May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE...
Transcript of May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE...
![Page 1: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/1.jpg)
Published Quarterly By The Space Coast Region, Porsche Club Of America
May 2010 | Volume 4, Issue 2
Amelia Island ConcoursA Track Day With Derek Bell48 Hours of Sebring
Back to Backat the Rolex 24
May 2011
Volu
me
5, Is
sue
2
INSIDETarga 66 | Amelia Island Concours | Sunrise to Sunset Rally
![Page 2: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/2.jpg)
Porsche Certified Pre-Owned
2009 911, 5,284 miles, Vin#PS721988 2009 911 Cabriolet, 11,041 miles, Vin#PS7410032007 911 Cabriolet, 8,587 miles, Vin#PS765811
2007 911, 35,288 miles, Vin#PS710944 2005 911, 21,832 miles, Vin#PS717605 2009 Boxster, 15,558 miles, Vin#PU710642
2007 Boxster, 39,232 miles, Vin#PU712599 2005 Boxster S, 52,741 miles, Vin#S7305502010 Cayman S, 2,451 miles, Vin#U780167A
©2010 Porsche Cars North America, Inc. Porsche recommends seat belt usage and observance of all traffic laws at all times.
One test drive will make the choice abundantly clear. As will this: there may never be a better chance to put the key to a Porsche in your hands. With its instantaneous power and race-bred performance, every time you get behind the wheel will be nothing less than an event. Visit us today to learn why there has never been a smarter time to own a Porsche. Porsche. There is no substitute.
Own the legend. Today.
Porsche of Melbournewww.porscheofmelbourne.com509 East Nasa Blvd.Toll Free: 800-606-1607(Please contact Horst Seibert for more information. We ship nationwide.)
After a lifetime of waiting, patience ceases to be a virtue.
![Page 3: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/3.jpg)
President’sColumn
TheBestIsYetToCome
SpaceCoastRegionhasjustfinishedafun-packedfirstquarterwith 19 events hosted by SPC and 36 days of Porsche-relatedactivitiesavailable toourmembers.Wealsoachievedarecordlevel of membership with a total of 732 regular and affiliatedmembers;thankstothoseofyouthatrenewedyourmembership,andabigwelcometothe50newmembersthatjoinedSPCsinceJanuary.Westillhaveplentyofmajoreventsupcoming.
Normally,ourmanicpaceofeventsbeginstowaneassummerapproaches;however,thisyearthe56thAnnualPorscheParadewillbeheldinSavannah,GeorgiafromJuly31st-August6th.ParadewaslastintheEasternTimezonein2008,andwillnotbeheldthisclosetoourhometurfformanyyearstocome.Severalof our members are taking advantage of this opportunity, andhave signed up to compete in autocross, concours, TSD andfun rallies, trivia contest, and the art exhibition. The parties,drives, and special activities provide something of interest foreach member of the family. We have secured a room block attheMansiononForsythParkinhistoricSavannah.Spaceisstillavailable;seethearticlesinthiseditionofEscape Velocityfordetailsonthecheck-inproceduresatParade.
Another rare event has been added to the national calendar;RennesportReunionIVwillbeheldinMonterey,CaliforniaonOctober16th-19th.Rennesport is the largestgathering in theworldofhistoricPorscheracecarsandothersignificantmodels.ForthosefortunateenoughtohaveattendedRennesportReunionIIIatDaytonainNovember2007,Ibelieveyou’llagreewithmyassessment that it was the greatest Porsche event ever held intheUS–totalimmersion.ThiseventISworththetrip.Weareresearching arrangements to transport our private vehicles to/fromMonterey.Ifyoumaybeinterestedinthisopportunity,letmeknow.
DrivewithPassion,
David O’Neal
On the cover: A quiet moment atthe Sebring ALMS PorscheplatzPhoto by John “Blake” Blakely | BlakeBlakelyPhotography.
�volume 5, Issue 2
page 5
page 6-7
page 9
page 10-11
page 12-13
page 14
page 19
page 20-21
page 22
page 23
page 24-25
page 26
page 27
page 28-29
page 30
page 31
Targa 66
Sunrise to Sunset Rally
Autogeek Detail Fest
Season’s First Autocross
Long and Short
Porsche World Road Show
POM Tech Session
Parade Autocross Preview
Classifieds
Accolades
Parade Check-In
Goodie Shop
Shiny Side Up DE
Amelia Island Concours
Coming Attractions
Member Spotlight
In This Issue
If your Boxster or 996 was born between 1997 and 2005, your car has a potentially terminal engine flaw in the rear intermediate shaft bearing. Fortunately, there is a solution. LN Engineering has developed a retrofit that cures the issue.
Series 9 is an authorized installer for this M96 engine saver. Call us today and make an appointment.
Now Open on the DeLand Airport!✔Engine Conversions and Updates✔Track Modifications/Race Prep✔Custom Cages to your Specs✔Full Ground-up Restorations✔General Repairs and Service✔Local Service for West Volusia
Visit www.914RS.com for more information.1405 Flightline Blvd, #21, DeLand, FL 32724
Attention Boxster and 996 owners!
IMS Retrofits start at $1999* *(Price quoted for a manual transmission Boxster and includes the bearing)
(386)256-9146 Visit www.914RS.com for more information 1405 Flightline Blvd., #21, DeLand, FL 32724
![Page 4: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/4.jpg)
� volume 5, Issue 2
PresidentDavidO’Neal
Vice PresidentSteveHoffman
SecretaryJohn“Blake”Blakely
TreasurerKirkStowers
MembershipBrianReinert
Past PresidentRalphFritsche
North Region CoordinatorMikeMasters
South Region CoordinatorDavidKelly
Skill Event Coordinators
321.751.9032TomKirk
Social EventCoordinators
321.427.5619RonMenck
Our Officials
Tech CoordinatorsRalphFritsche
Touring CoordinatorsBrianReinert
321.403.2500
Classic CoordinatorsRalphFritsche
Event InsuranceCoordinatorCollinDavey
2011 Parade CoordinatorRonMcCall
2012 Zonefest ChairCollinDavey
WebmasterJonathanParker
Webmaster Tech / AssistantVivienneDavey
Charity CoordinatorSueTompkins
EV EditorGinnyO’Neal
EV AdvertisingJackRoberts
Sponsorship ChairTomGorsuch
![Page 5: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/5.jpg)
FiveSPCmembersmadethedrivetoTargaSixty-Six at Palm Beach InternationalRaceway on February 26th.The trip therewent quickly, using I-95 only part of theway and two long, scenic stretches on theback roads into PBIR.After entering thetrack,weparked in thePorscheCorralandimmediately signed up for “Touring Laps”before making the rounds of the paddockandtakinglotsofphotos.
TherewasabigturnoutofseveralteamsandownersofveryexpensiveFerrarisforthetrackactivityand,ofcourse,manyBritishandotherEuropeanracecarsaswell.WireWheel.comhad a full contingent of their cars presenttoo.ThirtytofortyPorscheswereondisplayinthePorscheCorral,manyofthemcomingfromtheGoldCoastRegion.
