Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not...
Transcript of Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not...
![Page 1: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/1.jpg)
Analysis of the Structure and Function of Endocannabinoid-Hydrolyzing Enzymes
Using Biophysical and Nanomedical Techniques
by Michael James Johnson
A.A.S in Mathematics & Science, Westchester Community College
B.S. in Biotechnology, SUNY College of Environmental Science and Forestry
C.A.S in Business Administration, Northeastern University
A dissertation submitted to
The Faculty of the Bouvé College of Health Sciences at
Northeastern University
in partial fulfillment of the requirements for the degree of Doctor of Philosophy
December 1, 2014
Dissertation Research directed by
Alexandros Makriyannis
Professor of Pharmaceutical Biotechnology and Director of the Center for Drug Discovery
![Page 2: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/2.jpg)
i
Dedication
This work would not have been possible without the love and support of my family and
friends. Specifically, my loving partner Emily Sechny, my mother Mary Rice, and my father
Richard Johnson. Thank you for encouraging me to follow my dreams.
![Page 3: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/3.jpg)
ii
Acknowledgements
This work was supported by grants from the National Institutes of Health: DA003801 and
DA009158; National Institute on Drug Abuse: GM08607 and GM101135; National Science
Foundation: NSF-DGE-0965843; National Institute of General Medical Sciences, and in
collaboration with the Waters Corporation. With special thanks to all members of the Center for
Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr,
Sergiy Tyukhtenko, Anna Bowman, Cheryl Habrukowich, Mark Williams, Nikolai Zvonok, Jodi
Wood, Jay West, and Michael McCormack. Additionally, thanks to collaborators at the Barnett
Institute: John Engen, Thomas Wales, Xiaomeng Shi, and Brent Kochert, and collaborators at the
Electronic Materials Research Institute: Srinivas Sridhar, Dattatri Nagesha, Rajiv Kumar, and Codi
Gharagouzloo, and to the Facilities Manager at the Electron Microscopy Center at Northeastern
University, William Fowle. Thanks also to Kiran Vemuri and Kumara Subramanian for
synthesizing the compounds analyzed herein.
![Page 4: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/4.jpg)
iii
Abstract of Dissertation
Presented here is a systematic structural, and functional study of endocannabinoid
metabolizing enzymes, including: a potential biomarker for breast cancer and the development of
a novel nanoplatform for studying these membrane proteins. Investigating the impact of
phospholipid bilayers on the structure and function of membrane proteins is an essential precursor
to developing drugs that target these dynamic systems. The membrane-associated serine hydrolase,
monoacylglycerol lipase (MGL), and the membrane-bound serine hydrolase, fatty acid amide
hydrolase (FAAH), are well-recognized therapeutic targets that regulate endocannabinoid
signaling. In particular, overexpression of MGL in certain tumor cells elevates the levels of pro-
tumorigenic signaling lipids, and as such, MGL regulates a fatty acid network that promotes
pathogenesis in some cancers. Reported here is the application of phospholipid bilayer nanodiscs
that mimic the native cell membrane environment to evaluate the effects of membrane systems on
the catalytic properties, and conformational dynamics, of human MGL (hMGL) and rat FAAH
(rFAAH). Specifically, hMGL’s kinetic properties (apparent maximum velocity [VMAX] and
substrate affinity [KM]) were enhanced in the presence of anionic and charge-neutral phospholipid
bilayer nanodiscs. In order to examine further the effects of modulating the activity of hMGL, a
novel nano-medicinal agent (derived from a dynamic class of nano-materials that can be applied
to in vitro, in vivo, and clinical applications) was synthesized, and characterized. Nanoparticles
exist in a physical state between that of bulk material and a single molecule. In this transitional
state, surface properties and quantum-mechanical dynamics can be “tuned” simply by altering
particle size and shape. The ‘fLPA-SPIO@AuNS’ particle design proposed here presents a multi-
lamellar nanoplatform for imaging, drug delivery, and therapeutic applications that, in this case,
target the endocannabinoid system. Another novel imaging motif, proposed here involves probing
![Page 5: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/5.jpg)
iv
the mechanism of hMGL inhibition by 5-(4-hydroxyphenyl)-pentanesulfonyl fluoride (AM3506)
using biochemical and mass spectrometric (MS) approaches. After hMGL was treated with
AM3506, the conversion of sulfonyl serine (Ser122) to dehydroalanine via a β-elimination
mechanism was observed, and confirmed by tandem MS analysis. Targeting the resultant
dehydroalanine hMGL with thiophenol resulted in the conversion of Ser122 to S-phenyl-cysteine
(addition of 92 Da), which demonstrates a selective approach for serine hydrolase modification at
the catalytic serine. This modification confers a new function to in this case- hMGL without
genetic manipulation. The results of this work contribute to the understanding of key regulatory
pathway involved in breast cancer progression (as well as other disease states) and provides
evidence of the feasibility of the development of a novel, pharmacologic intervention toward the
diagnosis and treatment of metastatic disease.
