bcm/cain_foundation/noframes/html/pages/staff/neurons%20confocal%20mu1a%20dcx.jpg

1
Zebrafish as a Model to Investigate the Disease Mechanisms of Infantile Neuronal Ceroid Lipfuscinosis Nicole Brant and Dr. Wendy Boehmler, Department of Biology, York College of Pennsylvania http://www.bcm.edu/cain_foundation/noframes/html/ pages/staff/neurons%20confocal%20mu1a%20dcx.jpg Introduction •Infantile neuronal ceroid lipfuscinosis (INCL) is a devastating neurodegenerative disorder that destroys neurons in certain tissues of the central nervous system such as the thalamus, cortex, and cerebellum. •INCL is caused by a mutation in the PPT1 gene which encodes palmitoyl protein thioesterase 1. •PPT1 is a lysosomal enzyme that plays a major role in the degradation of lipid-modified proteins. •How PPT1 deficiency leads to selective central nervous system degeneration is unclear. •Neurons have an altered endoplasmic reticulum morphology. •Microarray analyses on INCL brain tissues shows an upregulation of inflammatory genes. •The post-mitotic nature of neurons may contribute to their selective degeneration. •While the gene mutation has been identified, there is still a need to investigate the neurobiology of the disease course throughout early development and to assess potential therapeutic treatments. •Mouse models of INCL have provided significant clues to the biological basis of the disease, however such studies can be slow, laborious, and expensive to perform. •Zebrafish, a small vertebrate, are becoming the organism of choice for modeling diseases and for drug discovery. •The genome is fully sequenced. •Breeding pairs can produce hundreds of embryos. •Embryos develop ex utero, develop rapidly, and are transparent Objectives 1. Determine if there is expression of the PPT1 gene in adult zebrafish tissues. 2. Determine if there is spatial and temporal expression of the PPT1 gene during zebrafish development. Methods Searches of expressed sequence tag databases (http://www.ncbi.nlm.nih.gov/) led to the identification of a potential zebrafish PPT1 homolog (Gene Accession number NM213339). RT-PCR was conducted using RNA collected from adult zebrafish and embryos. Figure 1: RT-PCR analysis of PPT1 from adult zebrafish. The PPT1 gene was amplified from adult zebrafish brain, gut, and muscle RNA. The primers used encompassed the predicted ATG start codon and stop codon to produce an amplicon of 1033 base pairs (bp). Primer sequences: forward 5’AGATTGAATAATGGCTCCACC3’ and reverse 5’TATCTGAGACGGTAGTTACGA3’. Conclusion 1.The data presented here represents the first analysis of temporal and spatial expression of the PPT1 gene in developing zebrafish embryos. 2.PPT1 is also expressed in adult zebrafish in the brain, gut, and muscle. 3.Sequence comparisons and syntenic analysis supports the identification of a novel zebrafish PPT1 homolog. Future Experiments •Perform a morpholino knockdown of PPT1 gene to assess any gross morphological abnormalities in development. Literature Cited • Cooper, Jonathan D., Russel, Claire and Mitchison, Hannah, M. 2006. Progress towards understanding disease mechanisms in small vertebrate models of neuronal ceroid lipofuscinosis. Biochimica et Biophysica Acta 873-889. • Woods, I. G., Wilson, C., Friedlander, B., Chang, P., Reyes, D. K., Nix, R., Kelly, P. D., Chu, F., Postlethwait, J. H., and W. S. Talbot. 