................1-1-2007 10 Kelly Smith, Brigham Young, Holiday Bowl .......................12-21-1984 9 Percy Harvin, Florida, Capital One Bowl ..................................1-1-2008 8 John Winesberry, Stanford, Rose Bowl .....................................1-1-1972 8 Shelton Diggs, Southern California, Rose Bowl ....................1-1-1977 8 Donte Stallworth, Tennessee, Citrus Bowl ..............................1-1-2002 8 Mike Williams, Southern California, Rose Bowl .....................1-1-2004
MOST YARDS GAINED 205 Dwayne Jarrett, Southern California, Rose Bowl ..................1-1-2007 149 Keary Colbert, Southern California, Rose Bowl .....................1-1-2004 126 Mario Bailey, Washington, Rose Bowl .......................................1-1-1992 125 Jason Witten, Tennessee, Citrus Bowl .......................................1-1-2002 122 Spider Gaines, Washington, Rose Bowl ...................................1-2-1978
MOST TOUCHDOWN PASSES CAUGHT 2 Bruce Hill, Arizona State, Rose Bowl .........................................1-1-1987 2 Kelley Washington, Tennessee, Citrus Bowl ...........................1-1-2002 2 Keary Colbert, Southern California, Rose Bowl .....................1-1-2004 2 Terrence Nunn, Nebraska, Alamo Bowl ..............................12-28-2005 2 Dwayne Jarrett, Southern California, Rose Bowl ..................1-1-2007 2 Andre Caldwell, Florida, Capital One Bowl .............................1-1-2008
TOTAL OFFENSE
MOST PLAYS 54 Anthoney Hill, Colorado State, Holiday Bowl ...................12-30-1994 52 Don Bunce, Stanford, Rose Bowl ................................................1-1-1972 52 Rex Grossman, Florida, Outback Bowl .....................................1-1-2003 49 Vince Young, Texas, Rose Bowl ....................................................1-1-2005 49 John David Booty, Southern California, Rose Bowl .............1-1-2007 49 Tim Tebow, Florida, Capital One Bowl ......................................1-1-2008
MOST YARDS GAINED 387 John David Booty, Southern California, Rose Bowl .............1-1-2007 383 Ben Leard, Auburn, Citrus Bowl ..................................................1-1-2001 379 Casey Clausen, Tennessee, Citrus Bowl ....................................1-1-2002 372 Vince Young, Texas, Rose Bowl ....................................................1-1-2005 359 Robbie Bosco, Brigham Young, Holiday Bowl ..................12-21-1984
ALL-PURPOSE
MOST PLAYS 35 Rickey Ervins, Southern California, Rose Bowl ......................1-2-1990 34 Charles White, Southern California, Rose Bowl .....................1-1-1979 33 Bobby Humphrey, Alabama, Hall of Fame Bowl ...................1-2-1988 32 Charles White, Southern California, Rose Bowl .....................1-1-1977 31 Cory Ross, Nebraska, Alamo Bowl ........................................12-28-2005
MOST YARDS GAINED 242 Percy Harvin, Florida, Capital One Bowl ..................................1-1-2008 205 Dwayne Jarrett, Southern California, Rose Bowl ..................1-1-2007 203 Ramonce Taylor, Texas, Rose Bowl .............................................1-1-2005 197 Bobby Humphrey, Alabama, Hall of Fame Bowl ...................1-2-1988 192 Vince Young, Texas, Rose Bowl ....................................................1-1-2005 190 Donte Stallworth, Tennessee, Citrus Bowl ..............................1-1-2002
BOWL GAME RECORDS32
PUNTING
MOST PUNTS 9 Len Frketich, Oregon State, Rose Bowl ....................................1-1-1965 9 Tinker Owens, Oklahoma, Orange Bowl ..................................1-1-1976 9 Marty King, Southern California, Rose Bowl ..........................1-1-1979 9 Patrick Morgan, Alabama, Orange Bowl ..................................1-1-2000 8 Sam Koch, Nebraska, Alamo Bowl ........................................12-28-2005 HIGHEST AVERAGE YARDS PER PUNT (Minimum 3 punts) 51.5 Sam Koch, Nebraska, Alamo Bowl ........................................12-28-2005 50.3 Chris Sperle, Southern California, Rose Bowl (4-201) ........1-2-1989 47.8 Kevin Buenafe, UCLA, Bluebonnet Bowl (8-382) ............12-31-1981 46.7 Tom Malone, Southern California, Rose Bowl (3-140) ........1-1-2004 46.5 Hayden Stockson, Alabama, Outback Bowl ...........................1-1-1997
PUNT RETURNS
MOST RETURNS 4 Eric Cross, Stanford, Rose Bowl ...................................................1-1-1972 4 Raymond Butler, Southern California, Rose Bowl ................1-1-1979 4 Beno Bryant, Washington, Rose Bowl.......................................1-1-1992 4 Freddie Milons, Alabama, Orange Bowl ..................................1-1-2000 4 Clifton Robinson, Auburn, Citrus Bowl ....................................1-1-2001 4 Desmond Reed, Southern California, Rose Bowl .................1-1-2007
MOST YARDS RETURNED 108 Freddie Milons, Alabama, Orange Bowl ..................................1-1-2000 66 Ray Horton, Washington, Rose Bowl ........................................1-1-1981 52 Ray Mickens, Texas A&M, Alamo Bowl ................................12-28-1995 48 Clifton Robinson, Auburn, Citrus Bowl ....................................1-1-2001
KICKOFF RETURNS
MOST RETURNS 7 Ramonce Taylor, Texas, Rose Bowl .............................................1-1-2005 4 Tyrone Ashley, Mississippi, Gator Bowl ....................................1-1-1991 4 Kevin Matier, N.C. State, Hall of Fame Bowl ............................1-1-1994 3 Cliff Watkins, Oregon State, Rose Bowl ....................................1-1-1965 3 Miles Moore, Stanford, Rose Bowl .............................................1-1-1972 3 Anthony Allen, Washington, Rose Bowl ..................................1-1-1981 3 Paul Miles, Nebraska, Fiesta Bowl ..............................................1-1-1986 3 Jay Barry, Washington, Rose Bowl .............................................1-1-1993 3 Van Ward, Colorado State, Holiday Bowl ............................12-30-1994
MOST YARDS RETURNED 201 Ramonce Taylor, Texas, Rose Bowl .............................................1-1-2005 113 Tyrone Ashley, Mississippi, Gator Bowl ....................................1-1-1991 90 Kevin Matier, N.C. State, Hall of Fame Bowl ............................1-1-1994 78 Kyle Stevens, Washington, Rose Bowl ......................................1-2-1978 68 Napoleon Kaufman, Washington, Rose Bowl ........................1-1-1993
INTERCEPTIONS
MOST INTERCEPTIONS 2 Scott Hill, Oklahoma, Orange Bowl ...........................................1-1-1976 1 Many players
MOST YARDS RETURNED 88 Dwayne Rudd, Alabama, Outback Bowl ..................................1-1-1997 50 Tyrone Ashley, Mississippi, Gator Bowl ....................................1-1-1991 44 Andre Williams, Texas A&M, Alamo Bowl ...........................12-28-1995 33 Ronnie Lott, Southern California, Rose Bowl .........................1-1-1979 31 Dennis Smith, Southern California, Rose Bowl .....................1-1-1979
TOTAL RETURNS
MOST RETURNS 9 Ramonce Taylor, Texas, Rose Bowl .............................................1-1-2005 6 Raymond Butler, Southern California, Rose Bowl ................1-1-1979 6 Freddie Milons, Alabama, Orange Bowl ..................................1-1-2000 5 Tyrone Ashley, Mississippi, Gator Bowl ....................................1-1-1991 5 Keiwan Ratliff, Florida, Outback Bowl .......................................1-1-2003