![Page 6: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/6.jpg)
v
Table of Contents
Dedication ........................................................................................................................................ i
Acknowledgements ......................................................................................................................... ii
Abstract of Dissertation ................................................................................................................. iii
Table of Contents ............................................................................................................................ v
List of Figures ................................................................................................................................. x
List of Tables ................................................................................................................................ xii
List of Schemes ............................................................................................................................ xiii
List of Abbreviations ................................................................................................................... xiv
Introduction ..................................................................................................................................... 1
Characterization of the Nanodisc Model Using High-resolution Techniques ................................ 3
Introduction ................................................................................................................................. 4
Results and Discussion ................................................................................................................ 6
Confirming the identity and purity of MSP1D1 ...................................................................... 6
Nanodisc assembly and complex co-purification .................................................................... 6
NMR analysis of ND-MGL association .................................................................................. 7
Densitometry analysis of the stoichiometry for ND-MGL preparation .................................. 8
Dynamic Light Scattering analysis of ND-MGL association kinetics .................................... 8
Imaging ND-MGL using transmission electron microscopy .................................................. 9
Conclusions ............................................................................................................................... 10
Materials and Methods .............................................................................................................. 12
Materials ................................................................................................................................ 12
Methods ................................................................................................................................. 12
Expression and purification of hMGL ............................................................................... 12
Expression and purification of MSP1D1 ........................................................................... 13
LC-TOF analysis of MSP1D1 ........................................................................................... 14
ND-MGL co-purification ................................................................................................... 14
ND self-assembly and isolation ......................................................................................... 15
Proton NMR analysis ......................................................................................................... 15
Densitometry analysis ........................................................................................................ 16
Dynamic Light Scattering .................................................................................................. 16
TEM imaging of nanodiscs ................................................................................................ 16
![Page 7: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/7.jpg)
vi
Schemes ..................................................................................................................................... 18
Figures ....................................................................................................................................... 20
Membrane Phospholipid Bilayer as a Determinant of Monoacylglycerol Lipase Kinetic Profile
and Conformational Repertoire24 .................................................................................................. 26
Introduction ............................................................................................................................... 27
Results and Discussion .............................................................................................................. 31
Phospholipid bilayer nanodisc characterization .................................................................... 31
Phospholipid bilayer nanodiscs enhance hMGL catalytic activity and substrate affinity ..... 31
hMGL interacts with phospholipid bilayer nanodiscs ........................................................... 33
hMGL interaction with nanodiscs modifies enzyme regional conformation ........................ 34
Covalent hMGL inhibitor modulates enzyme conformation in the presence of nanodiscs ... 37
MD simulations predict hMGL interaction topology with nanodiscs ................................... 38
Conclusions ............................................................................................................................... 40
Materials and Methods .............................................................................................................. 42
Materials ................................................................................................................................ 42
Methods ................................................................................................................................. 42
Purification of recombinant wild-type hMGL ................................................................... 42
MSP1D1 purification ......................................................................................................... 43
Nanodisc self-assembly and isolation ................................................................................ 43
FPLC analysis of nanodiscs incubated with hMGL .......................................................... 43
Determination of hMGL kinetic properties ....................................................................... 44
Peptide-based HX MS analysis .......................................................................................... 45
MALDI-TOF/TOF MS analysis of hMGL covalent modification by AM6580 ................ 46
Computational methods ............................................................................................................. 47
Tables ........................................................................................................................................ 49
Figures ....................................................................................................................................... 50
Supplemental Material .............................................................................................................. 54
Supplemental Tables .............................................................................................................. 54
Supplementary Figures .......................................................................................................... 55
Expression and Purification of Full-length rFAAH and Subsequent Incorporation within the
Nanodisc Model ............................................................................................................................ 57
Introduction ............................................................................................................................... 58
Results and Discussion .............................................................................................................. 60
![Page 8: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/8.jpg)
vii
Purification of full length rFAAH ......................................................................................... 60
rFAAH incorporation into the nanodisc biological membrane model .................................. 61
In-solution dynamics of rFAAH ............................................................................................ 62
Conclusions ............................................................................................................................... 63
Materials and Methods .............................................................................................................. 64
Materials ................................................................................................................................ 64
Methods ................................................................................................................................. 64
Expression and Purification of rFAAH.............................................................................. 64
Assay of rFAAH activity using AAMCA .......................................................................... 65