Brian and James Redman were just abouteverywhere getting things in order, andeasily accessible for anyone who wanted tochatwith them.WemetupwithChrisandGaby Brehme (our friends from Stuttgart)andtouredthevariouspitareastoseesomeofthemoreunusualentriesfortheday.
At 12:30 pm, the respective car clubs(British,Porsche,andafewothers)linedupforparadelapsfollowedbythemorerigoroustouring laps. Chris Brehme rode with meand we had an opportunity to get into theturbos pretty well down the back stretch,which ended abruptly when a coolant pipe
blewatthefarturnanddumpedcoolantalloverthetrack.Thatwastheendofourtrackactivities, and the beginning of a differentadventureforme.
Ireceivedgreatsupportfromeveryonethere,especially theonsitePCAmembers.Also, Ihave to personally thank Shay Rowe andthe folks at Porsche of Melbourne for theirextraordinaryhelpinthissituation.Althoughmyphoto-takingwassuspendedfortherestofthedaywhileIattendedtoothermatters,
Ididmanage tocaptureacoupleofphotosthat conveys the exceptional vehicles at theevent.
Targa Sixty-Six – A Great Day of Living in the PastExcept for my Turbo’s Coolant System ArticleandPhotosbyDavidKelly
914 finishing a successful track session
Track-ready Porsche between race sessions
PCA members from manyregions gathered for the event
Historic Porsche 911R
Heavily modified Ferrari 512
One of many rare Ferraris on track
5volume 5, Issue 2
Open Season Dealing with our Semiannual Bane
ByBrianReinert
The Lovebug. In my humble opinion, there is no “love” in their name. Actually, after a recent round trip from the Space Coast toSebring,Ihaveamuchbettername.ButIthinkitbestIreservethattomyselfandjustusetheirproperscientificname:Plecianearctica.Regardlessofhowwerefertothem–ourPorschesareatwarwiththem.Theacidicacidfromtheircarcasseswillbegintoetchthroughourpaintjobsinlessthan24hours.
Wecanwinthiswarandhereareafewtips:First,startwithagooddefense:wax.BesuretobuildupagoodcoatingeachMayandSeptember.Thiswillhelpscrubthemawayeasier.Andyes,evenwaxoveryourclearbra(justdonotuseanypolishonclearbras).Next,afteraliberalapplicationoftheplecianearcticas,takeseveralBounce™fabricsoftenerdryersheets,dampenasheetandspraywateronthefrontofyourPorsche.
Usethewetsheettowipevery(very)thoroughly;pleasedonotscrubhard–justwipeoverandover.Thesheetwillbegintodevelopamilkyhaze;continuetowipeandremove“thelove”.Thechemicalsfromthesheetswillworktheirmagic.Followbyrinsingwell,washingofftheBounce™residue,andthenapplysomequickdetail.Happydriving!
![Page 6: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/6.jpg)
Sunrise to Sunset Rally
� volume 5, Issue 2
FloridaCitrus,SpaceCoast,andSuncoastregionsheldtheirannualSunrisetoSunsetRallyonApril15thand16th.PCAmembersfromthe Everglades and Florida Crown regions also joined. The rallystartedatthehomeofoureventsponsor,PorscheofMelbourneforanopeningpartyonFridayevening.Registrationandtechlogisticswerehandledduringthisevent.Thisyear’st-shirtssportedrespectiveregion logos on the sleeves of the participants from the threeorganizing regions. Several members had minor tail light issuesresolvedbytheeverreadyPorscheofMelbournetechnicians.Manyof the rally participants brought pairs of shoes for the Porsche ofMelbourneorganizedSoles for Soulscharityinitiative.ThehighlightoftheeveningwasrallyistGinnyO’NealtakingdeliveryofastunningBoxsterSBlackEdition.
At 6:30 am Saturday morning, we met for breakfast on the beach.During our meal and cloudy (but still beautiful) sunrise, Porscheracing legendDerekBellentertaineduswitha few interestingandhumorousstories.ShayRowehostedadrawingawardingseveralverynicePorschelogoitems.Afterbreakfast, itwastimetolineupandbegintherally!Therallymastersgaveafewlastminuteinstructionssuchas“besure torecordyourmileage”,andDerekBellwaved55PCArallyistsoffatoneandahalfminuteintervals.
The rally was challenging, partially due to the length of the coast-to-coast drive. The rally masters Brian Reinert and David O’Nealwere concerned with the timing of the drive and the complexityofthenumberoflandmarksandriddles.Thetimingwassolvedbyroutingtherallythroughthreeareas,whichconcentratedonintenseriddles and gimmicks. Indialantic, the Fort Pierce waterfront, anddowntownSebringprovidedamultitudeofclues.Attwopointsalongtheroute,driverswereforcedtobacktrackalongthesameroadtheyhad justdriven.Later, theywerere-routed to travel in theoriginaldirectionalongthesameroad.Therallyconsistedofseveraltouringareasoftwentymilesormore.Someoftheseareasheldmanyclues,andothers,onlyoneclue.TherallydrewtoacloseatthelunchstopinHammockStatePark,westofSebring,duetotheintensityoftherallyareasandthedistancecovered.Here,driversenjoyedadeliciousboxedlunchandamuchneededpitstop.
After lunch, drivers had their choice of two scenic routes whichtook them from Hammock State Park to Lido Key Beach. JillPerryarrangedanamazingdinnerattheRitzCarlton,locatedonamagnificentverandaoverlooking theGulfofMexico.Afterdinner,the rally masters provided a slideshow that identified all of thecorrectanswers.Thecomplexityanddeviousnessofthecluescouldbemeasuredbythecheersandboosfromtherallyparticipants.
The first award was presented to R.J. and Missy Teasley from theSuncoast Region. The Teasleys were awarded the “Lost LeadersAward”,mainlyduetothecomicalanswerstheyprovided.“Weareonthewrongroad.Cutussomeslack,we’renew!”and“Notyellingateachotheryet!!!”Theysaid“Driverwasgoingtoofasttoread,maystartyellingsoon!”Theyevenofferedtopay$500 for theanswers!Toofunnyasmostrallyscoresheetsareserious.Icouldjustimaginethefuntheyhadwhiledrivingtheroute.
Thetopfivefinisherswererecognizedwithcommemorativeawards.FirstPlacewasdeliveredtoHarryandDeeAnnAllenofSpaceCoastRegionwhohad improvedupontheir2010secondplacefinish. Inadditiontotheirtrophy,PorscheofMelbournedonatedaveryniceCarrerachronographwatch.Eventco-chairsTomGorsuchofSpaceCoast Region and Jill Perry of Suncoast Region, as well as BrianReinertreceivedcommemorativethankyouawards.
Scoringfortherallywasclose.Thefirstandsecondplaceteamshadonlymissedsixclueseach.Thetiebreaker,mileagetraveled,became
ArticlebyBrianReinertPhotosbyJohn“Blake”Blakely
Derek Bell waves off the first rallyist
Harry and Dee Ann Allen at the start of their rally winning run
Brian Reinert and David O’Neal present Missy and R.J. Teasley with the Lost Leaders Award
![Page 7: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/7.jpg)
�volume 5, Issue 2
321.674.2114 | www.ZipperUroGyn.comNew Location: 1130 S. Harbor City Blvd., Melbourne
Zipper Urogynecology
Make fewer pit stops with a
visit to Zipper Urogynecology.