MOST YARDS RETURNED 202 Ramonce Taylor, Texas, Rose Bowl .............................................1-1-2005 163 Tyrone Ashley, Mississippi, Gator Bowl ....................................1-1-1991 153 Freddie Milons, Alabama, Orange Bowl ..................................1-1-2000 90 Kevin Matier, N.C. State, Hall of Fame Bowl ............................1-1-1994 88 Dwayne Rudd, Alabama, Outback Bowl ..................................1-1-1997
DEFENSE (Since 1966)
MOST TACKLES 16 Buddy Curry, North Carolina, Gator Bowl ..........................12-28-1979 15 Riki Gray, Southern California, Rose Bowl ...............................1-1-1979 14 Charles Weaver, Southern California, Rose Bowl ..................1-1-1970 14 Robert Jensen, Southern California, Rose Bowl ....................1-1-1970 14 Randall Poltl, Stanford, Rose Bowl .............................................1-1-1972
SCORING
MOST POINTS SCORED 24 Vince Young, Texas, Rose Bowl ....................................................1-1-2005 18 Shaun Alexander, Alabama, Orange Bowl ..............................1-1-2000 18 Vick Ballard, Mississippi State, Gator Bowl ..............................1-1-2011 16 Kyle Bryant, Texas A&M, Alamo Bowl ..................................12-28-1995 12 on 14 different occasions: Last: Percy Harvin, Florida, Capital One Bowl ........................1-1-2008 Andre Caldwell, Florida, Capital One Bowl..........................1-1-2008
MOST TOUCHDOWNS SCORED 4 Vince Young, Texas, Rose Bowl ....................................................1-1-2005 3 Shaun Alexander, Alabama, Orange Bowl ..............................1-1-2000 3 Vick Ballard, Mississippi State, Gator Bowl ..............................1-1-2011 2 on 14 different occasions: Last: Percy Harvin, Florida, Capital One Bowl ........................1-1-2008 Andre Caldwell, Florida, Capital One Bowl..........................1-1-2008
MOST FIELD GOALS SCORED 5 Kyle Bryant, Texas A&M, Alamo Bowl ..................................12-28-1995 3 Al Del Greco, Auburn, Sugar Bowl .............................................1-1-1984 3 Kent Bostrom, Arizona State, Rose Bowl .................................1-1-1987
MOST FIELD GOALS ATTEMPED (Since 1964) 7 Derek DePasquale, Mississippi State, Gator Bowl ................1-1-2011 6 Kyle Bryant, Texas A&M, Alamo Bowl ..................................12-28-1995 4 Rod Garcia, Stanford, Rose Bowl ................................................1-1-1972 4 Jeff Hayes, North Carolina, Gator Bowl ...............................12-28-1979 4 Al Del Greco, Auburn, Sugar Bowl .............................................1-1-1984 4 Kent Bostrom, Arizona State, Rose Bowl .................................1-1-1987
MOST POINT-AFTER-TOUCHDOWNS SCORED 7 Derek DePasquale, Mississippi State, Gator Bowl ................1-1-2011 6 Alex Walls, Tennessee, Citrus Bowl ............................................1-1-2002 5 Dusty Mangum, Texas, Rose Bowl .............................................1-1-2005 5 Joey Ijjas, Florida, Capital One Bowl .........................................1-1-2008 4 Travis Hanson, Washington, Rose Bowl ...................................1-1-1993 4 Todd Latourette, Arkansas, Citrus Bowl ...................................1-1-1999 4 Ryan Pflugner, Alabama, Orange Bowl ....................................1-1-2000 4 Damon Duval, Auburn, Citrus Bowl ..........................................1-1-2001 4 Ryan Killeen, Southern California, Rose Bowl ........................1-1-2004
33BOWL GAME HISTORY
RUSHING
MOST ATTEMPTS 89 Mike Hart 2005-05-07-08 78 Anthony Thomas 1998-99-2000-01 70 Butch Woolfolk 1979-79-81-81 68 Chris Perry 2001-02-03-04 64 Jamie Morris 1984-86-87-88 58 Tyrone Wheatley 1992-93-94-94 50 Bill Taylor 1970-72 47 Rick Leach 1976-77-78-79 42 Stan Edwards 1978-79-81-81 39 Rick Rogers 1981-83-84-84 39 Clarence Williams 1995-96-97-98
MOST YARDS GAINED 507 Tyrone Wheatley 1992-93-94-94 449 Jamie Morris 1984-86-87-88 430 Butch Woolfolk 1979-79-81-81 374 Anthony Thomas 1998-99-2000-01 333 Mike Hart 2005-05-07-08 266 Leroy Hoard 1988-89-90 186 Tshimanga Biakabutuka 1993-94-95 183 Ricky Powers 1991-92-93-94 176 Clarence Williams 1995-96-97-98 166 Stan Edwards 1978-79-81-81 161 Rick Rogers 1981-83-84-84
PASSING
MOST ATTEMPTED 157 Chad Henne 2005-05-07-08 121 John Navarre 2002-03-04 90 Brian Griese 1995-97-98 81 Elvis Grbac 1991-92-93 75 Rick Leach 1976-77-78-79 73 Tom Brady 1999-2000 49 Steve Smith 1981-83-84 48 Todd Collins 1992-94-94 41 Denard Robinson 2011- 38 Jim Harbaugh 1986-87
MOST COMPLETED 90 Chad Henne 2005-05-07-08 69 John Navarre 2002-03-04 48 Tom Brady 1999-2000 48 Brian Griese 1995-97-98 46 Elvis Grbac 1991-92-93 30 Rick Leach 1976-77-78-79 27 Denard Robinson 2011- 26 Todd Collins 1992-94-94 24 Steve Smith 1981-83-84 19 Jim Harbaugh 1986-87
MOST YARDS GAINED PASSING 1,179 Chad Henne 2005-05-07-08 830 John Navarre 2002-03-04 720 Brian Griese 1995-97-98 601 Elvis Grbac 1991-92-93 485 Rick Leach 1976-77-78-79 478 Tom Brady 1999-2000 354 Todd Collins 1992-94-94 348 John Wangler 1979-81 331 Steve Smith 1981-83-84 315 Drew Henson 1999-2000-01
MOST TOUCHDOWN PASSES THROWN 12 Chad Henne 2005-05-07-08 7 Elvis Grbac 1991-92-93 6 Brian Griese 1995-97-98 5 Tom Brady 1999-2000 4 John Navarre 2002-03-04 3 Rick Leach 1976-77-78-79 3 Todd Collins 1992-94-94 2 John Wangler 1979-81 2 Bob Chappuis 1948 2 Dave Hall 1983 2 Demetrius Brown 1988-89 2 Drew Henson 1999-2000-01 2 Denard Robinson 2011-
MOST INTERCEPTIONS THROWN 6 Rick Leach 1976-77-78-79 4 Chad Henne 2005-05-07-08 3 Jim Harbaugh 1986-87 3 Todd Collins 1992-94-94 3 Brian Griese 1995-97-98 2 B.J. Dickey 1979 2 Dave Hall 1983 2 Steve Smith 1981-83-84 2 Elvis Grbac 1991-92-93 2 Tom Brady 1999-2000
HIGHEST PASS EFF. (Min. 25 at tempts) 192.3 John Wangler 1979-81 142.7 Elvis Grbac 1991-92-93140.5 Chad Henne 2005-05-07-08124.2 Todd Collins 1992-94-94 107.4 Demetrius Brown 1988-89 104.3 Steve Smith 1981-83-84 91.5 Rick Leach 1976-77-78-79
RECEIVING
MOST PASSES CAUGHT 24 Braylon Edwards 2003-04-05 20 Anthony Carter 1979-81-81-83 17 Steve Breaston 2004-05-05-07 15 David Terrell 1999-2000-01 15 Marquise Walker 1999-2000-01-02 14 Mario Manningham 2005-07-08 13 Tai Streets 1995-96-97-98 13 Adrian Arrington 2005-07-08 12 Amani Toomer 1993-94-94-95 12 Russell Shaw 1997-98 12 Bennie Joppru 2000-01-02-03 12 Jason Avant 2003-04-05 12 Tyler Ecker 2004-05-05-07
MOST YARDS GAINED 395 Anthony Carter 1979-81-81-83 326 Braylon Edwards 2003-04-05 312 David Terrell 1999-2000-01 268 Tai Streets 1995-96-97-98 265 Marquise Walker 1999-2000-01-02 261 Steve Breaston 2004-05-05-07 242 Amani Toomer 1993-94-94-95 202 Desmond Howard 1990-91-92 198 Tyler Ecker 2004-05-05-07 187 Adrian Arrington 2005-07-08 185 Mario Manningham 2005-07-08
Individual Career Bowl Records
Tom Brady set or tied Michigan bowl game passing marks for attempts (46), completions (34), yards (369) and TDs (four) vs. Alabama in the 2000 Orange Bowl.
Braylon Edwards caught 24 passes for 326 yards and three TDs during his three bowl appearances, including 20 catches for 216 yards and 3 TDs in two Rose Bowl games.