Solubilized membrane protein library (SMPL) method for rFAAH nanodisc incorporation
............................................................................................................................................ 65
Coself-assembly of purified rFAAH .................................................................................. 66
Peptide-level HX MS analysis ........................................................................................... 66
Figures ....................................................................................................................................... 68
Supplementary Data .................................................................................................................. 75
Coverage of peptic peptides for rFAAH and MSP1D1 nanodiscs ........................................ 75
Supplementary Figures .............................................................................................................. 76
Acknowledgements ................................................................................................................... 78
Mechanistic Analysis of Human Monoacylglycerol Lipase Inhibition by the Sulfonyl Fluoride-
based Inhibitor AM3506 ............................................................................................................... 79
Introduction ............................................................................................................................... 80
Results ....................................................................................................................................... 83
Covalent inhibition of hMGL, H121S hMGL, and rFAAH by AM3506.............................. 83
Intact mass analysis of hMGL inhibited by AM3506 ........................................................... 83
MALDI-TOF analysis of hMGL and H121S hMGL inhibited by AM3506 ......................... 84
MALDI-TOF MS analysis of the Michael addition reaction ................................................ 85
Conclusions ............................................................................................................................... 86
Materials and Methods .............................................................................................................. 89
Materials ................................................................................................................................ 89
Methods ................................................................................................................................. 89
Expression and purification of hMGL and H121S hMGL ................................................ 89
Interaction of AM3506 with hMGL and H121S hMGL .................................................... 90
Assay of hMGL and H121S hMGL inhibition using AHMMCE...................................... 90
![Page 9: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/9.jpg)
viii
Intact mass analysis of AM3506-treated hMGL ................................................................ 91
MALDI-TOF MS analysis of tryptic digests (AM3506 hMGL and H121S hMGL) ........ 91
Additions of thiols to the tryptic digest samples of hMGL and H121S hMGL ................. 92
Addition of thiophenol to sulphonylated intact hMGL ...................................................... 92
Schema ...................................................................................................................................... 93
Figures ....................................................................................................................................... 94
Supplementary Data .................................................................................................................. 99
Expression and purification of ΔTM rFAAH ........................................................................ 99
Interaction of AM3506 with ΔTM rFAAH ......................................................................... 100
Assay of ΔTM FAAH inhibition using AAMCE ................................................................ 100
LC/MS ESIMS Intact mass analysis of AM3506-treated ΔTM rFAAH ............................. 100
MS/MS Analysis of rFAAH I250H Tryptic Peptides ......................................................... 101
Assignment of Trypsin Digested Peptides from rFAAH I250H ......................................... 102
Supplementary Figures ............................................................................................................ 103
Acknowledgements ................................................................................................................. 108
Synthesis and Characterization of a Novel, Theranostic, Click-Enabled Nanoplatform ............ 109
Introduction ............................................................................................................................. 110
Results and Discussion ............................................................................................................ 113
TEM imaging to monitor particle synthesis ........................................................................ 113
Dynamic light scattering analysis particle synthesis ........................................................... 113
T2 contrast enhancement as measured by MRI ................................................................... 115
Conclusions ............................................................................................................................. 116
Materials and Methods ............................................................................................................ 117
Materials .............................................................................................................................. 117
Methods ............................................................................................................................... 117
SPIO Synthesis via modified co-precipitation method .................................................... 117
Silica coating of SPIO nanoparticles ............................................................................... 117
THPC-stabilized gold solution synthesis ......................................................................... 118
Particle Seeding ............................................................................................................... 118
Synthesis of LPA ............................................................................................................. 118
Gold Shell Growth ........................................................................................................... 119
Dynamic Light Scattering ................................................................................................ 119
![Page 10: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/10.jpg)
ix
MRI contrast enhancement .............................................................................................. 119
Schema .................................................................................................................................... 120
Figures ..................................................................................................................................... 122
Acknowledgements ................................................................................................................. 127
Conclusions ................................................................................................................................. 128
Conclusions ............................................................................................................................. 129
References ................................................................................................................................... 133
Appendix ..................................................................................................................................... 144
![Page 11: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/11.jpg)
x
List of Figures
Fig. 1. Identity and purity of MSP1D1. ........................................................................................ 20
Fig. 2. SDS-PAGE analysis of ND-MGL formation. ................................................................... 21
Fig. 3. Downfield resonances of ND-MGL complex formation using proton NMR. .................. 22
Fig. 4. Densitometry Analysis of ND-MGL Complex. ................................................................ 23
Fig. 5. ND-MGL Association Kinetics as Measured by DLS. ..................................................... 24
Fig. 6. TEM Image of ND-MGL. ................................................................................................. 25
Fig. 1. Localization of conformational changes in hMGL induced by phospholipid bilayer
nanodiscs. ...................................................................................................................................... 50
Fig. 2. Localization of conformational changes in hMGL induced through active-site Ser
carbamylation by the covalent inhibitor, AM6580. ...................................................................... 51
Fig. 3. MD simulation of hMGL interaction with membrane phospholipid bilayer. .................... 52
Fig. 4. Cartoon superposition of the X-ray structure of hMGL (cyan, PDB ID: 3JW8) and the
model of hMGL obtained after 10 ns of MD simulation at a water/phospholipid interface (gray).