2005. The zebrafish gene map defines ancestral vertebrate chromosomes. Genome Research 15:1307-1314. Gene Name Zebrafish Chromosome Human Chromosome PPT1 19 1 dnajc8 19 1 flj10504 19 1 mhcuaa 19 1 trh3 19 1 tpm3b 19 1 ctps 19 1 hdac1 19 1 flj14490 19 1 rbb4 19 1 fuca1 19 1 bmp8 19 1 col9a2 19 1 ilf2 19 1 sfpq 19 1 pum1 19 1 cap1 19 1 rpl11 19 1 Figure 4: Comparison of zebrafish and human PPT1. Human and zebrafish PPT1 amino acid sequences were aligned using CLUSTALW. Dashes in sequences allow optimal alignment for amino acid insertions/deletions. Identical amino acids are highlighted by asterisks and conserved are highlighted by dots. Collected tissues from the brain, eye, gut, heart, and muscle and 24, 48, and 72 hours post fertilization (hpf) embryos PCR Denature for 30 sec. at 94 o C Annealing for 30 sec. at 48 o C Elongation for 1 min. at 72 o C 30 cycles RNA isolation with phenol/chloroform extraction Reverse Transcriptio n cDNA Zebrafish PPT1 gene was successfully cloned into a pDrive and sequenced Results Figure 2: RT-PCR analysis of PPT1 from 24, 48, and 72 hpf embryos. The PPT1 gene was amplified from 24, 48, and 72 hpf embryo RNA. Primers encompassed the entire gene to produce the predicted 1033bp amplicon. Table 1: Markers and Genes Syntenic with PPT1 Genes in Zebrafish and Humans. Ladder Brain Eye Gut Muscle Heart 1033 bp Ladder 24 hour 48 hour 72 hour Ladder 1033 bp Human MASPGCLWLLAVA-LLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVE 59 Zebrafish MAPPAAFRLLSVSGCLLLLCGT----SWASNGTVPLVIWHGMGDSCCNPLSMGAIKKMVE 56 **.*..: **:*: * *.: . ..:************************** Human KKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQ 119 Zebrafish QEVSGIYVLSLMIGKSVFEDTENGFLMDVNKQVSFVCDQLAKDPKLKEGYNAMGFSQGAQ 116 :::.******* ***:::**.**.*:::**.**: **: *******::**********.* Human FLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQER 179 Zebrafish FLRAVAQRCPDPPMRNLISVGGQHQGVYGLPRCPGESSHICDWIRKQLNSGAYTDAVQKH 176 **********.*** ************:**************:*** **:***:..**:: Human LVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPV 239 Zebrafish LVQAQYWHDPLNDDLYKKYSLFLADINQERVVNETYKKNLMSLNKFVMVKFLQDSIVDPV 236 ****:*****:::*:*:::*:********* :**:******:*:********:******* Human DSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYA 299 Zebrafish DSEWFGFYKAGQAEELETLQESPIYKEDRLGLAAMDSAGKLVFLASEGDHLQFTREWFNE 296 ********::***:* .***:.:*.:***** **.**:*****:******::.*** Human HIIPFLG 306 Zebrafish NLLSYLL 303 :::.:* •A whole-mount in situ hybridization was performed on 24, 48, and 72 hpf embryos. Figure 3: Expression of the palmitoyl protein thioesterase 1 gene. Lateral views of 24 (A, D), 48 (B, E), and 72 (C, F) hpf embryos. Note the sense probe (A, B, C) and the antisense probe (D, E, F). B-brain, E-eye, SC-spinal cord Collected 24, 48, and 72 hpf embryos, stored them in MeOH, made the sense and antisense probes and reagents Staining and washing, stored embryos and took pictures Permeabilization of the embryos and hybridization of the RNA probe Washes Incubation with anti-DIG antibody alkaline phosphase Washes A 24 hpf D 24 hpf E 48 hpf B 48 hpf F 72 hpf C 72 hpf http://www.devbio.uga.edu/gallery/images/ embryo4LRG.jpg B E SC B E SC B SC E Acknowledgements I would like to thank Dr. Boehmler for all of her time and guidance.