BOWL GAME RECORDS34
MOST TOUCHDOWN PASSES CAUGHT4 Anthony Carter 1979-81-81-83
4 Amani Toomer 1993-94-94-95 4 David Terrell 1999-2000-01 3 Braylon Edwards 2003-04-05 3 Adrian Arrington 2005-07-08 2 Desmond Howard 1990-91-92 2 Tony McGee 1992-93 2 Tai Streets 1996-97-98 2 B.J. Askew 2000-01-02-03 2 Steve Breaston 2004-05-05-07 2 Mario Manningham 2005-07-08
TOTAL OFFENSE
MOST PLAYS183 Chad Henne 2005-05-07-08
139 John Navarre 2002-03-04 122 Rick Leach 1976-77-78-79 114 Brian Griese 1995-97-98 90 Elvis Grbac 1991-92-93 81 Tom Brady 1999-2000
78 Anthony Thomas 1998-99-2000-0178 Chris Perry 2001-02-03-04
71 Steve Smith 1981-83-84 70 Butch Woolfolk 1979-79-81-81
MOST YARDS GAINED 1145 Chad Henne 2005-05-07-08 748 John Navarre 2002-03-04 723 Brian Griese 1995-97-98 608 Rick Leach 1976-77-78-79 559 Tom Brady 1999-2000
557 Elvis Grbac 1991-92-93507 Tyrone Wheatley 1992-93-94-94
449 Jamie Morris 1984-86-87-88 430 Butch Woolfolk 1979-81-81 424 Steve Smith 1981-83-84
ALL-PURPOSE
MOST PLAYS95 Mike Hart 2005-05-07-08
89 Anthony Thomas 1998-99-2000-0178 Butch Woolfolk 1979-79-81-81
76 Jamie Morris 1984-86-87-88 74 Chris Perry 2001-02-03-04 68 Tyrone Wheatley 1992-93-94-94 53 Bill Taylor 1970-72 47 Rick Leach 1976-77-78-79 46 Steve Breaston 2004-05-05-07 44 Stan Edwards 1978-79-81-81
MOST YARDS GAINED 812 Steve Breaston 2004-05-05-07 608 Tyrone Wheatley 1992-93-94-94 605 Anthony Carter 1979-81-81-83 571 Jamie Morris 1984-86-87-88 491 Butch Woolfolk 1979-79-81-81 444 Anthony Thomas 1998-99-2000-01
377 Mike Hart 2005-05-07-08 350 Chris Perry 2001-02-03-04 336 Desmond Howard 1990-91 332 Mercury Hayes 1993-94-94-95 288 Ralph Clayton 1978-79-79
PUNTING
MOST PUNTS 25 Don Bracken 1981-81-83-84 24 Monte Robbins 1984-86-87-88 24 Hayden Epstein 1999-2000-01-02 19 John Anderson 1976-77-78 18 Chris Stapleton 1990-93-94 16 Adam Finley 2003-04-05 12 Eddie Azcona 1991-92 8 Gregg Willner 1979 8 Zoltan Mesko 2007-08 7 Barry Dotzauer 1972 7 Paul Peristeris 1995 7 Ross Ryan 2005 HIGHEST AVG. YDS/PUNT (Min. 5 punts) 42.5 Zoltan Mesko (8-340) 2007-08 41.9 Chris Stapleton (18-755) 1990-93-94 41.6 Hayden Epstein (24-998) 1999-2000-01 41.4 Monte Robbins (24-993) 1984-86-87-88 41.2 Don Bracken (25-1031) 1981-81-83-84 41.1 John Anderson (19-781) 1976-77-78 41.0 Adam Finley (12-492) 2003-04-05 40.0 Hayden Epstein (5-200) 1999 38.9 Barry Dotzauer (7-272) 1972 36.9 Gregg Willner (8-295) 1979
PUNT RETURNS
MOST RETURNS 11 Anthony Carter 1979-81-81-83 9 Steve Breaston 2004-05-05-07 7 Charles Woodson 1996-97-98 6 Rick Sygar 1965 6 Dwight Hicks 1976-77-78 6 DiAllo Johnson 1999 6 Julius Curry 2000-01-02-03 5 Mike Jolly 1977-78-79 5 Desmond Howard 1990-91-92
MOST YARDS RETURNED107 Derrick Alexander 1990-91-93-94
86 Charles Woodson 1996-97-9874 Steve Breaston 2004-05-05-07
68 Anthony Carter 1979-81-81-83 51 DiAllo Johnson 1999
50 Rick Sygar 196543 Julius Curry 2000-01-02-03
34 Junior Hemingway 2011- 29 Desmond Howard 1990-91-92 24 Bob Mielke 1965 24 John Kolesar 1986-88-89
KICKOFF RETURNS
MOST RETURNS15 Steve Breaston 2004-05-05-07
9 Mercury Hayes 1993-94-94-95 8 Todd Howard 2002
7 Martavious Odoms 2011-5 Ralph Clayton 1978-79-795 Anthony Carter 1979-81-81-83
5 Walter Cross 20005 Brandon Minor 2007-084 Bo Rather 19724 Jamie Morris 1984-86-87-88
4 Allen Jefferson 1988-90-914 Desmond Howard 1990-91-924 Tyrone Wheatley 1992-93-94-94
MOST YARDS RETURNED 443 Steve Breaston 2004-05-05-07 193 Mercury Hayes 1993-94-94-95 163 Martavious Odoms 2011- 125 Todd Howard 2002 107 Allen Jefferson 1988-90-91 102 Ralph Clayton 1978-79-79 102 Anthony Carter 1979-81-81-83 98 Brandon Minor 2007-08 97 Walter Cross 2000 87 Bo Rather 1972
INTERCEPTIONS
MOST INTERCEPTIONS2 Brad Cochran 1984-842 David Arnold 1986-87-88-89
2 Ty Law 1992-93-942 Clarence Thompson 1994-94-952 Charles Woodson 1996-97-982 Leon Hall 2004-05-05-07
MOST YARDS RETURNED 48 David Arnold 1986-87-88-89 46 Ian Gold 1999
43 Clarence Thompson 1994-94-9539 Julius Curry 2000-0136 Otis Williams 1989-90-91-92
26 James Whitley 199925 Mike Jolly 197823 Dwight Hicks 1976-77-7823 Prescott Burgess 2005-05-0721 Calvin O'Neal 1977
Steve Breaston set a Rose Bowl record with 315 all-purpose yards in the 2005 Rose Bowl game against Texas. He holds Michigan's career kick-off return yardage record with 443 yards on 15 returns in bowl action.
35BOWL GAME HISTORY
TOTAL RETURNS
MOST RETURNS24 Steve Breaston 2004-05-05-07
16 Anthony Carter 1979-81-81-83 11 Mercury Hayes 1993-94-94-95 9 Desmond Howard 1990-91-92 9 Charles Woodson 1996-97-98 8 Dwight Hicks 1976-77-78 8 Todd Howard 2002 7 Martavious Odoms 2011- 6 Rick Sygar 1965 6 Mike Jolly 1977-78-79 6 Julius Curry 2000-01-02-03
MOST YARDS RETURNED 517 Steve Breaston 2004-05-05-07 194 Mercury Hayes 1993-94-94-95 170 Anthony Carter 1979-81-81-83 163 Martavious Odoms 2011-
135 Derrick Alexander 1990-91-93-94 125 Todd Howard 2002 107 Allen Jefferson 1988-90-91 102 Ralph Clayton 1978-79-79 100 Desmond Howard 1990-91-92 97 Walter Cross 2000
TACKLES (Since 1968)
MOST TACKLES41 Erick Anderson 1989-90-91-92
39 Ron Simpkins 1978-79-79 35 Mike Mallory 1984-84-86 33 Garland Rivers 1984-86-87 32 Sam Sword 1995-96-97-98 29 Andy Cannavino 1979-79-81 29 Dhani Jones 1998-99-2000 28 Victor Hobson 2000-01-02-03 27 Paul Girgash 1979-81-81-83 27 Steve Morrison 1992-93-94-94 25 Calvin O'Neal 1976-77 25 Curtis Greer 1978-79-79
SCORING
MOST POINTS SCORED 42 Tyrone Wheatley 1992-93-94-94 36 Anthony Thomas 1998-99-2000-01 30 Chris Perry 2001-02-03-04 24 Anthony Carter 1979-81-81-83 24 Jamie Morris 1984-86-87-88 24 Amani Toomer 1993-94-94-95 24 David Terrell 1999-2000-01 18 Jack Weisenburger 1948 18 Mel Anthony 1965 18 Jim Harbaugh 1986-87 18 Braylon Edwards 2003-04-05 18 Adrian Arrington 2005-07-08
MOST TOUCHDOWNS SCORED 7 Tyrone Wheatley 1992-93-94-94 6 Anthony Thomas 1998-99-2000-01 5 Chris Perry 2001-02-03-04 4 Anthony Carter 1979-81-81 4 Jamie Morris 1984-86-87-88 4 Amani Toomer 1993-94-94-95 4 David Terrell 1999-2000-01 3 Jack Weisenburg 1948 3 Mel Anthony 1965 3 Jim Harbaugh 1986-87 3 Braylon Edwards 2003-04-05 3 Adrian Arrington 2005-07-08
MOST FIELD GOALS MADE 4 Garrett Rivas 2004-05-05-07 3 Ali Haji-Sheikh 1981-81-83 3 Remy Hamilton 1994-94-95 2 Pat Moons 1986 2 Hayden Epstein 1999-2000-01-02 2 K.C. Lopata 2008 1 Tim Killian 1970 1 Dana Coin 1972 1 Gregg Willner 1978-79 1 Bryan Virgil 1979 1 Bob Bergeron 1984-84 1 Mike Gillette 1987-88-89 1 J. D. Carlson 1990-91-92 1 Peter Elezovic 1993-94 1 Jay Feely 1999 1 Adam Finley 2003
MOST FIELD GOALS ATTEMPTED 6 Garrett Rivas 2004-05-05-07 4 Ali Haji-Sheikh 1981-81-83 4 Hayden Epstein 1999-2000-01-02 3 Mike Gillette 1987-88-89 3 Remy Hamilton 1994-94-95 2 Dana Coin 1972 2 Bob Wood 1976 2 Pat Moons 1986 2 J.D. Carlson 1990-91-92 2 Peter Elezovic 1993-94 2 Jay Feely 1999 2 K.C. Lopata 2008
Anthony Thomas was a two-time Most Valuable Player of the Florida Citrus Bowl, gaining honors in the 1999 and 2001 games.