....................................................................................................................................................... 53
Fig. S1. Analysis of hMGL ........................................................................................................... 55
Fig. S2. Demonstration that AM6580 covalently inhibits hMGL by carbamylation of the enzyme
’s Ser129 nucleophile. ................................................................................................................ 56
Fig. 1. rFAAH membrane fraction activity tracking using the fluorogenic substrate AAMCA. . 68
Fig. 2. Coomassie stained SDS-PAGE analysis of rFAAH purification from solubilized
membrane fraction. ....................................................................................................................... 69
Fig. 3. FPLC-SEC separation for purified rFAAH. ...................................................................... 70
Fig. 4. FPLC-SEC separation for purified ND-rFAAH. ............................................................... 71
Fig. 5. Coomassie stained SDS-PAGE for ND-rFAAH. .............................................................. 72
Fig. 6. Uptake plots for rFAAH in solution. ................................................................................. 73
Fig. 7. In-solution dynamics for rFAAH (PDB: 1mt5)20. ............................................................. 74
Fig. S1. Coverage map for MSP1D1 in ND-rFAAH samples. ..................................................... 76
Fig. S2. Coverage map for rFAAH in solution. ............................................................................ 77
Fig. 1. Inhibition curves for serine hydrolases using AM3506..................................................... 94
Fig. 2. LC-TOF ESI-MS analysis of hMGL enzyme masses. ...................................................... 95
Fig. 3. MS/MS analysis of hMGL inactivation by AM3506. ....................................................... 96
Fig. 4. H121S hMGL inhibition by AM3506. .............................................................................. 97
Fig. 5. MALDI TOF MS analysis of the conjugate addition of thiophenol and β-
mercaptoethanol (βME) to AM3506-treated hMGL. .................................................................. 98
Fig. S1: LC-ESI MS analysis of hMGL enzyme masses at pH 8.0. ........................................... 103
![Page 12: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/12.jpg)
xi
Fig. S2. Coomassie-stained SDS-PAGE gel for purified, hexa-histidine-tagged ΔTM rFAAH104
Fig. S3. ΔTM rFAAH inhibition by AM3506. .......................................................................... 105
Fig. S4: MS analysis of ΔTM rFAAH inhibition by AM3506. ................................................. 106
Fig. S5: LC-ESI MS analysis ΔTM rFAAH I250H .................................................................. 107
Fig. 1. TEM micrographs of oleic acid stabilized Fe3O4 (SPIO) particles. ................................ 122
Fig. 2. TEM micrographs of SiO2-NH2 coated Fe3O4 (SPIO) particles (Core-Shell) and “
seeded” particles. ...................................................................................................................... 123
Fig. 3. Dynamic light scattering analysis of SPIO-NH2 and seeded nanoparticles. ................... 124
Fig. 4. Dynamic light scattering analysis of fLPA-SPIO@AuNS particles. .............................. 125
Fig. 5. Magnetic resonance images of SC-SPIONs. ................................................................... 126
![Page 13: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/13.jpg)
xii
List of Tables
Table 1. Kinetic parameters for hydrolysis of AHMMCE and 2-AG by hMGL in the presence
and absence of detergent or phospholipid bilayer nanodiscs. ....................................................... 49
Table S1. Peptic peptides common to hMGL in the absence or presence of nanodiscs. .............. 54
![Page 14: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/14.jpg)
xiii
List of Schemes
Scheme 1: Workflow for co-purification of ND-MGL. ................................................................ 18
Scheme 2: Determination of MGL conformation by proton NMR spectroscopy. ....................... 19
Scheme 1: Proposed mechanism of hMGL inactivation by AM3506. ......................................... 93
Scheme 1: fLPA-SPIO@AuNS Synthetic Scheme. ................................................................... 120
Scheme 2: Agar phantoms for MRI contrast enhancement. ....................................................... 121
![Page 15: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/15.jpg)
xiv
List of Abbreviations
(-)MSP
A his-tag cleaved variant of membrane scaffold protein 1D1
2-AG
2-arachidonoylglycerol
βME
Beta-mercaptoethanol
ΔTM-rFAAH
Transmembrane deleted, or truncated rat fatty acid amide hydrolase
AA
Arachidonic acid
AAMCA
N-arachidonoyl 7-amino-4-methylcoumarin amide
ABHD6/12
α-β Hydrolase Domain Containing Enzyme 6/12
ABPP
Activity based protein profiling
AChE
Acetylcholinesterase
AEA
Anandamide
AHMMCE
Arachidonoyl 7-hydroxy-6-methoxy-4-methylcoumarin ester
AMC
7-amino-4-methylcoumarin
Amp
Ampicillin
APTES
(3-Aminopropyl)triethoxysilane
AuNP
Gold nanoparticle
BSA
Fatty acid-free bovine serum albumin
CAN
Acetonitrile
CB
Cannabinoid
CHAPS
3-[(3-Cholamidopropyl)dimethylammonio]-1-
Propanesulfonate
Click chemistry
Azide-alkyne Huisgen cycloaddition
CNS
Central nervous system
CYMAL 6-cyclohexyl-1-hexyl-β-D-maltopyranoside
![Page 16: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/16.jpg)
xv
DAG
Diacylglycerol
DAGL Diacylglycerol lipase
DCC
N, N’-Dicyclohexylcarbodiimide
DCU
N,N'-dicyclohexylurea
DDM
N-dodecyl-beta-D-maltoside
DI
Deionized
DLS
Dynamic light scattering
DMSO
Dimethyl sulfoxide
EA
Ethanolamine
ECB
Endocannabinoid
EDTA
Ethylenediaminetetraacetic acid
EM
Electron microscopy
EPR Enhanced permeability and retention effect
ESI
Electrospray ionization
FAAH
Fatty acid amide hydrolase
fLPA-SPIO@AuNS
Lipoic acid propargyl amide-functionalized superparamagnetic iron
oxide core, gold nanoshell
FPLC
Fast protein liquid chromatography
GBMSDG
Greater Boston Mass Spectrometry Discussion Group
GPCR
G protein coupled receptor
h/rFAAH
Humanized rat fatty acid amide hydrolase
H121S hMGL
Histidine 121 to serine single mutant recombinant human
monoacylglycerol lipase
HEPES 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid
![Page 17: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/17.jpg)
xvi
HMMC 7-hydroxy-6-methoxy-4-methylcoumarin
HPLC
High pressure liquid chromatography
HX MS Hydrogen deuterium exchange mass spectrometry
IGERT
Integrative Graduate Education and Research Traineeship
IMA
Imidazole
IMAC
Immobilized metal affinity chromatography
ImageJ
Image processing and analysis in java software
IPTG
Isopropyl β-D-thiogalactopyranoside
IR
Infrared
Kan
Kanamycin A
LB
Luria Broth
LC-TOF MS
Liquid chromatography time-of-flight mass spectrometry
LDAO
Lauryldimethylamine-oxide
LPA
Dihydrolipoic acid, or lipoic propargyl amide
MALDI-TOF
Matrix-assisted laser desorption ionization-time of flight
MAPK
Mitogen-activated protein kinase
Matrix
α-cyano-4-hydroxycinnamic acid
MD
Molecular dynamics
MGL
Monoacylglycerol lipase
MNPs
Magnetic nanoparticles
MRI
Magnetic resonance imaging
MSP
Membrane scaffold protein
n.d.