�is travel season focus onfun and not the restroom.
the deciding factor. Fourth, fifth, andsixthplacewasseparatedbyonepoint,whileseventhandeighthplacewastiedand decided by mileage. Competitionwasveryfierceindeedaswehadseveralprior Sunrise to Sunset Championsparticipating: Mel and Dave Tockman(2010),ChrisandDianeBrooke(2009),Bill and Prudie Davis (2008) and BobandJoyceTone(2001).
SpaceCoastRegionretainedtheperpetualSunchaserTrophywiththemosttopfivefinishers.ThetrophyremainsondisplayinthePorscheofMelbourneshowroom,alongwithanartglassthankyougiftpresentedtoShayRoweforPOM’scontinuing
outstanding support of thisiconic rally. This supportincluded the party, specialguest Derek Bell, event t-shirts, breakfast, lunch,doorprizes,achasevehicle,awardsincludingtheCarrerachronograph,horsd’oeuvres,and bar provisions at theRitz Carlton. Sunrise toSunsetfuninourPorsches—nowhere else but CentralFlorida.
We all join Tom in saying “Thank you Shay and Porsche of Melbourne”
Rally Master Brian Reinert and Co-Chairs Jill Perry and Tom Gorsuch receive commemorative awards Rally Master Brian Reinert and Co-Chairs Jill Perry and Tom Gorsuch receive commemorative awards
![Page 8: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/8.jpg)
![Page 9: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/9.jpg)
Stuart,Floridaisapparentlyquitethehotbedforthingsautomotive.Afewweeksago,wewenttothe901ShopthereandsawsomecoolracepreparedPorsches.WewentthereagainonMarch26thtothe6thAnnualAutogeekDetailFestandCarShow.Autogeekisagreatstory of a small auto detailing product catalog business that wentontothewebafewyearsago,andhassinceexplodedwithsuccess.The Autogeek facility is just off I-95. But everything they have tooffercanbefoundatwww.autogeek.net.
Our small group was led by Steve Hoffman (‘87 911 Turbo), andincludedLesSpain(‘08CaymanS),NeilElton(’97Carrera4S),RickParrott(’03Boxster)withmeastailgunner(’08911TurboCab).WemadequickbusinessoftheshorttripdowntoStuart.
Upon arrival, we were escorted in as part of the car show. Whilethere were several makes and models of Mustangs, Corvettes, andvintagemusclecarsrepresented,IrememberonlyseeingoneotherPorschebesidesourSpaceCoastcontingent.Itwasgreattobeabletocontributesomediversitytotheshow.
Even though thiswas just thesixthDetailFest, itwas twiceasbigastheonelastyear,whichwastwiceasbigastheyearbefore.Therewasavendortentwithdozensofdisplays,demos,andfreesamples.This,ofcourse,wasonlyafractionoftheresourcesthatareavailablethroughtheAutogeekwebsite.
There were classes run by detailing expert Mike Phillips, showinghowtousetheorbitalpolishingmachines.Youcouldeventryusingthemachinesyourselfonacarhoodsetupforthatpurpose.Theymakeitallseemsoeasy,butIamstillafraidtotouchmycarwithapolishingmachine.Thatmightchangeaftersomemoreexperience.Anyvolunteers?
Many items were marked down for the show, plus an additional15%off,andnoshippingfeesinceyoucouldtakeithomewithyou.SoIhadtobuyafewthingswhileIwasthere.Theyhadcomputerterminalssetupforustousetoplaceourorders.OnceIloggedontoautogeek.net, Iwas likeakid inacandystore. I foundeverythingonecoulddreamoftomakeyourcarlookgreat.Thewebsitehasproduct explanations, comparisons with other products, YouTubevideos,anduserevaluations. Theseallcontributed to increasemyconfidence about what to buy. Having fellow SPC members righttheretotalkwithreallyhelpedaswell.
AssoonasIreturnedhome,Ihadtheopportunitytotrysomeofthenewproductsonmywife’scar,withgreatresults. Unfortunately,itrainedthenextday,soI’llgetachancetousetheseproductsagainsoon.
Like many Porsche owners, I enjoy spending the time it takes tokeepourcars lookingnice. Withexperiencesharedbyfellowclubmembers,andtheresourcesontheAutogeeksite, Iexpect tohaveevenbetterresultsfrommyeffortsinthefuture.
Autogeek 6th Annual Detail Fest & Car ShowArticlebyTomKirkPhotosbySteveHoffman
Neil Elton and Steve Hoffman’s Porsches stand out in a crowd
Demos and free samples aplenty
Neil’s C4S gets an on-site ding repair
Detailing geek paradise
�volume 5, Issue 2
![Page 10: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/10.jpg)
First Autocross of the SeasonArticlebyTomKirkPhotosbyTomKirkandKenFrisbie
The 2011 autocross season started with an event sponsored by theFloridaCitrusRegionat theLakeCountySheriff ’s training facilityinTavaresonSaturday,February12th.Autocrosseventslikethisaregreatopportunitiestodriveyourcarinamorespiritedmannerthanyoushouldonthestreet,andtobetterexperiencetheperformanceandengineeringbuiltintoourfantasticautomobiles.
Thiseventalsomarksthebeginningofthefriendlyannualautocrosscompetition between Space Coast and the Florida Citrus Region.Forthefirsttimeever,lastseasonSPCwasfinallyabletotakethetitleawayfromFLC.Ourgoalthisyearistoretainthetrophy!
AthreecarcaravanconsistingofDavidO’Neal’s2008SpeedYellowCaymanS,AndreMartineau’s2011BlackBoxsterS,andmy(newtome)2008Meteor Grey 911 Turbo Cab hit the road. Wearrived to find the course laid-out with cones
onthelargeparkinglotinsteadoftheroadcoursewithwhichIwasfamiliar. I have had trouble navigating my way through what canlooklikeaseaofconesatpreviousautocrossevents,andwonderedifthatwouldhappenhere.
Butwhilewalkingthecourse,wereceivedinstructionaboutthebestlinetotakethroughitsdifferentsections. ItalsohelpedthatIwasinthesecondrungroup.ThatmeantIworkedthecoursewhilethefirstrungroupdrove.Thisallowedmetowatchtheotherdriversanddevelopaplanforwhenitwasmyturn.
BythetimeIdrove,itwaswarmenoughformetodropmyconvertibletop,turnonthesportmode,andspinupmycar’stwinturbosalittle.TheTurboisobviouslymuchfasterandhandlesquitedifferentlythanthe2006CaymanSIusedtoown.Thisautocrosswastheperfectplaceformetograduallypushthecaralittlemorewitheachsuccessivelap.Bytheendofmyfivelapsession,Ihadtakenseveralsecondsoffmyruntime.Butitgotevenbetterafterlunch.