Erick Anderson tallied a Michigan bowl record 41 tackles during his career.
MOST PATs MADE 11 Peter Elezovic 1993-94 11 Hayden Epstein 1999-2000-01-02 11 Garrett Rivas 2004-05-05-07 8 J.D. Carlson 1990-91-92 7 Jim Brieske 1948 7 Ali Haji-Sheikh 1981-81-83 6 Mike Gillette 1987-88-89 6 Jay Feely 1999 5 Remy Hamilton 1994-94-95 5 Adam Finley 2003 5 K.C. Lopata 2008
BOWL GAME RECORDS36
Team Single Game Bowl RecordsFIRST DOWNS
MOST FIRST DOWNSMichigan 35 Mississippi, Gator Bowl 1991 28 Florida, Capital One Bowl 2008 27 Stanford, Rose Bowl 1902 25 UCLA, Bluebonnet Bowl 1981 25 Southern California, Rose Bowl 2004Both Teams 46 Florida, Capital One Bowl 2008 45 Brigham Young, Holiday Bowl 1984 45 Mississippi, Gator Bowl 1991 45 Florida, Outback Bowl 2003Opponents 32 Brigham Young, Holiday Bowl 1984 28 Alabama, Hall of Fame Bowl 1988 28 Florida, Outback Bowl 2003 26 Mississippi State, Gator Bowl 2011
FEWEST FIRST DOWNSMichigan 10 Washington, Rose Bowl 1992 11 Southern California, Rose Bowl 1990Both Teams 26 Southern California, Rose Bowl 1979 28 Oklahoma, Orange Bowl 1976 Opponents 5 Stanford, Rose Bowl 1902 10 Southern California, Rose Bowl 1948 12 California, Rose Bowl 1951 12 Alabama, Orange Bowl 2000
RUSHING
MOST ATTEMPTSMichigan 90 Stanford, Rose Bowl 1902 74 Stanford, Rose Bowl 1972 60 Washington, Rose Bowl 1981 Both Teams 117 Oklahoma, Orange Bowl 1976 114 Stanford, Rose Bowl 1902 109 Nebraska, Fiesta Bowl 1986 Opponents 67 Auburn, Sugar Bowl 1984 65 Oklahoma, Orange Bowl 1976
FEWEST ATTEMPTSMichigan 23 Alabama, Orange Bowl 2000 25 Mississippi State, Gator Bowl 2011 27 Southern California, Rose Bowl 2007 29 Arizona State, Rose Bowl 1987Both Teams 50 Southern California, Rose Bowl 2007 60 Alabama, Orange Bowl 2000 63 Southern California, Rose Bowl 2004 68 Tennessee, Citrus Bowl 2002 69 Washington State, Rose Bowl 1998Opponents 23 Stanford, Rose Bowl 1972 23 Southern California, Rose Bowl 2007 24 Stanford, Rose Bowl 1902 25 Southern California, Rose Bowl 2004 27 Brigham Young, Holiday Bowl 1984
MOST NET YARDSMichigan 527 Stanford, Rose Bowl 1902 391 Mississippi, Gator Bowl 1991 332 Oregon State, Rose Bowl 1965Both Teams 594 Stanford, Rose Bowl 1902 484 Mississippi, Gator Bowl 1991 475 Nebraska, Fiesta Bowl 1986 Opponents 304 Nebraska, Fiesta Bowl 1986 301 Auburn, Sugar Bowl 1984
FEWEST NET YARDSMichigan 12 Southern California, Rose Bowl 2007 37 Alabama, Orange Bowl 2000 49 Southern California, Rose Bowl 2004 53 Arizona State, Rose Bowl 1987 72 Washington, Rose Bowl 1992 Both Teams 60 Southern California, Rose Bowl 2007 117 Southern California, Rose Bowl 2004 195 Washington State, Rose Bowl 1998 195 Washington, Rose Bowl 1992 200 Tennessee, Citrus Bowl 2002Opponents 33 UCLA, Bluebonnet Bowl 1981 48 Southern California, Rose Bowl 2007 51 Colorado State, Holiday Bowl 1994
PASSING
MOST ATTEMPTEDMichigan 47 Alabama, Orange Bowl 2000 46 Southern California, Rose Bowl 2004 43 Nebraska, Alamo Bowl 2005 41 Southern California, Rose Bowl 2007 41 Mississippi State, Gator Bowl 2011Both Teams 86 Southern California, Rose Bowl 2007 81 Southern California, Rose Bowl 2004 79 Florida, Outback Bowl 2003 74 Tennessee, Citrus Bowl 2002 74 Nebraska, Alamo Bowl 2005 Opponents 49 Brigham Young, Holiday Bowl 1984 45 Southern California, Rose Bowl 2007 44 Stanford, Rose Bowl 1972 42 Florida, Outback Bowl 2003
FEWEST ATTEMPTEDMichigan 11 Oregon State, Rose Bowl 1965 11 Stanford, Rose Bowl 1972 Both Teams 25 Oklahoma, Orange Bowl 1976 29 California, Rose Bowl 1951 Opponents 5 Oklahoma, Orange Bowl 1976 6 Auburn, Sugar Bowl 1984
MOST COMPLETEDMichigan 35 Alabama, Orange Bowl 2000 27 Southern California, Rose Bowl 2004
27 Mississippi State, Gator Bowl 2011 26 Southern California, Rose Bowl 2007 25 Florida, Capital One Bowl 2008 Both Teams 53 Southern California, Rose Bowl 2007 51 Southern California, Rose Bowl 2004 48 Alabama, Orange Bowl 2000 48 Tennessee, Citrus Bowl 2002 45 Mississippi State, Gator Bowl 2011Opponents 35 Brigham Young, Holiday Bowl 1984 28 Auburn, Citrus Bowl 2001 27 Southern California, Rose Bowl 2007 25 Washington, Rose Bowl 1992 24 Southern California, Rose Bowl 2004
FEWEST COMPLETEDMichigan 2 Oklahoma, Orange Bowl 1976 3 Stanford, Rose Bowl 1972 Both Teams 5 Oklahoma, Orange Bowl 1976 11 Auburn, Sugar Bowl 1984 Opponents 2 Auburn, Sugar Bowl 1984 3 Oklahoma, Orange Bowl 1976
HIGHEST COMP. PCT. (Min 10 att)Michigan 77.1 Tennessee, Citrus Bowl 2002 72.7 Oregon State, Rose Bowl 1965 71.4 California, Rose Bowl 1951 71.4 Auburn, Citrus Bowl 2001 Opponents 78.3 Mississippi State, Gator Bowl 2011 75.7 Auburn, Citrus Bowl 2001 72.0 UCLA, Rose Bowl 1983 71.4 Brigham Young, Holiday Bowl 1984 71.4 South ern Cal, Rose Bowl 1989
LOWEST COMP. PCT. (Min 10 att)Michigan 10.0 Okla homa, Orange Bowl 1976 27.3 Stan ford, Rose Bowl 1972 Opponents 40.0 Ne braska, Fiesta Bowl 1986 46.2 UCLA, Bluebonnet Bowl 1981
37BOWL GAME HISTORY
MOST NET YARDSMichigan 373 Florida, Capital One Bowl 2008 369 Alabama, Orange Bowl 2000 328 North Carolina, Gator Bowl 1979 324 Mississippi, Gator Bowl 1991 319 Florida, Outback Bowl 2003 Both Teams 700 Southern California, Rose Bowl 2007 688 Auburn, Citrus Bowl 2001 646 Tennessee, Citrus Bowl 2002 642 Florida, Outback Bowl 2003 613 Southern California, Rose Bowl 2004Opponents 406 Tennessee, Citrus Bowl 2002 394 Auburn, Citrus Bowl 2001 391 Southern California, Rose Bowl 2007 371 Brigham Young, Holiday Bowl 1984 342 Southern California, Rose Bowl 2004
FEWEST NET YARDSMichigan 26 Stan ford, Rose Bowl 1972 33 Okla homa, Orange Bowl 1976 Both Teams 96 Okla homa, Orange Bowl 1976 129 Ne braska, Fiesta Bowl 1986 Opponents 21 Au burn, Sugar Bowl 1984 23 Southern California, Rose Bowl 1979