Not determined
![Page 18: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/18.jpg)
xvii
NAPE
N-arachidonoyl phosphatidyl-ethanolamine
NCI
National Cancer Institute
ND
Nanodisc
ND-CPX
Nanodisc protein complex
NIH
National Institute of Health
NMR
Nuclear magnetic resonance
NP
Nanoparticle
NSF
National Science Foundation
OD600
absorbance (optical density) of a sample measured at a wavelength
of 600 nm
PDB
Protein data bank
PDI
Polydispersity index
PE
Phosphatidyl-ethanolamine
PMSF
Phenylmethanesulfonylfluoride
POPC
1-palmitoyl-2-oleoylphosphatidylcholine
POPG
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol
RARE
Rapid acquisition with relaxation enhancement, aka. rapid spin
echo
rFAAH
Rat fatty acid amide hydrolase
rFAAH I250H
Isoleucine to histidine single mutant rat fatty acid amide hydrolase
RT
Room temperature, approximately 22 °C
SC-SPION
Silica coated superparamagnetic iron oxide nanoparticle
SD
Standard deviation
SDS-PAGE
Sodium dodecyl sulfate polyacrylamide gel electrophoresis
![Page 19: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/19.jpg)
xviii
SEC
Size exclusion chromatography
SH-PEG/mPEG2000-SH
O-[2-(3-Mercaptopropionylamino)ethyl]-O′-methylpolyethylene
glycol 2,000
SMPL Solubilized membrane protein library
Sol-hMGL
L169S, L176S double mutant human monoacylglycerol lipase
SPIO(N)
Superparamagnetic iron oxide (nanoparticle)
SPIO-NH2
Amine-functionalized, silica coated, superparamagnetic iron oxide
nanoparticles
SPR
Surface plasmon resonance
TEM
Transmission electron microscopy
TeOS
Tetraethyl orthosilicate
TEV Protease
Tobacco etch virus protease
THPC
Tetrakis(hydroxymethyl)phosphonium chloride
TM
Transmembrane domain
TRP
Transient receptor potential
UPLC
Ultra high pressure liquid chromatography
WT hMGL
Wild type recombinant human monoacylglycerol lipase
![Page 20: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/20.jpg)
1
Introduction
According to the National Cancer Institute, more than 12% of female newborns in the
United States will be diagnosed with breast cancer within their lifetime;1 those with aggressive
forms of the disease, will have less than a 25% chance of surviving 5 years post-diagnosis.1
Without pharmacological intervention, breast cancer will remain a significant global health issue
for the foreseeable future. Currently, a major hurdle in the breast cancer drug discovery initiative
is the identification of highly selective imaging and therapeutic agents for the diagnosis and
treatment of the disease.
The regulation of endocannabinoid signaling has profound effects on the progression of
aggressive/metastatic breast and prostate cancer cell growth, migration, and invasion.2
Monoacylglycerol lipase (MGL), a serine hydrolase that regulates endocannabinoid signaling,
has a typical serine-histidine-aspartate catalytic triad3,4 belongs to the α/β hydrolase family,5 and
is the major enzyme responsible for the hydrolysis of 2-arachidonoylglycerol (2-AG);6 which is
an endocannabinoid that is synthesized and localized in the membrane bilayer.7 Increased tissue
2-AG levels, consequent to pharmacological or genetic MGL ablation, are associated with
preclinical therapeutic benefit against pain,8,9 inflammation,10,11 neurodegenerative disorders,12
psychological stressors,13 nausea/emesis,14 and most notably cancer pathogenesis.2,15
Overexpression of MGL, and the resultant over-hydrolysis of 2-AG, elevates the level of pro-
tumorigenic signaling lipids in cancer cells.2 As such, the development of highly selective
imaging and therapeutic agents for examining functional MGL presents a key step in advancing
our understanding of the complete metabolic role this potential biomarker for breast cancer
plays.