description

Zebrafish as a Model to Investigate the Disease Mechanisms of Infantile Neuronal Ceroid Lipfuscinosis Nicole Brant and Dr. Wendy Boehmler, Department of Biology, York College of Pennsylvania. http:// www.devbio.uga.edu/gallery/images/embryo4LRG.jpg. - PowerPoint PPT Presentation

Transcript of bcm/cain_foundation/noframes/html/pages/staff/neurons%20confocal%20mu1a%20dcx.jpg

Page 1: bcm/cain_foundation/noframes/html/pages/staff/neurons%20confocal%20mu1a%20dcx.jpg

Zebrafish as a Model to Investigate the Disease Mechanisms of Infantile Neuronal Ceroid Lipfuscinosis

Nicole Brant and Dr. Wendy Boehmler, Department of Biology, York College of Pennsylvania http://www.bcm.edu/cain_foundation/noframes/html/pages/

staff/neurons%20confocal%20mu1a%20dcx.jpg

Introduction• Infantile neuronal ceroid lipfuscinosis (INCL) is a devastating neurodegenerative disorder that destroys neurons in certain tissues of the central nervous system such as the thalamus, cortex, and cerebellum.

• INCL is caused by a mutation in the PPT1 gene which encodes palmitoyl protein thioesterase 1.

• PPT1 is a lysosomal enzyme that plays a major role in the degradation of lipid-modified proteins.

•How PPT1 deficiency leads to selective central nervous system degeneration is unclear.

•Neurons have an altered endoplasmic reticulum morphology.•Microarray analyses on INCL brain tissues shows an upregulation of inflammatory genes.•The post-mitotic nature of neurons may contribute to their selective degeneration.

•While the gene mutation has been identified, there is still a need to investigate the neurobiology of the disease course throughout early development and to assess potential therapeutic treatments.

•Mouse models of INCL have provided significant clues to the biological basis of the disease, however such studies can be slow, laborious, and expensive to perform.

• Zebrafish, a small vertebrate, are becoming the organism of choice for modeling diseases and for drug discovery.

•The genome is fully sequenced.•Breeding pairs can produce hundreds of embryos.•Embryos develop ex utero, develop rapidly, and are transparent

Objectives1. Determine if there is expression of the PPT1 gene in

adult zebrafish tissues.2. Determine if there is spatial and temporal expression

of the PPT1 gene during zebrafish development.

Methods• Searches of expressed sequence tag databases

(http://www.ncbi.nlm.nih.gov/) led to the identification of a potential zebrafish PPT1 homolog (Gene Accession number NM213339).

• RT-PCR was conducted using RNA collected from adult zebrafish and embryos.

Figure 1: RT-PCR analysis of PPT1 from adult zebrafish. The PPT1 gene was amplified from adult zebrafish brain, gut, and muscle RNA. The primers used encompassed the predicted ATG start codon and stop codon to produce an amplicon of 1033 base pairs (bp). Primer sequences: forward 5’AGATTGAATAATGGCTCCACC3’ and reverse 5’TATCTGAGACGGTAGTTACGA3’.

Conclusion1.The data presented here represents the first analysis of temporal and spatial expression of the PPT1 gene in developing zebrafish embryos.

2.PPT1 is also expressed in adult zebrafish in the brain, gut, and muscle.

3.Sequence comparisons and syntenic analysis supports the identification of a novel zebrafish PPT1 homolog.

Future Experiments• Perform a morpholino knockdown of PPT1 gene to assess any gross morphological abnormalities in development.

Literature Cited

• Cooper, Jonathan D., Russel, Claire and Mitchison, Hannah, M. 2006. Progress towards understanding disease mechanisms in small vertebrate models of neuronal ceroid lipofuscinosis. Biochimica et Biophysica Acta 873-889.

• Woods, I. G., Wilson, C., Friedlander, B., Chang, P., Reyes, D. K., Nix, R., Kelly, P. D., Chu, F., Postlethwait, J. H., and W. S. Talbot. 2005. The zebrafish gene map defines ancestral vertebrate chromosomes. Genome Research 15:1307-1314.