MOST HAD INTERCEPTEDMichigan 3 Oklahoma, Orange Bowl 1976 3 UCLA, Rose Bowl 1983 3 Arizona State, Rose Bowl 1987 3 Colorado State, Holiday Bowl 1994 Both Teams 6 Mississippi, Gator Bowl 1991 5 Colorado State, Holiday Bowl 1994 Opponents 4 Mississippi, Gator Bowl 1991 4 N.C. State, Hall of Fame Bowl 1994
MOST TOUCHDOWN PASSESMichigan 4 Alabama, Orange Bowl 2000 4 Southern California, Rose Bowl 1948 4 Mississippi, Gator Bowl 1991 4 Texas, Rose Bowl 2005Both Teams 6 Nebraska, Alamo Bowl 2005 6 Southern California, Rose Bowl 2007 6 Florida, Capital One Bowl 2008 5 Tennessee, Citrus Bowl 2002 5 Alabama, Orange Bowl 2000 5 Auburn, Citrus Bowl 2001 5 Southern California, Rose Bowl 2004 5 Texas, Rose Bowl 2005 Opponents 4 Southern California, Rose Bowl 2004 4 Southern California, Rose Bowl 2007 3 Washington, Rose Bowl 1992 3 Auburn, Citrus Bowl 2001 3 Tennessee, Citrus Bowl 2002 3 Nebraska, Alamo Bowl 2005 3 Florida, Capital One Bowl 2008 3 Mississippi State, Gator Bowl 2011
TOTAL OFFENSE
MOST PLAYSMichigan 86 Florida, Capital One Bowl 2008 85 Southern California, Rose Bowl 1970 85 Stanford, Rose Bowl 1972 85 Mississippi, Gator Bowl 1991 85 Nebraska, Alamo Bowl 2005 Both Teams 159 Florida, Outback Bowl 2003 158 Arkansas, Citrus Bowl 1999 155 Southern California, Rose Bowl 1970 153 Mississippi, Gator Bowl 1991 153 Nebraska, Alamo Bowl 2005 Opponents 89 Alabama, Hall of Fame Bowl 1988 85 Washington, Rose Bowl 1992 85 Florida, Outback Bowl 2003 81 Mississippi State, Gator Bowl 2011
FEWEST PLAYSMichigan 49 Alabama, Hall of Fame Bowl 1988 52 Arizona State, Rose Bowl 1987 52 Southern California, Rose Bowl 1990 Both Teams 119 California, Rose Bowl 1951 121 UCLA, Bluebonnet Bowl 1981 Opponents 53 Alabama, Outback Bowl 1997 55 Southern California, Rose Bowl 1948 57 Alabama, Orange Bowl 2000
MOST NET YARDSMichigan 715 Mississippi, Gator Bowl 1991 524 Florida, Capital One Bowl 2008 491 Southern California, Rose Bowl 1948Both Teams 1048 Mississippi, Gator Bowl 1991 939 Auburn, Citrus Bowl 2001 929 Florida, Outback Bowl 2003 923 Florida, Capital One Bowl 2008 896 Washington, Rose Bowl 1993 Opponents 506 Florida, Outback Bowl 2003 503 Tennessee, Citrus Bowl 2002 486 Auburn, Citrus Bowl 2001 485 Mississippi State, Gator Bowl 2011 483 Brigham Young, Holiday Bowl 1984
FEWEST NET YARDSMichigan 202 Oklahoma, Orange Bowl 1976 202 Brigham Young, Holiday Bowl 1984 Both Teams 393 Southern California, Rose Bowl 1979 535 California, Rose Bowl 1951 Opponents 133 Southern California, Rose Bowl 1948 157 Southern California, Rose Bowl 1979
PUNTING
MOST PUNTSMichigan 21 Stanford, Rose Bowl 1902 10 Oklahoma, Orange Bowl 1976 10 Washington, Rose Bowl 1992Both Teams 37 Stanford, Rose Bowl 1902 19 Oklahoma, Orange Bowl 1976 17 Southern Cal, Rose Bowl 1979 17 Alabama, Orange Bowl 2000 17 Florida, Outback Bowl 2003 Opponents 16 Stanford, Rose Bowl 1902 9 Oregon State, Rose Bowl 1965 9 Oklahoma, Orange Bowl 1976 9 Southern California, Rose Bowl 1979 9 Alabama, Orange Bowl 2000
FEWEST PUNTSMichigan 1 Mississippi State, Gator Bowl 2011 2 California, Rose Bowl 1951 2 Mississippi, Gator Bowl 1991 2 Florida, Capital One Bowl 2008Both Teams 3 Mississippi State, Gator Bowl 2011 5 Florida, Capital One Bowl 2008 6 California, Rose Bowl 1951 7 Mississippi, Gator Bowl 1991 7 Southern Californa, Rose Bowl 2004Opponents 1 Brigham Young, Holiday Bowl 1984 2 Mississippi State, Gator Bowl 2011 3 Southern California, Rose Bowl 1977 3 Nebraska, Fiesta Bowl 1986 3 Auburn, Citrus Bowl 2001 3 Southern California, Rose Bowl 2004 3 Florida, Capital One Bowl 2008
HIGHEST NET YDS/PUNT (Min 3)Michigan 47.3 Washington, Rose Bowl 1981 47.0 N.C. State, Hall of Fame Bowl 1994 Opponents 51.5 Nebraska, Alamo Bowl 2005 50.3 Southern California, Rose Bowl 1989 47.8 UCLA, Bluebonnet Bowl 1981
LOWEST NET YDS/PUNT (Min 3)Michigan 24.0 Alabama, Outback Bowl 1997 28.0 Colorado State, Holiday Bowl 1994Opponents 29.7 Southern California, Rose Bowl 1977 31.8 Tennessee, Citrus Bowl 2002 32.1 Florida, Outback Bowl 2003
BOWL GAME RECORDS38
PUNT RETURNS
MOST PUNTS RETURNEDMichigan 8 Oregon State, Rose Bowl 1965 7 UCLA, Bluebonnet Bowl 1981 7 Nebraska, Alamo Bowl 2005 Both Teams 10 UCLA, Bluebonnet Bowl 1981 10 Nebraska, Alamo Bowl 2005 9 Southern California, Rose Bowl 1979 Opponents 5 Southern California, Rose Bowl 1990 4 Eight times LAST: Southern California, Rose Bowl 2007
FEWEST PUNTS RETURNEDMichigan 0 Southern California, Rose Bowl 1977 0 Brigham Young, Holiday Bowl 1984 0 Colorado State, Holiday Bowl 1994 0 Florida, Capital One Bowl 2008 Both Teams 1 Southern California, Rose Bowl 1977 1 Mississippi State, Gator Bowl 2011 2 Many games Opponents 0 Oregon State, Rose Bowl 1965 0 Mississippi, Gator Bowl 1991 0 Alabama, Outback Bowl 1997 0 Mississippi State, Gator Bowl 2011
MOST YARDS RETURNEDMichigan 92 N.C. State, Hall of Fame Bowl 1994 85 Oregon State, Rose Bowl 1965Both Teams 128 Alabama, Orange Bowl 2000 104 Nebraska, Alamo Bowl 2005 97 N.C. State, Hall of Fame Bowl 1994 85 Oregon State, Rose Bowl 1965Opponents 108 Alabama, Orange Bowl 2000 68 Southern California, Rose Bowl 1990 66 Washington, Rose Bowl 1981
FEWEST YARDS RETURNEDMichigan 0 Southern California, Rose Bowl 1977 0 Brigham Young, Holiday Bowl 1984 0 Colorado State, Holiday Bowl 1994 0 Southern California, Rose Bowl 2004 0 Florida, Capital One Bowl 2008 Both Teams - 6 Brigham Young, Holiday Bowl 1984 1 Southern California, Rose Bowl 1977 1 Southern California, Rose Bowl 2004 Opponents - 6 Brigham Young, Holiday Bowl 1984 0 Alabama, Outback Bowl 1997 0 Mississippi, Gator Bowl 1991 0 Mississippi State, Gator Bowl 2011
KICKOFF RETURNS