![Page 21: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/21.jpg)
2
The serine esterase/amidase fatty acid amide hydrolase (FAAH) similarly regulates a
bioactive lipidome by catabolizing cannabinoid and non-cannabinoid compounds,16 including its
primary substrate anandamide (AEA),17 and 2-AG.18 FAAH also regulates signaling through the
transient receptor potential (TRP) ion channels.19 The crystal structures of rat FAAH (rFAAH),20
truncated rFAAH (ΔTM-rFAAH),20,21 and a humanized rFAAH construct (h/rFAAH)22 are
known, but the structural dynamics, and oligomeric states of this enzyme have yet to be
elucidated.
Unlike FAAH, which is anchored by a transmembrane spanning domain,20 MGL
transiently associates with cell membranes.23 To gain a comprehensive understanding of the
mechanism of action of these enzymes, it is vital that we first unravel the impact of this protein-
membrane interaction. Like most lipases, MGL appears to exhibit interfacial activation and
undergoes a transition from a “solution” to a “membrane-associated” conformation, a process
that involves attachment of part of its lid domain to the phospholipid bilayer.24 As a prerequisite
for developing effective small molecule drugs that target MGL and FAAH, it is essential to
probe these conformational and spatial dynamics. Presented here is the determination the kinetics
of MGL hydrolysis in a nanodisc biological membrane mimetic, and the further characterization
of the nanodisc model with use of high resolution imaging techniques, measurement of the
structural dynamics of MGL and rFAAH in nanodiscs using hydrogen-deuterium exchange mass
spectrometry (HX-MS), use a novel “Michael probe” system as a proof-of-concept for a novel
imaging agent which specifically labels active human MGL, and the development of a silica-
coated, super-paramagnetic, iron oxide core/gold shell, theranostic nanoplatform that could be
used to target these proteins and treat metastatic disease.
![Page 22: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/22.jpg)
3
Chapter 1
Characterization of the Nanodisc Model Using High-resolution Techniques
![Page 23: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/23.jpg)
4
Introduction
Nanodiscs (NDs), originally described and synthesized by Stephen Sligar et al.25,26 at the
University of Illinois at Urbana-Champaign, are phospholipid bilayers constrained by two
amphipathic membrane scaffold proteins (MSPs). NDs are highly stable in aqueous solution and
are compatible with analytical techniques that are typically limited to soluble proteins (see
review by Malhotra and Alder27). Unlike micelles, bicelles, and liposomes, which traditionally
have been used as in vitro models of biological membranes,28 NDs do not suffer from
aggregation, geometric distortion, or heterogeneity. Nanodiscs are formed through a self-
assembly process whereby detergent-stabilized (usually sodium cholate) phospholipids and
detergent-stabilized membrane proteins are combined with MSP in specific stoichiometric ratios.
Detergent is subsequently removed, catalyzing self-assembly of nanodisc-membrane protein
complexes (ND-CPX) through dialysis or the use hydrophobic-adsorbent beads. ND-CPX
formation is then traditionally confirmed using fast protein liquid chromatography (FPLC)
equipped with a size-exclusion analytical column and sodium dodecyl sulfate-polyacrylamide gel
electrophoresis (SDS-PAGE). This system has been used to aid the study many different
membrane proteins, such as GPCRs25,29,30, pore proteins31,32, enzymes24,33-35, and multimeric
complexes36,37. This represents an invaluable tool for studying these proteins, which make up 20-
30% of the proteome for any given organism,38 especially considering that membrane proteins
make up less than 1% of the crystal structures in the protein data bank (PDB).27
In the current study, we examined the identity and purity of MSP1D1 using FPLC-SEC
and liquid chromatography time-of-flight mass spectrometry (LC-TOF MS) before forming ND-
MGL complexes. The ND-MGL was analyzed using immobilized metal affinity chromatography
(IMAC) co-purification, FPLC-SEC, and SDS-PAGE to confirm complex formation. Nuclear
![Page 24: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/24.jpg)
5
magnetic resonance (NMR) spectroscopy was also used to confirm the interaction between NDs
and MGL. Densitometric analysis was performed to analyze the stoichiometry of the ND-MGL
complex using our synthetic scheme (ratio of MSP/lipid/MGL/detergent), and dynamic light
scattering (DLS) was used to study the association kinetics of ND-MGL formation. Finally, high
resolution electron microscopy was performed to image ND-MGL.
![Page 25: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/25.jpg)
6
Results and Discussion
Confirming the identity and purity of MSP1D1
Before proceeding with nanodisc self-assembly, the identity and purity of MSP1D1 was
confirmed using SDS-PAGE, FPLC, and LC-TOF-MS (Fig. 1). The multimeric state of the
protein is important to measure before initiating ND-CPX self-assembly, since MSP readily
forms oligomers. Monomeric MSP1D1 forms NDs more quickly than older, more aggregated
protein (data not shown). Dimers will disaggregate in the presence of cholate in the ND buffer,
but higher order oligomers will not and therefore cannot be used to form NDs. SEC for freshly
purified MSP1D1 shows MSP-monomer as the predominant peak, but significant amounts of
MSP-dimer and trivial amounts of higher order oligomers are also present in the sample (Fig.