Theofficialtimekeepingendedwiththelunchbreak,butabouttencarsstayedforsomefunruns.Withonlyfivedriversineachgroup,
Nice clean 912 in the staging area
David sharing a few go-fast tips
10 volume 5, Issue 2
![Page 11: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/11.jpg)
First Autocross of the Seasoneach lap came in rapid succession. I decidedto turn off my traction control. With 480horsepower, driving all four wheels in secondgear, top down and the sun shining - it was aspiritualexperience.
Itookanothersecondoffmytimeandwasnowwithinonesecondofthefastestcarsthere.NotthatIamatallcompetitive.Justsaying...Please join us at future autocross events andenjoy your car and the camaraderie of fellowPorsche enthusiasts. I’ll be the one grinningfromeartoear.
997 TT at rest
11volume 5, Issue 2
Car and driver in sync
![Page 12: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/12.jpg)
The longest and shortest races of the 2011 ALMS season haveconcluded, and Patrick Long, Joerg Bergmeister, and the FlyingLizardssquadhavecomeupshort inbothefforts. TheSebring12HourskickedofftheseasonwithitsusualSpringBreakatmosphere,andtiedtherecordsetin2002forthelargestgridwith56carstakingthegreenflag.FollowedbytheLongBeachGrandPrix,atwohoursprintwithintheconcretecanyonstreetcircuit.
BackatSebringwerethefactoryeffortsofAudiandPeugeottoreprisetheduelofthedieselLMP1prototypes.However,HughChaunac’sTeam Oreca Matmut campaigning last year’s Peugeot HDi FAPdiesel,surprisedalltakingthecheckeredflaginP1attheendofthe12hourmark.AnothersurpriseintheLMP1resultswasthesecondplacefinishoftheHighcroftHPDARX-01e,agasolinepoweredcar.
Duetoracingincidents, theAudiandPeugeot factoryeffortswererelegatedtothird,fourth,fifth,andeighthplaces.ItwasthelasttimeSebringspectatorswouldseetheAudiR15+TDIprototypesastheywillcampaigntheirnewR18duringtheLeMans24inJune.
BacktoLongandtheLizardsefforts-atSebring,JoergBergmeisterqualifiedthe#45PorscheGT3RSRinsixthplace.Noworriesfora12hourendurancefestasthereisplentyoftimetomakeuppositions.Steadypace,pitstrategy,andmost importantly,keeping itclean insuchalargefieldaretherequirementsforapodiumspot.TheGTclassisshapingupasexpectedtoserveupthemostintensecompetitionthis year. With refreshes among the Porsches, Corvettes, Ferraris,andBMWs,it’sanybody’sraceonanygivenweekend.
12 and 2 - The Long and Short of It...ArticleandPhotosbyJohn“Blake”Blakely
Level 5 Motorsports Lola Coupe out of T17
Patrick Long in the #45 Flying Lizard Porsche 911 GT3RSR
A Trio of Peugeot and Audi diesels at the start of the Sebring 12 Hours
12 volume 5, Issue 2
![Page 13: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/13.jpg)
TheLizardsweresteadilymakinguppositions,withLongfindinghimselfinP3duringhisfirststint.RacinghardwithJanMagnusseninthe#4CorvetteintoTurn17,PatrickhitabumpintheinfamouscornerthatlaunchedthefrontendofhisPorscheintothedooroftheVette.Thecontactresultedinbothcarsspinning,butabletoresumetheraceafterpittingforminorrepairs. Unfortunately, the #01 ExtremeSpeedFerrari took thebruntof the incident,contactingtheVetteandsubsequentlyahardimpactintothewallendingitsday.
The Lizards fought back and forth, butcontinued mishaps, including a malfunctionwith the cool suit system that flooded theelectronics,sawthe#45endinsixthplace,justastheyhadstartedtherace.
On to the Long Beach Grand Prix, a venuethathadseentheLizardstakethetopspottheprevious two years. Long qualified the #45in fourthplaceand took thefirst stintunderthegreenflag.Thestartoftheracepresentedtremendous action as the BMWs gave uptheirstartingpositionswiththe#4Vetteand#45Lizardbattlingforfirstplace.Atthefiftyminutemark,Longhadmadehisway toP1.Whiletryingtogetaroundthe#01FerrariofScottSharpwhohadjustcomeoutofthepits,and trying to fend off both the #4 Vette and#56 BMW, Long went wide and took pickuponhistires.GoingintoTurn8withtoomuchdebris on his tires, Long contacted the wallendingthedayforthe#45.The#56BMWofHand and Mueller continued on to take thetopspot,theirsecondinsomanyraces.
DisappointingresultsfortheLizardsfirsttworacesofthe2011ALMSseason.Afterabriefhiatus and a two car effort for this year’s LeMans24inJune,theALMSseasonwillresumeatLimeRockPark,CTonJuly8-9.
Flying Lizard streaks down the front straight at the Sebring 12 Hours
Flying Lizards out of the mist during the morning warmup
1�volume 5, Issue 2
![Page 14: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/14.jpg)
In late March, I received an invitation that was too good to passup.PorscheofMelbourneandPCAinvitedmetoparticipateinthePorscheWorldRoadShowevent,whichwastobeheldatthePalmBeach International Raceway during the first week in April. PCAmembersandpotentialcustomerswereamongthoseinvited.Asthename would suggest, this event has been held at locations aroundtheworld.ThePBIReventwasthefirstofsevenannouncedintheinauguralUSARoadShowseries tobeconducted throughJuneofthisyearatvariouslocationsintheUS.
Iwasregisteredforanearlymorningtimeslot,whichmeantIhadtogetupwaytooearlytodrivedowntoPBIR;butitwasworthit!Ihadtheuniqueopportunitytosatisfymyneed-for-speedwhilesamplingavarietyofthePorschebrandallinoneday.AndweallknowthatthereisnobetterwaytoexperiencetheexcitementofPorschesthantodrivethem,especiallyonthetrack.
The event started with a brief classroom overview, covering basicdrivingtechniquesandtheplannedschedulefortheday.Thenourgroupof20-25wasdividedinhalfandwewereofftothetracktolearnfrombehindthewheel.Myhalfofthegroupheadedtotheautocrossarea first. Waiting for us there were the mid-engine Boxsters andCaymans,includingaBoxsterSpyderandaCaymanR.Evenmostof
theinstructorstherehadnotyetdrivenaCaymanR.Theformatwasthateachparticipantselectedacaranddrovealapwithaninstructorridingalong.Whenthatlapwascompleted,youreturnedandgotin
linetodriveadifferentcaronthenextlap.Eachofuscompletedabout8-10autocross laps inall, testingall thedriving skills–cornering,braking and acceleration. Votes for the favorite ride were dividedfairlyevenlybetweentheBoxsterSpyderandtheCaymanR.