MOST KICKOFFS RETURNEDMichigan 8 Tennessee, Citrus Bowl 2002 8 Mississippi State, Gator Bowl 2011 6 Washington, Rose Bowl 1978 6 Arizona State, Rose Bowl 1987 6 Washington, Rose Bowl 1992 6 Texas, Rose Bowl 2005 6 Nebraska, Alamo Bowl 2005 6 Florida, Capital One Bowl 2008 Both Teams 14 Texas, Rose Bowl 2005 11 Tennessee, Citrus Bowl 2002 11 Florida, Capital One Bowl 2008 11 Mississippi State, Gator Bowl 2011 10 Alabama, Hall of Fame Bowl 1988 10 Washington, Rose Bowl 1993 Opponents 8 Texas, Rose Bowl 2005 7 Southern California, Rose Bowl 1948 7 Nebraska, Fiesta Bowl 1986
FEWEST KICKOFFS RETURNEDMichigan 0 UCLA, Bluebonnet Bowl 1981 1 Alabama, Outback Bowl 1997 Both Teams 3 UCLA, Bluebonnet Bowl 1981 3 UCLA, Rose Bowl 1983 2 Alabama, Outback Bowl 1997 2 Washington State, Rose Bowl 1998 Opponents 0 Washington State, Rose Bowl 1998 1 Southern California, Rose Bowl 1977 1 UCLA, Rose Bowl 1983 1 Alabama, Outback Bowl 1997
MOST YARDS RETURNEDMichigan 221 Texas, Rose Bowl 2005 191 Mississippi State, Gator Bowl 2011 186 Nebraska, Alamo Bowl 2005 125 Tennessee, Citrus Bowl 2002 118 Florida, Capital One Bowl 2008 Both Teams 435 Texas, Rose Bowl 2005 248 Mississippi State, Gator Bowl 2011 229 Nebraska, Alamo Bowl 2005 214 Washington, Rose Bowl 1993 198 Washington, Rose Bowl 1978Opponents 214 Texas, Rose Bowl 2005 144 Nebraska, Fiesta Bowl 1986 143 Washington, Rose Bowl 1993
FEWEST YARDS RETURNEDMichigan 0 UCLA, Bluebonnet Bowl 1981 3 Southern California, Rose Bowl 1951 Both Teams 31 Alabama, Outback Bowl 1997 38 Washington State, Rose Bowl 1998 43 UCLA, Bluebonnet Bowl 1981 Opponents 0 Washington State, Rose Bowl 1998 0 UCLA, Rose Bowl 1983 9 Alabama, Outback Bowl 1997
TOTAL RETURNS
MOST RETURNSMichigan 15 Nebraska, Alamo Bowl 2005 12 Washington, Rose Bowl 1978 11 Washington, Rose Bowl 1992 11 Tennessee, Citrus Bowl 2002 Both Teams 21 Nebraska, Alamo Bowl 2005 20 Texas, Rose Bowl 2005 19 Washington, Rose Bowl 1978 19 Washington, Rose Bowl 1992 19 Tennessee, Citrus Bowl 2002 Opponents 12 Texas, Rose Bowl 2005 10 Colorado State, Holiday Bowl 1994 9 Southern California, Rose Bowl 1948 9 Southern California, Rose Bowl 1979 9 North Carolina, Gator Bowl 1979 9 Florida, Capital One Bowl 2008
FEWEST RETURNSMichigan 3 North Carolina, Gator Bowl 1979 4 Many games Both Teams 6 Southern Cal, Rose Bowl 1977 8 Alabama, Outback Bowl 1997 8 Washington State, Rose Bowl 1998 Opponents 2 Southern California, Rose Bowl 1977 2 Alabama, Outback Bowl 1997 2 Washington State, Rose Bowl 1998
MOST YARDS RETURNEDMichigan 258 Nebraska, Alamo Bowl 2005 246 Texas, Rose Bowl 2005 225 Mississippi State, Gator Bowl 2011 203 N.C. State, Hall of Fame Bowl 1994 183 Arkansas, Citrus Bowl 1999Both Teams 469 Texas, Rose Bowl 2005 333 Nebraska, Alamo Bowl 2005 318 N.C. State, Hall of Fame Bowl 1994 282 Mississippi State, Gator Bowl 2011 277 Arkansas, Citrus Bowl 1999Opponents 223 Texas, Rose Bowl 2005 192 Mississippi, Gator Bowl 1991 182 Alabama, Orange Bowl 2000 164 Nebraska, Fiesta Bowl 1986
FEWEST YARDS RETURNEDMichigan 25 Washington, Rose Bowl 1981 32 Nebraska, Fiesta Bowl 1986 Both Teams 58 Brigham Young, Holiday Bowl 1984 88 Oklahoma, Orange Bowl 1976 Opponents 2 Washington State, Rose Bowl 1998 17 Southern California, Rose Bowl 1977 23 Brigham Young, Holiday Bowl 1984
39BOWL GAME HISTORY
INTERCEPTIONS
MOST INTERCEPTIONSMichigan 4 N.C. State, Hall of Fame Bowl 1994 4 Mississippi, Gator Bowl 1991Both Teams 6 Mississippi, Gator Bowl 1991 5 Colorado State, Holiday Bowl 1994Opponents 3 Oklahoma, Orange Bowl 1976 3 UCLA, Rose Bowl 1983 3 Arizona State, Rose Bowl 1987 3 Colorado State, Holiday Bowl 1994
MOST YARDS RETURNEDMichigan 72 Arkansas, Citrus Bowl 1999 63 N.C. State, Hall of Fame Bowl 1994 48 Washington, Rose Bowl 1978 Both Teams 120 Arkansas, Citrus Bowl 1999 88 Alabama, Outback Bowl 1997 65 Mississippi, Gator Bowl 1991Opponents 88 Alabama, Outback Bowl 1997 64 Southern California, Rose Bowl 1979
FUMBLES
MOST FUMBLESMichigan 4 Southern California, Rose Bowl 1977 4 Tennessee, Citrus Bowl 2002 4 Nebraska, Alamo Bowl 2005 4 Florida, Capital One Bowl 2008 3 Alabama, Outback Bowl 1997 3 Washington, Rose Bowl 1992 3 Southern California, Rose Bowl 2004 Both Teams 9 Stanford, Rose Bowl 1902 8 Nebraska, Fiesta Bowl 1986 7 Tennessee, Citrus Bowl 2002 Opponents 9 Stanford, Rose Bowl 1902 6 Nebraska, Fiesta Bowl 1986 4 Many games
FEWEST FUMBLESMichigan 0 Washington State, Rose Bowl 1998 0 Washington, Rose Bowl 1981 0 Alabama, Hall of Fame Bowl 1988 0 Colorado State, Holiday Bowl 1994 Both Teams 1 Arkansas, Citrus Bowl 1999 1 Alabama, Hall of Fame Bowl 1988 1 Mississippi State, Gator Bowl 2011 2 Many gamesOpponents 0 Washington, Rose Bowl 1978 0 Southern California, Rose Bowl 1990 0 Washington, Rose Bowl 1992 0 Arkansas, Citrus Bowl 1999 0 Nebraska, Alamo Bowl 2005 0 Mississippi State, Gator Bowl 2011
MOST FUMBLES LOSTMichigan 2 California, Rose Bowl 1951 2 Southern California, Rose Bowl 1977 2 North Carolina, Gator Bowl 1979 2 Tennessee, Citrus Bowl 2002 2 Nebraska, Alamo Bowl 2005 2 Florida, Capital One Bowl 2008 Both Teams 5 Stanford, Rose Bowl 1972 4 Many games Opponents 4 Stanford, Rose Bowl 1972 3 Many games
FEWEST FUMBLES LOSTMichigan 0 Many games LAST: Texas, Rose Bowl 2005 Both Teams 0 Washington State, Rose Bowl 1998 0 Southern California, Rose Bowl 1970 0 Arizona State, Rose Bowl 1987 0 Southern California, Rose Bowl 1990 0 Washington, Rose Bowl 1992 Opponents 0 Many games LAST: Mississippi State, Gator Bowl 2011
TURNOVERS
MOST TURNOVERSMichigan 4 California, Rose Bowl 1951 4 North Carolina, Gator Bowl 1979 4 UCLA, Rose Bowl 1983 4 Florida, Capital One Bowl 2008 Both Teams 9 Mississippi, Gator Bowl 1991 7 Brigham Young, Holiday Bowl 1984 7 Colorado State, Holiday Bowl 1994Opponents 6 Brigham Young, Holiday Bowl 1984 6 Mississippi, Gator Bowl 1991 6 N.C. State, Hall of Fame Bowl 1994