1a). SDS-PAGE analysis shows only a single band for purified MSP1D1, indicating that MSP
multimers disaggregate in SDS (Fig. 1a inset). LC-TOF electrospray ionization (ESI)-MS reveals
two predominant masses for MSP1D1, 24,660.6 Da, and 24,716.0 Da (Fig. 1b). The first is the
expected protein mass (± 1 Da) as interpreted from the protein’s amino acid sequence. The
second peak is only present when IMAC purification is carried out using Talon® affinity resin,
not Clontech His60 Ni Superflow™ resin, and most likely represents the addition of a divalent
metal-ion to the 6-His tag, although we did not rule out other possible (+56 Da) chemical
modifications such as addition of a butyl group.
Nanodisc assembly and complex co-purification
Since MGL associates with membranes, but is not tethered to the membrane like many
“membrane-bound” proteins, a co-purification experiment was performed to give additional
proof of complex formation beyond SDS-PAGE analysis of SEC fractions. ND-MGL was
isolated using (Scheme 1). To demonstrate complex formation, untagged MSP1D1 “(-)MSP”
![Page 26: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/26.jpg)
7
was used for nanodisc complex formation with 6-His tagged, wild-type human MGL (WT
hMGL). (-)MSP does not bind to Talon® cobalt affinity resin, unlike MSP1D1, TEV protease,
and WT hMGL, and (-)MSP clearly separates from uncleaved MSP1D1 on an SDS-PAGE gel
(Fig. 2). Anti-his western blotting showed a clear signal for WT hMGL and no signal for (-)MSP
(data not shown). The pooled and concentrated elution, following nanodisc formation, showed
bands for both WT hMGL, and (-)MSP (Fig. 2). The (-)MSP could only be observed in complex
with MGL. This pooled and concentrated elution contained ND-MGL, ND, and WT hMGL
(which presumably disassociated during SEC), as evidenced by size exclusion chromatography,
and silver stained SDS-PAGE (data not shown), providing direct evidence of complex formation.
In order to select for a population of ND-MGL, rather than ND and WT hMGL in the
disassociated state, an excess of ND should be self-assembled to ensure the ND-MGL
conformation in solution.
NMR analysis of ND-MGL association
MGL shows a distinct pattern of low-field “downfield” resonances (12-18 ppm) in proton
NMR. This pattern, or “fingerprint,” represents a hydrogen bond network that changes when the
enzyme is in an “open” active, or a “shielded” inactive 3-dimentional conformation. By altering
the pH of the aqueous buffer, this conformation can be shifted from open to closed or left in a
dynamic state where the MGL population readily switches between open and shielded (Scheme
2). To determine if the addition of NDs would change the conformation of MGL in solution,
suggesting interaction/complex formation, NDs were titrated into the NMR tube with a mixed
population of MGL (pH 8). Addition of nanodiscs elicited two changes in the downfield
resonance pattern. First, a clear shift from the open to the shielded conformation was observed,
and second, a significant decrease in overall downfield signal was evident (Fig. 3). This result
![Page 27: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/27.jpg)
8
suggests that MGL in the open conformation was interacting with the NDs. The resultant
complex would be too large to measure by our method for solution-probe proton NMR due to its
slow rate of tumbling39. Therefore, addition of NDs may have served to sequester active protein,
leaving only inactive and uncomplexed MGL available for detection in the NMR tube. This
experiment adds to the preponderance of evidence that suggests NDs and MGL form complexes
in solution.
Densitometry analysis of the stoichiometry for ND-MGL preparation
To determine the stoichiometry of the ND-MGL complex, which was designed to have an
excess of NDs to drive the associated state, densitometry analysis was performed. A ratio of 1
ND-MGL per 6 NDs formed was found for this preparation (Fig. 4a). The MSP1D1 standard
curve had an R2 value of 0.987 (Fig. 4b), and the MGL standard curve had an R2 value of 0.996
(Fig. 4c). This stoichiometry is sufficient for future analysis of this sample, and this
densitometry-based methodology should be used to analyze future ND complexes.
Dynamic Light Scattering analysis of ND-MGL association kinetics
DLS measures particle size based on motion in solution (based on a Brownian motion
assumption) and has been widely used to study protein aggregation40-46. We used this technique
to analyze the association kinetics for ND-MGL complex formation. When NDs were added to a
solution containing WT hMGL, at first widely variant Z-averages (intensity based harmonic
mean particle size) were calculated (Fig. 5). This variance from the mean particle size decreased
steadily over 15 min until a metastable state was achieved (Fig. 5). This suggests that the ND-
MGL complex forms rapidly through a dynamic process of association and disassociation. The
time to achieve this equilibrium is essential to consider before proceeding to analyze ND-MGL
samples.
![Page 28: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/28.jpg)
9
Imaging ND-MGL using transmission electron microscopy
The fine structure physical of ND-MGL samples was imaged using TEM (Fig. 6). This
representative micrograph shows two, well-formed, POPC/POPG (3/2) ND-MGL complexes.