Next, my group headed over to the PBIR road course. As most ofyou know, this is an 11-turn, 2.034-mile course featuring fast andchallenging corners and straightaways. The selection of Porscheshere included the following models: Turbo S, GTS, Carrera 4S,CarreraCab,Carrera,andCarreraSCoupes.AllwereinMeteorGreyMetallic;somewithPDKandsomewithsix-speedmanual.Onthetrackcoursethegroupwasdividedinhalfagain,andtheformatwasaleadcarforeachsub-groupdrivenbyaninstructor,followedbysixparticipantseachintheirownPorsche.Afterthecompletionofeachlap,weswitchedcarssothatwehadtheopportunitytodriveevery911modelforatleastonelap.Aswiththeautocross,wecompleted8-10lapsinall.
Whatagreatexperience!IftheRoadShowcomesthiswayagain,Iwouldrecommendsigningupforwhateversessionyoucan,evenifitisat7:30am.ThankyouPCAandPorscheofMelbourne.
Porsche World Road Show – USAArticleandPhotosbyDonGrainger
PBIR entrance
Our road course chariots await, 911s all in matching Meteor Grey Metallic
Driving the latest models on the autocross track
“What a great experience!”
1� volume 5, Issue 2
![Page 15: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/15.jpg)
A crisp spring morning greeted thoseattendingtheMarch5theditionoftheTechSession hosted by Porsche of Melbourne.Hot coffee and fresh Krispy Kreme donutsawaitedthe60+membersgatheredtolearnsomebehind-the-scenesdataontheircars.
For the first 60 minutes, TechniciansMichael Steele, Jessie Lim and Mike Basshad a new Panamera wired up to Porsche’scomputerized diagnostic system; theoutputs were projected onto a large screenfor all to see. Those assembled were ableto watch the intricate displays as problemswere diagnosed and corrected. Only a fewminutesofobservingthisprocessconveyedthat“Technician”isthecorrecttermforourfriends in theshop.Athoroughknowledgeof automotive mechanics tied to extensivecomputer diagnostic skills is necessary todealwithtoday’sPorscheproducts.
BillBethauserfromExplicitCustomsprovideda brief presentation on some of the after-marketitemstypicallyofinteresttoPorscheowners.For thoseconsideringperformancemodifications,MichaelSteeleandIsuggestedtheequipmentandprogressivemodificationsneededtoparticipateinAutocross(AX)andDriver’sEducation(DE)eventsstartingwithhelmets. Porsche Club of America permitstheuseofMA(motorcycle),KA(go-kart)andSA(automotive)helmetswithaSnellratingof2005ornewerforbothAXandDE.Othermodificationsdiscussedincludedbrakepadsand cooling, exhaust systems, suspension,and CPU upgrades. Some track videoswere displayed to the delight of many –especiallyme.
A Beautiful, Informative DayPorsche of Melbourne Tech Session Offered Info for AllArticlebyDavidO’NealPhotosbyDavidKelly
PorscheofMelbourne’sentireservicestaff:ManagerAndyKinner,ServiceAdviserMandyHerring,PartsManagerPatrickWynter,andPartsAdviserMattJerozal,wereonhandfortheevent,offeringspecialsonpartsandPorscheattire.DonnaEdwardsarrangedatastyBBQlunchthatwasservedattheconclusionoftheevent.
The Three Amigos (L to R): POM’s Mike Bass, Jessie Lim, Michael Steele
Wings abound (back to front): Carrera GTS, GT3 RS, GT3
1�volume 5, Issue 2
![Page 16: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/16.jpg)
Wealladmitthatautocrossingcanbeprettyfun…figuringouthowyourcarhandlesatthelimitinrelativelysafesurroundings…thatissomegoodstuff!EventheConcoursbuffsholdasecretdesiretothrasharound the course and see how they would do. For those novicesamongus,anautocrossisaminirace-coursethatiscreatedbysettinguporangepylons.Digitaltimersnotestartandfinishtimes,andanycontactwithapyloncostsyouanextratwosecondswhichisaddedtothetimeforyour“lap,”thusremovinganyadvantagethatmightbe gained by “altering” the course. There are typically three timedruns;whichfollowaprescribedsetofactivitiessuchasacoursewalk,driver’s meeting, and safety inspection of your vehicle. Dependingonregistrationnumbers,additionaltimedlapsmaybeoffered,whichgivesyouthatmuchmoreopportunitytobestyourcompetition.Ofcourse,basicsafetyequipment isrequired,suchashelmets(loanerhelmets will be available), but no major modifications are neededto your Porsche. After all, Porsches are built for performance! Ofcourse, if thebugbites,youmayfindyourselfmodifyingyourcar,progressingboththroughtheupperclassesandyourpocketbook.
Comparedtomostregionevents,Paradeautocrosseventsarehugeaffairs,withsomanyclassesandcarsthatittakesacoupleofdaystocomplete.ThereisaplaceforeverycarthatPorschemakes,orhasmadeforthepast60years!Beingacourseworkergivesareallygreatview of the cars on course, giving you a chance to see how others
do things (yet another advantage), so don’t forget to volunteer tohelp out. As with a region event, we need volunteers to make thishappen!
A Parade autocross can be anything but “routine”, and with thismonth’s installment of interesting Parade tidbits, I will point outa fewkeydifferencesofaParadeevent.Firstofall,atParade, techinspectionisNOTofferedonthemorningoftheautocross.Youmusttechyourcarinadvanceofyourdrivingday.Sochecktheschedule,knowwhenyouwilldriveandwhen the tech inspectionstation isopen.Additionally,whiletrackwalksareofferedeachmorningoftheevent,youcanalsowalkthetrackeachprecedingafternoon.Thisisagreatadvantagetohavingamulti-dayevent.Anotherhelpfulactivitywouldbe toattend the“chalk talk” lecture topick-up the tipsandtricksofthesuccessfulautocrossdriver.HostedbyParadeAutocrosschairHenryHoeh,thissessionpromisestobeveryinformative.TheParadeautocrossisaNovicefriendlyevent,sopleasedon’tchoosetositonthesidelinesandwatchjustbecauseyou’renotanexperiencedconechaser.
The autocross will be held at the Hutchinson Island race course,adjacenttotheParadeheadquarters.ThiscoursewascreatedtorunChamp Car type events around a commercial park, and the trackinfieldwillbeusedforthisyear’sautocross.Thereisevenapossibilitythat some special ride opportunities may crop up around the racecourseitself.StaytunedtotheParadewebsiteorFacebookpageformoreinformation!
ByColeScrogham
2011 Porsche ParadeGroundhogDayattheAutocross
20 volume 5, Issue 2
![Page 17: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/17.jpg)
Therearea lotoffirst timeParadeentrantsthis year, and I am sure that many haveexperienced a local region’s autocross,perhapsonlyasaspectator. Ifyouhavetheopportunity,itwouldbeworthyourwhiletogetalittleexperienceatalocaleventbeforeyouheadtoSavannah.IfyouhavenevertriedaParadeautocrossbefore,thisonemightbejust the ticket to find out more about yourPorsche’s unique handling in a low speed,controlledenvironment.Youdon’thavetobeahero,justgiveitatryandseehowitgoes.You might discover something about yourPorsche,andyourself!