FEWEST TURNOVERSMichigan 0 Washington, Rose Bowl 1981 0 Nebraska, Fiesta Bowl 1986 0 Alabama, Hall of Fame Bowl 1988 0 Southern California, Rose Bowl 1990 0 Washington, Rose Bowl 1993 0 N. C. State, Hall of Fame Bowl 1994 0 Florida, Outback Bowl 2003 0 Texas, Rose Bowl 2005 Both Teams 1 Southern California, Rose Bowl 1970 1 Southern California, Rose Bowl 1990 1 Washington, Rose Bowl 1993 1 Southern California, Rose Bowl 2004 Opponents 0 Southern California, Rose Bowl 1970 0 UCLA, Rose Bowl 1983 0 Arizona State, Rose Bowl 1987 0 Alabama, Orange Bowl 2000 0 Southern California, Rose Bowl 2004
PENALTIES
MOST PENALTIESMichigan 12 Arkansas, Citrus Bowl 1999 11 Brigham Young, Holiday Bowl 1984 11 Colorado State, Holiday Bowl 1994Both Teams 28 Alabama, Orange Bowl 2000 23 UCLA, Bluebonnet Bowl 1981 20 Brigham Young, Holiday Bowl 1984 Opponents 18 Alabama, Orange Bowl 2000 14 UCLA, Bluebonnet Bowl 1981 11 Southern California, Rose Bowl 1989 11 Texas A&M, Alamo Bowl 1995
FEWEST PENALTIESMichigan 1 Alabama, Hall of Fame Bowl 1988 2 Many games Both Teams 5 Southern California, Rose Bowl 1948 5 Stanford, Rose Bowl 1972 5 UCLA, Rose Bowl 1983 5 Alabama, Hall of Fame Bowl 1988 5 Southern California, Rose Bowl 2004 5 Southern California, Rose Bowl 2007 Opponents 1 Southern California, Rose Bowl 1948 2 Southern California, Rose Bowl 1979 2 UCLA, Rose Bowl 1983
MOST YARDS PENALIZEDMichigan 115 Alabama, Orange Bowl 2000 112 Brigham Young, Holiday Bowl 1984 104 Arkansas, Citrus Bowl 1999 99 UCLA, Bluebonnet Bowl 1981 Both Teams 247 Alabama, Orange Bowl 2000 242 UCLA, Bluebonnet Bowl 1981 194 Brigham Young, Holiday Bowl 1984 Opponents 143 UCLA, Bluebonnet Bowl 1981 132 Alabama, Orange Bowl 2000 110 Texas A&M, Alamo Bowl 1995
FEWEST YARDS PENALIZEDMichigan 5 Alabama, Hall of Fame Bowl 1988 10 Southern California, Rose Bowl 2004 11 Washington, Rose Bowl 1978 Both Teams 27 UCLA, Rose Bowl 1983 32 Southern California, Rose Bowl 2004 35 Alabama, Hall of Fame Bowl 1988 Opponents 10 Southern California, Rose Bowl 1948 10 UCLA, Rose Bowl 1983
BOWL GAME RECORDS40
SCORING
MOST POINTSMichigan 49 Stanford, Rose Bowl 1902 49 Southern California, Rose Bowl 1948 45 Arkansas, Citrus Bowl 1999 42 N.C. State, Hall of Fame Bowl 1994 41 Florida, Capital One Bowl 2008Both Teams 76 Arkansas, Citrus Bowl 1999 76 Florida, Capital One Bowl 2008 75 Texas, Rose Bowl 2005 69 Washington, Rose Bowl 1993 69 Alabama, Orange Bowl 2000 Opponents 52 Mississippi State, Gator Bowl 2011 45 Tennessee, Citrus Bowl 2002 38 Texas, Rose Bowl 2005 35 Florida, Capital One Bowl 2008 34 Washington, Rose Bowl 1992
FEWEST POINTSMichigan 3 Southern California, Rose Bowl 1970 6 Oklahoma, Orange Bowl 1976 6 Southern California, Rose Bowl 1977 Both Teams 13 Southern California, Rose Bowl 1970 16 Auburn, Sugar Bowl 1984 Opponents 0 Stanford, Rose Bowl 1902 0 Southern California, Rose Bowl 1948 3 Mississippi, Gator Bowl 1991
MOST DECISIVE WINMichigan 49 Stanford, Rose Bowl (49-0) 1902 49 Southern California, Rose Bowl (49-0) 1948 35 N.C. State, Hall of Fame Bowl (42-7) 1994
MOST DECISIVE LOSSMichigan 38 Mississipp State, Gator Bowl (14-52) 2011 28 Tennessee, Citrus Bowl (17-45) 2002 20 Washington, Rose Bowl (14-34) 1992 14 USC, Rose Bowl (14-28) 2004 14 USC, Rose Bowl (18-32) 2007
MOST TOUCHDOWNSMichigan 8 Stanford, Rose Bowl 1902 7 Southern California, Rose Bowl 1948 6 N. C. State, Hall of Fame Bowl 1994 6 Arkansas, Citrus Bowl 1999 Both Teams 10 Arkansas, Citrus Bowl 1999 10 Alabama, Orange Bowl 2000 10 Florida, Capital One Bowl 2008 9 Washington, Rose Bowl 1993 9 Florida, Outback Bowl 2003 9 Texas, Rose Bowl 2005 9 Mississippi State, Gator Bowl 2011Opponents 7 Mississippi State, Gator Bowl 2011 5 Tennessee, Citrus Bowl 2002 5 Alabama, Orange Bowl 2000 5 Texas, Rose Bowl 2005 5 Florida, Capital One Bowl 2008 4 Washington, Rose Bowl 1992 4 Washington, Rose Bowl 1993 4 Arkansas, Citrus Bowl 1999 4 Auburn, Citrus Bowl 2001 4 Florida, Outback Bowl 2003 4 Southern California, Rose Bowl 2004 4 Nebraska, Alamo Bowl 2005 4 Southern California, Rose Bowl 2007
FEWEST TOUCHDOWNSMichigan 0 Southern California, Rose Bowl 1970 1 Many games Both Teams 1 Southern California, Rose Bowl 1970 1 Auburn, Sugar Bowl 1984 Opponents 0 Stanford, Rose Bowl 1902 0 Southern California, Rose Bowl 1948 0 Washington, Rose Bowl 1981 0 Auburn, Sugar Bowl 1984 0 Mississippi, Gator Bowl 1991
MOST POINTS BY QUARTER
FIRST QUARTER Michigan 14 Mississippi State, Gator Bowl 2011 10 UCLA, Bluebonnet Bowl 1981 10 Washington, Rose Bowl 1993 10 Colorado State, Holiday Bowl 1994 Both Teams 24 Mississippi State, Gator Bowl 2011 17 Washington, Rose Bowl 1993 17 Colorado State, Holiday Bowl 1994 17 Texas A&M, Alamo Bowl 1995Opponents 10 Texas A&M, Alamo Bowl 1995 10 Tennessee, Citrus Bowl 2002 10 Mississippi State, Gator Bowl 2011 7 Washington State, Rose Bowl 1998 7 Washington, Rose Bowl 1978 7 Southern California, Rose Bowl 1979 7 UCLA, Rose Bowl 1983 7 Washington, Rose Bowl 1993 7 Colorado State, Holiday Bowl 1994 7 Texas, Rose Bowl 2005 7 Nebraska, Alamo Bowl 2005 7 Florida, Capital One Bowl 2008
SECOND QUARTER Michigan 21 N. C. State, Hall of Fame Bowl 1994 21 Arkansas, Citrus Bowl 1999 14 Southern California, Rose Bowl 1948 14 Alabama, Hall of Fame Bowl 1988 14 Auburn, Citrus Bowl 2001 14 Florida, Outback Bowl 2003 14 Texas, Rose Bowl 2005 14 Florida, Capital One Bowl 2008 Both Teams 31 Arkansas, Citrus Bowl 1999 30 Florida, Outback Bowl 2003 28 Auburn, Citrus Bowl 2001 24 Tennessee, Citrus Bowl 2002 21 Washington, Rose Bowl 1993 21 N.C. State, Hall of Fame Bowl 1994 21 Alabama, Orange Bowl 2000 21 Texas, Rose Bowl 2005 21 Florida, Capital One Bowl 2008 21 Mississippi State, Gator Bowl 2011Opponents 21 Mississippi State, Gator Bowl 2011 16 Florida, Outback Bowl 2003 14 Nebraska, Fiesta Bowl 1986 14 Southern California, Rose Bowl 1989 14 Washington, Rose Bowl 1993 14 Alabama, Orange Bowl 2000 14 Auburn, Citrus Bowl 2001 14 Tennessee, Citrus Bowl 2002
