Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas,...

28

Transcript of Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas,...

Page 1: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 2: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 3: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 4: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 5: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 6: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 7: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 8: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 9: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 10: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 11: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 12: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 13: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 14: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 15: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 16: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 17: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 18: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 19: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 20: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 21: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 22: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 23: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 24: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 25: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 26: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 27: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus
Page 28: Eye tracking in MSN Search von Edward Cutrell und …...simulated tropical forest with gorillas, orangutans and chimpanzees. Also found at the zoo are the Noble Aquatic Center: Aquaticus

Expresion y Purificacion in Vitro de La Thermus Aquaticus Dna Polimerasa

Expresion y Purificacion in Vitro de La Thermus Aquaticus Dna Polimerasa

Orangutans of Indonesia - Cornell Southeast Asia Program · Orangutans of Indonesia Cornell University Southeast Asia Program. Orangutan (Pongo pygmaeus) Orangutans (Malay, ... of

Orangutans of Indonesia - Cornell Southeast Asia Program · Orangutans of Indonesia Cornell University Southeast Asia Program. Orangutan (Pongo pygmaeus) Orangutans (Malay, ... of

Kinecting with Orangutans: Zoo Visitors’ Empathetic ...library.usc.edu.ph/ACM/CHI 2017/1proc/p6075.pdf6075 Kinecting with Orangutans: Zoo Visitors’ Empathetic Responses to Animals’

Kinecting with Orangutans: Zoo Visitors’ Empathetic ...library.usc.edu.ph/ACM/CHI 2017/1proc/p6075.pdf6075 Kinecting with Orangutans: Zoo Visitors’ Empathetic Responses to Animals’

Eastern Mole (Scalopus aquaticus)

Eastern Mole (Scalopus aquaticus)

Thermus AQuaticus DNA polymerase SEQUENCE: MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPED FPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPG.

Thermus AQuaticus DNA polymerase SEQUENCE: MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPED FPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPG.

Liquid Conservation in Orangutans (Pongo pygmaeus) and Humans

Liquid Conservation in Orangutans (Pongo pygmaeus) and Humans

Complete Genome Sequence of Thermus Aquaticus Y51MC23

Complete Genome Sequence of Thermus Aquaticus Y51MC23

Save Orangutans

Save Orangutans

5 L Orangutans

5 L Orangutans

SAVING THE ORANGUTANS. Know Orangutans are dying due to deforestation, diseases, and forest fires caused by palm tree plantation owners. Food Chain Orangutans.

SAVING THE ORANGUTANS. Know Orangutans are dying due to deforestation, diseases, and forest fires caused by palm tree plantation owners. Food Chain Orangutans.

ORANGUTANS AND THE JAVA SEA - small cruise ships

ORANGUTANS AND THE JAVA SEA - small cruise ships

ORANGUTAN CONSERVANCY ORANGUTAN VETERINARY … · orangutans [ habitat has been destroyed over the last 20 years, and estimates show that approximately only 40,000 orangutans are

ORANGUTAN CONSERVANCY ORANGUTAN VETERINARY … · orangutans [ habitat has been destroyed over the last 20 years, and estimates show that approximately only 40,000 orangutans are

Orangutans in the Wild

Orangutans in the Wild

Acoustic surveys of Water Rail Rallus aquaticus over ...

Acoustic surveys of Water Rail Rallus aquaticus over ...

Thermus aquaticus gen. n. and sp. n., a Non- sporulating ... · The isolation of a new thermophilic bacterium, Thermus aquaticus gen. n. and sp. n., is described. Successful enrichment

Thermus aquaticus gen. n. and sp. n., a Non- sporulating ... · The isolation of a new thermophilic bacterium, Thermus aquaticus gen. n. and sp. n., is described. Successful enrichment

About Orangutans

About Orangutans

A mutated thermostable Thermus aquaticus DNA polymerase ...

A mutated thermostable Thermus aquaticus DNA polymerase ...

Thermus Aquaticus Gen. n. and Sp. n a Nonsporulating Extreme Thermophile

Thermus Aquaticus Gen. n. and Sp. n a Nonsporulating Extreme Thermophile

HOW ORANGUTANS CHOOSE WHERE TO SLEEP: COMPARISON …

HOW ORANGUTANS CHOOSE WHERE TO SLEEP: COMPARISON …

ELS ORANGUTANS

ELS ORANGUTANS