Alwaysgreatfunandfullofexcitement,theautocross is one of the pinnacle events ofParade;thisisyourchancetocompetewithclubmembersfromaroundthecountryandto put a national trophy on your mantel!Registrationsarecominginquickly,soloadup and join all your friends at the biggestPCA party of the year, Parade 2011! Moreinformationisavailableathttp://parade2011.pca.org/ and you can also join our ParadeFacebook page at www.facebook.com/PorscheParade. HereyoucanconnectwithallyourParadefriendsandplanyourweek.Don’tmissout,registertoday!
21volume 5, Issue 2
![Page 18: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/18.jpg)
22 volume 5, Issue 2
1986 928S Coupe; 27,500 originalmiles; Black: All leather fawninterior; Stored in climate controlledgarage; 5-speed; Dual A/C; P.S.; P.B.;A.M./F.M./CD;PowerSunRoof;GoldB.B.S. wheels; All original Show Car;7-Time Vero Beach Polo Club WaterCooledChampion;Atrueshowqualitysurvivor; $29,500; can email photos;[email protected] Jim Applegate,Sebastian,FL772-713-6662
ClassifiedsFOR SALE: 1986 Porsche 928S
![Page 19: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/19.jpg)
Tom Gorsuch has been electedto the position ofNational Treasurer,becoming one ofthe top five officersin the PorscheClub of America.Tom’s unanimouselection was madeat PCA’s Board
meeting in Las Vegas in February. Beforethis advancement, Tom held the positionsof National Membership Chair for PCA,PresidentofSPC,andadrivingforcebehindmostofourregion’srecentachievements.
Michael Steele,Lead Technician atPorscheofMelbournehas accepted theposition of TechnicalSupport Specialistand will work fromPorsche of NorthAmerica’s service
centerinAtlanta.Overthepastfiveyears,thisgentlegianthasallowedunprecedentedaccessforourmembers toPOM’sservice facilities,and has provided informative presentationsat the annual tech sessions. Michael was aregular contributor to EV through his Tech Column.Selfishly,wewillmissMike,butwishhimthebest.Talenthasitsrewards.
Dan Cleary and The Werkshophaveprovided over 25years of service toSPC members andcontinuestocareforthe “more mature”modelsofourbelovedmarquee. Dan is aSPC Past Presidentandaneveravailable
sourceofPorscheknowledgeformanyregionmembers. Rumor has it that he has ownedeveryolderTurbointhecounty,atonetimeoranother.AsSpaceCoastRegionentersits43rdyear,wehappilyacknowledgehisservicetoourclub.Thankyouandcongratulations.
Kirk Stowers, SPC’sTreasurer and aPast President hasbeenstrickenrecentlywith some severemedical complications.Kirk has been anofficer of SPC formany years, is anactive participant
andPastPresidentofthe356FloridaOwnersGroup (FOG), and owns/operates Stowers356whichhasperenniallyhostedoursummerBBQ. For many years Kirk chaired a clubfavoriteevent,PorschesandPolo,aswellasthefirsttwoSunrisetoSunsetRallies.IamsureallofyoujoinusinwishingKirkahealthyreturntohislivelyself.
Accolades
IMAGINE THIS ON YOUR LAPEL!Space Coast Region lapel pins are availableatacostof$10each.Thepinsarecloisonné,1.25” in diameter, have a “pin and “clasp”
back, and are like the pinsthat are scheduled to fly onSpace Shuttle Endeavour’sfinal mission. Interested?Contact Steve Hoffman [email protected].
2�volume 5, Issue 2
![Page 20: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/20.jpg)
2011 Parade Check-inByRonMcCall
Window TintingAudio/Video Sales and InstallationFiberglass Enclosures and Interior
Performance PartsCustom Body and PaintAdjustable Suspension
Security SystemsDetailing
1445 W. New Haven Avenue, Suite 200West Melbourne, Florida 32904
www.ExplicitCustoms.com
2� volume 5, Issue 2
Okay,yougotthroughregistration,yourbagsarepacked,andahotelroomhasbeenreserved;nowyouarereadytogetthispartystarted!ManyveteranParadegoersthinkregistrationisnothingcomparedtotheorganizedchaosatcheck-in.IfyouhavebeentoParadebefore,youknowwhattoexpect.IfthisisyourfirstParade,youwillquicklygetthehangofit.Eitherway,Ihavesomesuggestionstogetyouinandoutasquicklyaspossible.
Firstofall,whenyouarriveinSavannah,godirectlytotheParadecheck-in location. Do not even think about doing anything else.Hotelcheck-inandcarwashcanwait.Theurgencyisthatthesooner
youcheck-in,thebetterchanceyouwillhavetogetthetableyouwantforthosedinnersthathavereservedseating,andthetimesyouwantfor thevariousactivities forwhichyouareregistered. Speakingofthedinners,thosewillbethelongestlinesatcheck-in.Itisimportanttonotethatifyouwishtositwithyourfriends,theyhavetoberightthereinlinewithyouwhenyouselectatable.Therearenosavingseats.
![Page 21: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/21.jpg)
But,backtocheck-in.Assoonasyouandyourgrouparrive,youwillpickupyourpacketatthefirsttable.Itwillhaveeverythingyouneedtocheck-in.Then,scopeouttheroomandlookforthetablesfortheeventsyouregisteredfor.YouwillseetheVolunteerTable,GimmickRally, TSD Rally, Michelin Drive and Compare, Driving Tours,Autocross,andsoon.Youmaywanttolookfortheshortestline,orrankyoureventsinpriorityorderandheadforthattablefirst.Thepointisthatyouwanttogetyourpreferredtimeslotforthateventtoavoid impactinganyotheractivities forwhichyouhave registered.You get the picture; make check-in your first stop with strategy inmind,andabackupplanifthetimesyouwantaretaken.
Onceeverythingischeckedoff,youwillgetafinalreviewandyou’redone.Itistimetocheck-inatthehotel,gotothecarwashtogetyourprideandjoyreadyfortheweek,haveyourfavoritebeverage,andgototheZone12WelcomeParty.Then,it’sofftothePirelliWelcomeParty.Youhaveearnedit.Havefun!
25volume 5, Issue 2
![Page 22: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/22.jpg)
Escape Velocity invites its readers tosubmit articles and photos dealing withtopicsofinteresttotheSpaceCoastRegionmembers.
IfyouhaveapersonalPorscheexperienceyou’d like to share, a technical tip, orjust pictures of your car in fun places,please forward it to Ginny O’Neal forconsideration. Articles accepted will besubjecttoediting.You may email submissions to: [email protected]
Want to Share?
PCA Member Price
15% DiscountOn ALL
Minor Services!
On ALL Major Services!
This offer Expires July 31,2011. This offer not valid onprevious service and cannot becombined with any other offer.See service advisor for details.
Membership has its privileges. Reach an audience of passionate people.
Your next client could be reading this right now.
You are... Advertise in the PCA national
award winning Escape Velocity.