THIRD QUARTER Michigan 24 Nebraska, Fiesta Bowl 1986 21 Mississippi, Gator Bowl 1991 21 N.C. State, Hall of Fame Bowl 1994 21 Alabama, Orange Bowl 2000 Both Teams 35 Alabama, Orange Bowl 2000 28 N.C. State, Hall of Fame Bowl 1994 24 Nebraska, Fiesta Bowl 1986 24 Washington, Rose Bowl 1993 24 Texas, Rose Bowl 2005 Opponents 16 Southern California, Rose Bowl 2007 14 Arkansas, Citrus Bowl 1999 14 Alabama, Orange Bowl 2000 14 Southern California, Rose Bowl 2004 14 Florida, Capital One Bowl 2008 14 Mississippi State, Gator Bowl 2011
FOURTH QUARTER Michigan 21 Southern California, Rose Bowl 1948 21 Arkansas, Citrus Bowl 1999 20 UCLA, Bluebonnet Bowl 1981 Both Teams 28 Arkansas, Citrus Bowl 1999 28 Southern California, Rose Bowl 2007 27 UCLA, Bluebonnet Bowl 1981 23 Texas, Rose Bowl 2005 22 Alabama, Outback Bowl 1997 22 Nebraska, Alamo Bowl 2005 Opponents 17 Texas, Rose Bowl 2005 15 Alabama, Hall of Fame Bowl 1988 15 Nebraska, Alamo Bowl 2005 14 Alabama, Outback Bowl 1997 14 Tennessee, Citrus Bowl 2002
41BOWL GAME HISTORY
MOST POINTS BY HALF
FIRST HALF Michigan 21 Southern California, Rose Bowl 1948 21 N.C. State, Hall of Fame Bowl 1994 21 Auburn, Citrus Bowl 2001 21 Florida, Outback Bowl 2003 21 Florida, Capital One Bowl 2008Both Teams 45 Gator Bowl, Gator Bowl 2011 38 Washington, Rose Bowl 1993 37 Florida, Outback Bowl 2003 35 Auburn, Citrus Bowl 2001 35 Florida, Capital One Bowl 2008Opponents 31 Mississippi State, Gator Bowl 2011 24 Tennessee, Citrus Bowl 2002 21 Washington, Rose Bowl 1993 17 Washington, Rose Bowl 1978 17 Southern California, Rose Bowl 1979
SECOND HALF Michigan 32 Stanford, Rose Bowl 1902 28 Southern California, Rose Bowl 1948 24 Nebraska, Fiesta Bowl 1986 23 Texas, Rose Bowl 2005 Both Teams 47 Texas, Rose Bowl 2005 44 Southern California, Rose Bowl 2007 41 Florida, Capital One Bowl 2008 37 UCLA, Bluebonnet Bowl 1981 35 Alabama, Hall of Fame Bowl 1988 Opponents 29 Southern California, Rose Bowl 2007 24 Texas, Rose Bowl 2005 21 Alabama, Hall of Fame Bowl 1988 21 Washington, Rose Bowl 1992 21 Tennessee, Citrus Bowl 2002 21 Florida, Capital One Bowl 2008 21 Mississippi State, Gator Bowl 2011
CONVERSIONS
MOST CONVERSIONSMichigan 7 Southern California, Rose Bowl 1948 6 N.C. State, Hall of Fame Bowl 1994 5 Alabama, Orange Bowl 2001 5 Florida, Outback Bowl 2003 5 Florida, Capital One Bowl 2008Both Teams 10 Florida, Capital One Bowl 2008 9 Washington, Rose Bowl 1993 9 Alabama, Orange Bowl 2000 9 Texas, Rose Bowl 2005 9 Mississippi State, Gator Bowl 2011 Opponents 7 Mississippi State, Gator Bowl 2011 6 Tennessee, Citrus Bowl 2002 5 Texas, Rose Bowl 2005 5 Florida, Capital One Bowl 2008 4 Washington, Rose Bowl 1993 4 Alabama, Orange Bowl 2000 4 Auburn, Citrus Bowl 2001
FEWEST CONVERSIONSMichigan 0 Many games LAST: North Carolina, Gator Bowl 1979 Both Teams 1 Southern California, Rose Bowl 1970 1 Auburn, Sugar Bowl 1984 Opponents 0 Many games LAST: Alabama, Outback Bowl 1997
MOST TWO-POINT CONVERSIONSMichigan 1 Arizona State, Rose Bowl 1987 1 Alabama, Outback Bowl 1997 1 Southern California, Rose Bowl 2007 Both Teams 1 Arizona State, Rose Bowl 1987 1 Alabama, Hall of Fame Bowl 1988 1 Alabama, Outback Bowl 1997 1 Nebraska, Alamo Bowl 2005 1 Southern California, Rose Bowl 2007 Opponents 1 Alabama, Hall of Fame Bowl 1988 1 Washington, Rose Bowl 1992 1 Nebraska, Alamo Bowl 2005
MOST TWO-PT CONVERSIONS ATT.Michigan 2 Oregon State, Rose Bowl 1965 2 Southern California, Rose Bowl 1989 Both Teams 2 Oregon State, Rose Bowl 1965 2 Arizona State, Rose Bowl 1987 2 Southern California, Rose Bowl 1989 Opponents 1 Arizona State, Rose Bowl 1987 1 Alabama, Hall of Fame Bowl 1988 1 Washington, Rose Bowl 1992 1 Nebraska, Alamo Bowl 2005
SAFETIES
MOST SAFETIESMichigan 1 Stanford, Rose Bowl 1972 Both Teams 1 Stanford, Rose Bowl 1972 1 Nebraska, Fiesta Bowl 1986 Opponents 1 Nebraska, Fiesta Bowl 1986
FIELD GOALS
MOST FIELD GOALSMichigan 3 Texas, Rose Bowl 2005 2 Nebraska, Fiesta Bowl 1986 2 Texas A&M, Alamo Bowl 1995 2 Alabama, Outback Bowl 1997 2 Florida, Capital One Bowl 2008 Both Teams 7 Texas A&M, Alamo Bowl 1995 4 Texas, Rose Bowl 2005 3 Alabama, Outback Bowl 1997 3 Washington, Rose Bowl 1981 3 Auburn, Sugar Bowl 1984 3 Arizona State, Rose Bowl 1987 3 Southern California, Rose Bowl 2007 Opponents 5 Texas A&M, Alamo Bowl 1995 3 Auburn, Sugar Bowl 1984 3 Arizona State, Rose Bowl 1987
MOST FIELD GOALS ATT. (Since 1964)Michigan 3 Southern California, Rose Bowl 1989 3 Alabama, Outback Bowl 1997 3 Texas, Rose Bowl 2005 Both Teams 8 Texas A&M, Alamo Bowl 1995 6 Stanford, Rose Bowl 1972Opponents 6 Texas A&M, Alamo Bowl 1995 4 Stanford, Rose Bowl 1972 4 North Carolina, Gator Bowl 1979 4 Auburn, Sugar Bowl 1984 4 Arizona State, Rose Bowl 1987
2011 Seniors
TONY ANDERSON17 - CB
Redondo Beach, Calif.
JORDAN BARPAL35 - WR
West Bloomfi eld, Mich.
MATT CAVANAUGH28 - S
Alto, Mich.
MARELL EVANS51 - LB
Richmond, Va.
J.B. FITZGERALD42 - LB
Princeton Junc-tion, N.J.
KELVIN GRADY19 - WR
Grand Rapids, Mich.
WILL HEININGER39 - DL
Ann Arbor, Mich.
JUNIOR HEMINGWAY21 - WR
Conway, S.C.
BRANDON HERRON58 - LB
Stafford, Texas
MARK HUYGE72 - OL
Wyoming, Mich.
ZAC JOHNSON36 - S
Morenci, Mich.
KEVIN KOGERCo-Captain
86 - TEToledo, Ohio
MIKE MARTINCo-Captain
68 - DTRedford, Mich.
JOHN MCCOLGAN49 - FB
Saginaw, Mich.
DAVID MOLKCo-Captain
50 - CLemont, Ill.
MARTAVIOUS ODOMS9 - WR
Pahokee, Fla.
TOM POMARICO91 - LS
Jackson, Mich.
ALEX SCHWAB60 - DT
Manassas, Va.
MICHAEL SHAW20 - RB
Trotwood, Ohio
RYAN VAN BERGEN53 - DL
Whitehall, Mich.
JARED VAN SLYKE31 - S
St. Louis, Mo.
STEVE WATSON84 - TE
Cherry Hills Village, Colo.
TROY WOOLFOLK29 - DB
Sugar Land, Texas
Michigan Bowl Tradition
66th Annual Gator Bowl Classic | January 1, 2011On Bill Gay Grounds At EverBank Field
Welcome to Florida’s First Coast
Mississippi State VS. Michigan
The University of Michigan is proud to be making its 41st bowl game appearance