Gene Name

Zebrafish Chromosom

e

Human Chromosom

e PPT1 19 1dnajc8 19 1

flj10504 19 1mhcuaa 19 1

trh3 19 1tpm3b 19 1ctps 19 1

hdac1 19 1flj14490 19 1

rbb4 19 1fuca1 19 1bmp8 19 1col9a2 19 1

ilf2 19 1sfpq 19 1

pum1 19 1cap1 19 1rpl11 19 1

Figure 4: Comparison of zebrafish and human PPT1. Human and zebrafish PPT1 amino acid sequences were aligned using CLUSTALW. Dashes in sequences allow optimal alignment for amino acid insertions/deletions. Identical amino acids are highlighted by asterisks and conserved are highlighted by dots.

Collected tissues from the brain, eye, gut,

heart, and muscle and 24, 48, and 72 hours

post fertilization (hpf) embryos

PCRDenature for 30 sec. at

94oCAnnealing for 30 sec. at

48oCElongation for 1 min. at

72oC30 cycles

RNA isolation with phenol/chloroform

extraction

ReverseTranscriptio

n

cDNA

Zebrafish PPT1 gene was

successfully cloned into a pDrive and sequenced

Results

Figure 2: RT-PCR analysis of PPT1 from 24, 48, and 72 hpf embryos. The PPT1 gene was amplified from 24, 48, and 72 hpf embryo RNA. Primers encompassed the entire gene to produce the predicted 1033bp amplicon.

Table 1: Markers and Genes Syntenic with PPT1 Genes in Zebrafish and Humans.

Ladder

Bra

inEye

Gut

Musc

leH

eart

1033 bp

Lad

der

24

hour

48

hour

72

hour

La

dd

er

1033bp

Human MASPGCLWLLAVA-LLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVE 59 Zebrafish MAPPAAFRLLSVSGCLLLLCGT----SWASNGTVPLVIWHGMGDSCCNPLSMGAIKKMVE 56 **.*..: **:*: * *.: . ..:************************** Human KKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQ 119 Zebrafish QEVSGIYVLSLMIGKSVFEDTENGFLMDVNKQVSFVCDQLAKDPKLKEGYNAMGFSQGAQ 116 :::.******* ***:::**.**.*:::**.**: **: *******::**********.* Human FLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQER 179 Zebrafish FLRAVAQRCPDPPMRNLISVGGQHQGVYGLPRCPGESSHICDWIRKQLNSGAYTDAVQKH 176 **********.*** ************:**************:*** **:***:..**:: Human LVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPV 239 Zebrafish LVQAQYWHDPLNDDLYKKYSLFLADINQERVVNETYKKNLMSLNKFVMVKFLQDSIVDPV 236 ****:*****:::*:*:::*:********* :**:******:*:********:******* Human DSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYA 299 Zebrafish DSEWFGFYKAGQAEELETLQESPIYKEDRLGLAAMDSAGKLVFLASEGDHLQFTREWFNE 296 ********::***:* .***:.:*.:***** **.**:*****:******::.*** Human HIIPFLG 306 Zebrafish NLLSYLL 303 :::.:*

• A whole-mount in situ hybridization was performed on 24, 48, and 72 hpf embryos.

Figure 3: Expression of the palmitoyl protein thioesterase 1 gene. Lateral views of 24 (A, D), 48 (B, E), and 72 (C, F) hpf embryos. Note the sense probe (A, B, C) and the antisense probe (D, E, F).B-brain, E-eye, SC-spinal cord

Collected 24, 48, and 72 hpf embryos, stored them in MeOH, made

the sense and antisense probes and

reagents

Staining and washing, stored embryos and took

pictures

Permeabilization of the embryos and

hybridization of the RNA probe

Washes

Incubation with anti-DIG antibody

alkaline phosphase

Washes

A 24 hpf

D 24 hpf

E 48 hpf

B 48 hpf

F 72 hpf

C 72 hpf

http://www.devbio.uga.edu/gallery/images/embryo4LRG.jpg

B

E

SC

B

E

SC

BSC

E

Acknowledgements

I would like to thank Dr. Boehmler for all of her time and guidance.