Call Jack Roberts today! 321-727-0046
New Stuff at the Goodie Store
PorscheofMelbournehasfreshenedtheirinventoryofSpaceCoastapparelofpolos,dressshirts,capsandvisors.Youcanevenselectspecial“RegionoftheYear”items.Thesearealimited-productionitemandwhenthey’regone—they’regone.Wehavealottobeproudofandshouldallbewearingourcolors.Out-of-townerscancallPatrickat(321)956-0600toplacetheirorder.
2� volume 5, Issue 2
![Page 23: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/23.jpg)
In case you’ve wondered what comprises aDriver’sEducation(DE)event,you’vecometo the right place. First of all, DEs are notracingschools. Thesessionsarenot timed;therearenotrophies;racingisnotpermitted.A DE provides a venue where, under thesupervision of a driving instructor, driverscanlearnhighspeedcorneringandbrakingtechniques that can only be learned on aclosedtrack.
The first question is “why should I exposemy Porsche to the rigors of a race track?”The answer: because a DE gives you theopportunitytolearnnewdrivingtechniquesandfindthelimitsofbothyouandyourcarin a safe and controlled environment. Theskills learned will make you a better driverandmayhelpavoidapotentialaccident.
Planning for a DE starts many weeks inadvance beginning with registration. Theseeventstypicallysellout,soearlyregistrationis a must. PCA DE events are all listed onwww.register.pca.org. Next, an inspectionmustbeperformedtoassureyourvehicleismechanicallysound.ThatinspectionmustbeperformedbyaPorschedealer,arecognizedrepairfacility,orindependentmechanic.This
inspection is a requirement, not an option.Porsche of Melbourne provides this serviceatnocharge.
A helmet is required during your time onthe track. A helmet can be bought on-line,but before doing so, I suggest that you trysomeone else’s helmet for size. Currently,PCApermitstheuseofallSA(automotive),KA(karting)andMA(motorcycle)helmetswithaSNELstickerof2005ornewer.
Regarding the type of clothing to be wornduring the event, clubs have differentregulations as to shirts and pants, so checktheir web site. Most permit short sleevedshirtsandshortsduringthesummermonths.Closed-toed shoes are required. Specialdrivingshoesarenotnecessaryforbeginners;athletic shoes or boat shoes are acceptable.The shoes should be comfortable, but tightenoughthatquickmovementsofthelegsandfeetdon’tcausetheshoetoshift.
When you arrive at the track, you’ll firstsign a track waiver and be directed to thepit and paddock areas. Most DEs requireyou to check-in for the event, sign anotherwaiver, and receive a wrist band indicating
yourrungroup.Toprepareyourcarfortechinspection,removeallofthelooseitemsinyourcar(includingfloormats),glovebox,andtrunk.Removeyourtirevalvestemcaps.Isuggestthatyoubringa plastic sheet to place on the groundforthoseitemsrequiredtoberemoved.
Then you may drive your car to aninspection area where a team willreview your signed inspection sheet,checkyourhelmet’s rating, assure thatalllooseitemshavebeenremovedfromyour vehicle, check your tire pressure,and then place a sticker on yourwindshield acknowledging that theinspectioniscomplete.
In the driver’s meeting, the Chief DrivingInstructor (CDI) will provide a generaloverviewoftheday’sactivitiesandprotocols.Passingareasofthetrackwillbeaddressed,alongwithpoint-byproceduresandareviewof the flags used at the track. The CDI willemphasize the importance of safety on thetrack, and the unbending issue of no ruleviolations. Finally, you will be paired withyourinstructor.
Yourinstructormaydriveduringaportionofthefirstwarm-upsessionandshowyou“theline”aroundthetrack,includingtheturn-in,apexandtrack-outpoints,thelocationofflagstations,andthepitentrance.Newstudentswill receive classroom training before thefirst“at-speed”session.
Theinstructorwillonlytakeyoutothelimitsof speed and cornering that you, and theinstructor, feel comfortable. Following eachsession,youandyourinstructorwillreviewyourprogressandfocusontheelementsthatyouneedtoconcentrateonduringthenextsession.
After several sessions over a couple ofdays, your instructor may recommendthat you receive a check-out ride with theCDI to be signed off for solo status. Thisrecommendation isbasedonyourprogressand is at the discretion of the instructor. Ifitdoesn’tcomeatonce,bepatient.I’vebeenracingcarsandinstructingforover20years,andthedayIfeelthatIknowitall,I’mgoingtohangupbothmydriverandpilotlicenses.So,keepatit......thingswillfallintoplace.
IcanassureyouthataDEwillmakeyouabetter driver in knowing both the limits ofyourselfandyourcar;Ihopeyouwillgiveita try.Andremember,atall times,KeeptheShinySideUp!
ByJackChandler
How to keep the shiny side up with a DE
The author in his driving suit
2�volume 5, Issue 2
![Page 24: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/24.jpg)
Drive to and Dine at the ConcoursTheannouncementsaid“driveanddine”sotherequirementswereclear.Thedestinationwasthe16thAnnualAmeliaIslandConcoursD’Elegance.Thiswasoursecondsuchcaravantothistoptiercollectorcar showcase. Fourteen members in seven Porsches made the trekthis year which started at 9:00 am in Indian Harbour Beach, andgrew to size as we collected members in Daytona Beach. As driveleader,IconvincedtheeagermembersthatlunchontheRitzCarltongolf course would be grand among the extravagant automobilesand thousands of like minded enthusiasts. The scenic route alongHeckscher Drive and SR A1A on Amelia Island satisfied the drivepartwithhighmarksfromourtouringparticipants.
Parkingneartheeventatnoonwaseasyenoughandsoonwewereinsidethegates.Lunchfromtheeventvendorwaslesselegantthananticipated,buttheatmospherewasbeyonddescription.Inadditiontothefourteendriveparticipants,wemetupwithseveralotherSpaceCoast Region members who had arrived on Friday. The beautifulseashore, the Ritz Carlton facilities, the collector car auction andseminars,andtheplethoraofexoticcarsontheroadmakeforafinegetawayweekend.
Bobby Rahal was the event honoree and as such the historic racecar section included some significant Porsches. While it wouldbe impossible to describe the entire field, the following does giveyou an idea of what we enjoyed. Recitals are edited versions ofthe display marquees for each identified vehicle respectively. FormoreinformationyoucanvisittheAmeliaIslandConcourswebsiteatwww.ameliaconcours.organdRMAuctionsatwww.rmauctions.com.
1979 Porsche 935, the red Dick Barbour Racing, Hawaiian Tropic PorschePorschefirststartedturbochargingtheirtriedandtruesix-cylinderenginein1973andwhatfollowedforthenexteightyearswascompletedominanceofGroupFiveracingbythisengine,mostnotablyasthepowerplantwithinthe935model.Firstintroducedin1976,withasingle turbo, the 935 won races in Europe as well as in the IMSA
series in the US. Arguably the most successful of any 935 to everrace, thecarondisplaycompetedinatotalof62races,competingat the Le Mans 24 hours four times, and 12 Hours of Sebring fivetimes.ThiscarwassecondoverallatLeMansin1979;finishedfirstoverallat theDaytona24Hour in1981withBobbyRahaldriving,andwonatSebringinthe12Houreventin1983reconfiguredto934specifications.
1953 Porsche 356 S CoupeThisReutter-bodiedbent-windowcoupewasbuiltfortheAmericanmarketandwasdeliveredtoMaxHoffman,NewYork,NY,onJune5th, 1953. It was delivered as a USA deluxe with a combinationleather/cloth interior.The1,500cc four-cylinderModel528motordeveloped 74 horsepower and it was the first year production carswerefittedwithasynchromeshtransmission.Thetopspeedwaslistedas114mphwith the0-60performance in12.2 seconds.As shownwithfactoryspecifiedFishSilverGreyexteriorandAzureBluetrimwithLightGreyleatherandBlueBedfordcordinterior.Therewere
ArticlebyTomGorsuchPhotosbyJohn“Blake”Blakely
Amelia Island Concours D’Elegance
28 volume 5, Issue 2
![Page 25: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/25.jpg)
1970 Porsche 911S formerly owned by Steve McQueen, to be sold by RM Auctions in AugustWhocanforgettheepicfilmLeMans—Porsche917s,Ferrari512s,theworld’sgreatestracingdrivers,allinamotionpictureconceivedbyandstarringtheKingofCool,SteveMcQueenashotshotPorschedriver Michael Delaney. In the lengthy opening sequence, thisPorsche911SisfeaturedprominentlyasDelaneydrivesthroughthecountryside,reflectingonracespastandpresentandpreparingforthe
24hourenduranceracingbattle.Afterfilmingit joinedMcQueen’spersonal stable of extraordinary motor cars in California. Highest1970specificationandinexceptionaloriginalcondition.
Amelia Island Concours D’Elegance
So many amazing machines . . .
2�volume 5, Issue 2
![Page 26: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/26.jpg)
A special thank you to our advertiserspages 2, 26, 31, centerfold
page 3
page 4
page 7
page 8
page 9
page 10
page 10
page 11
page 11
page 13
page 15
page 19
page 21
Porsche of Melbourne
Series 9
CPA Wealth Management
Zipper Urogynecology
AAA
Sharpe’s Body Shop
Blake Blakely Photography
GAGE-IT-WELL
Brown & Bigelow (Lois & Jack Roberts)
Wickham Dental Care
Tyson Marine and Aviation Insurance
Fast Lane Travel
Cebotech
Invisible Car Bras
May 14 SpecialKaffeeklatschen,EauGallieYachtClub,9am 14 Kaffeeklatschen,PaneraDaytona,9am 15 DrivetoFloridaCitrusAXinTavares,departsLowesRockledge,7am 15 FloridaCitrusAX,Tavares,8:30am 21 PerformanceProductsPresentation,Titusville,departsSam’sClub Melbourne,8am27-30 Zonefest@InnisbrookResort
Jun 4 Drive&DinetoD’VineWines,departsPorscheofMelbourne,9am 5 DrivetoFloridaCitrusAXinTavares,departsLowesRockledge,7am 5 FloridaCitrusAX,Tavares,8:30am 11 LeMansStartandBreakfast,PorscheofMelbourne,8am
Jul 17 Kaffeeklatschen,PanerainDaytona,IndianHarbourBeach& VeroBeach,9am 31 DrivetoPorscheParade,departsPorscheofMelbourne,timeTBD 31 PorscheParade@Savannah
Aug1-6 PorscheParade@Savannah 14 Kaffeeklatschen,PanerainDaytona,IndianHarbourBeach& VeroBeach,9am 20 SummerBanquet
DatesandtimessubjecttochangePleasecheckourwebsite,spc.pca.org,
to confirm event times, contacts, and details.
com
ing a
ttrac
tions
page 22
page 22
page 24
page 24
page 24
page 25
page 25
page 26
page 26
page 27
page 27
page 29
page 29
page 29
Green Turtle Market
iGuard
Coasters Pub
Eau Gallie Yacht Club
Explicit Customs
Dan’s Werkshop
SOS Dent
Marino’s Mobile Detail
Taylor Custom Remodeling
Nancy Taylor/Prudential Sterling Properties
AAA Yacht Sales
Tamburr Motorcars
Glover Oil Co.
Horst Seibert/Porsche of Melbourne
�0 volume 5, Issue 2
![Page 27: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/27.jpg)
EV :What should we know about the Georgeff family?A. Jim’s sister introduced us in MiamiBeach in 1959. I was working my firstjob as an Operating Room Nurse and Jimworked for Ranza Airlines during the daywhile attendingAeronauticalSchool in theevening.Whilewedidn’thavemuchmoney,wemanagedtohavelotsoffungoingtothebeachanddancingattheSouthBeachhotels.Speaking of fun, you may want to ask JimabouthismanyweekendsinHavana,Cuba(priortomeetingme)!Marriedsince1961,wehavetwochildren,ChristineandStephenJames.StephenandhiswifeMaryhavetwochildren,AlexandraandNoah.Webuiltourcurrent home in Malabar on property thatwehaveownedfor40years.Weloveit“uphere”.EV :What was your first Porsche?A.Webought“Boomsie”(1968911T)fromaphysicianinMiamiin1971.Idroveittoworkfor14years.Sheisatwo-time“People’sChoice” winner at SPC’s OktoberfestConcours.
EV :Which car is your favorite?A.AlthoughIlove“Sealy”,a2006CaymanS that we bought last year, “Boom” is ourfavorite Porsche. But, she sometimes getstiredthesedays.
EV :Besides Porsches, what activities do the Georgeffs enjoy?A. We have both enjoyedboating and fishing for40 years. Jim was an avidfishermanuntilthelastfewyears. Our retirementhasbeen very fulfilling. Wehaveespeciallyenjoyedourparticipation in the SpaceCoast Porsche Club andthe many new friends wehavemade.
EV :Do you have any Porsche stories to share?A. Yes, and it is a veryrecentone.Wehaveneverparticipated in a rally so
wedecidedtogiveSunrisetoSunsetashot.Well, since Jim is not much of a navigator,I decided to have him drive. I found outthat I’mnot thathotmyselfwhen it comesto navigating. I must say, it was a ratherstressfulandtryingexperience.Atleastwecertainly got to see a lot of our fair state!Regardless, we enjoyed ourselves and lookforwardtothenextone.
Q & A with Jim and Karen GeorgeffEscapeVelocity asks our members
�1volume 5, Issue 2
Karen and Jim Georgeff
![Page 28: May 2010 | Volume 4, Issue 2 Back to Back · at the Rolex 24 May 2011 Volume 5, Issue 2 INSIDE Targa 66 | Amelia Island Concours | Sunrise to Sunset Rally. Porsche Certified Pre-Owned](https://reader034.fdocuments.us/reader034/viewer/2022043020/5f3bf3b31bccaf14b5039df2/html5/thumbnails/28.jpg)
21 Riverside Drive #�01 | Cocoa, Fl �2�22
PRsRT sTDu.s. PosTAGe
PAIDAll seRvICe
GRAPHICs
Commemorative WatCh
2009 Region of the YearThe Ferry Porsche Trophy
Engraving on back: 2009 Region of the Year
Available at Porscheof Melbourne Parts
Department