Due to the destructive nature of TEM sample preparation, and the need for a complete vacuum in
the sample chamber, many NDs were destroyed during this procedure; and as such, misfolded
protein aggregates were visible in the imaging field. For this experiment, negative staining with
the electron dense uranyl acetate was used to create contrast in the image. The stain
accumulates/concentrates along the edges of the NDs creating dark circles, and the stain deposits
on any proteins in complex with the NDs. Therefore, the dark spots within the 10 nm circles
designated by red arrows, are presumed to be MGL in complex with NDs.
![Page 29: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/29.jpg)
10
Conclusions
In this study, high-resolution imaging techniques were used to analyze the ND membrane
model. After confirming the fidelity of the membrane scaffold protein, we provided evidence
that NDs will form complexes with MGL using a co-purification protocol. These data offer
evidence that hMGL associates with nanodiscs to form an ND-MGL complex with a mean
Stokes diameter slightly greater than either the enzyme or the unassociated nanodiscs.
To characterize further this interaction, a ND-MGL mixture was analyzed using in-gel
densitometry. The stoichiometric ratio of this mixture can be altered by modulating the amount
of MGL in the self-assembly mixture, but a synthetic scheme leading to an excess of blank NDs
was preferred in this situation to drive the ND-MGL associated state, since MGL is not a
membrane bound, or integral membrane protein and can disassociate and reassociate with
biological membranes readily. Dynamic light scattering was then used to determine the length of
time required for complex formation between blank NDs and detergent-free WT hMGL in
solution. The time required to reach a dynamic equilibrium is essential to consider if using this
method for complex formation. We have provided evidence that 15 min is sufficient for this
equilibrium to be reached at room temperature, but 30 min will be used in the future to ensure
the steady state has been reached.
Complexation was also analyzed using NMR spectroscopy. Sol-hMGL gives distinct
NMR spectra, depending on whether it is in the open (active), shielded (catalytically inactive)
form, or a mixture of the two conformation(s). ND-hMGL complexes are too large to measure by
solution probe NMR as their “tumbling time” is too slow, but hMGL that has yet to form a
complex can be detected. We showed that when NDs are titrated into a solution of sol-hMGL,
the NMR-detectable enzyme population is completely in the closed form at a stoichiometric ratio
![Page 30: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/30.jpg)
11
of ND::MGL 1::32. This may be due to a high-affinity interaction between open hMGL and the
nanodisc. Indeed it has been postulated that hMGL will only disassociate from the membrane
through transition from the open-conformation, membrane-associated complex to the membrane-
dissociated, closed conformation47.
![Page 31: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/31.jpg)
12
Materials and Methods
Materials
SDS-PAGE supplies, SM-2 biobeads, and Bio Spin columns were purchased from Bio-
Rad (Hercules, CA). Culture media, standard laboratory chemicals, and buffers were purchased
from Fisher Chemical (Pittsburgh, PA) and Sigma Chemical Co. (St. Louis, MO). The plasmid
expressing MSP1D1 was purchased from Add Gene (Cambridge, MA). POPC and POPG were
purchased from Avanti Polar Lipids (Alabaster, AL) as stock solutions in chloroform. 1,2-
Deuterium oxide (>99%) was purchased from Cambridge Isotope Laboratories (Andover, MA).
Methods
Expression and purification of hMGL
Expression and purification of hMGL followed the following procedure. A single E. coli
BL21 (DE3) colony, containing pET45His6hMGL plasmid, was used to inoculate 20 mL of
Luria broth medium containing ampicillin (100 µg/mL) and was grown overnight at 37°C with
shaking (~250 rpm). The following day, 10 mL of the overnight culture was used to inoculate 1
L of fresh Luria broth-AMP100 and allowed to grow until the culture reached an OD600 of 0.6.
Protein expression was induced with isopropyl β-D-thiogalactopyranoside (IPTG) to a final
concentration of 1 mM and the temperature lowered to 33°C. Following a 4 hr. induction, the
cells were collected by centrifugation at 5000 x g for 10 min at 4°C and stored at –80°C. For
purification, the frozen pellet was thawed on ice, re-suspended in lysis buffer (50 mM Tris, 100
mM NaCl, 1% Triton X-100, pH=8.0) and sonicated on ice. The cell lysate was then centrifuged
at 30,000g for 30 min at 4°C. The supernatant was added to 0.5 mL (bed volume) of Cobalt-
NTA resin (Clonetech) pre-equilibrated with lysis buffer and mixed for 1 hr. at 4°C. The
suspension was transferred to a gravity-flow column and washed with 20 mL lysis buffer, then
![Page 32: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/32.jpg)
13
with 10 mL of lysis buffer containing 10 mM imidazole. Finally, hMGL was eluted with 3mL of
lysis buffer containing 250 mM imidazole and the purity was checked with SDS-PAGE.
Expression and purification of MSP1D1
MSP1D1 growth and expression was carried out according to the protocol published by
Bayburt et al.48 In brief, a single colony of E. coli BL21 Gold (DE3) expressing the pET28a
plasmid with the MSP1D1 gene was grown in 30 mL LB-kan30 until an OD600 of 0.5-1 was
achieved (~4-5 h.), then the inoculum was kept at 4 °C overnight. 1 L of 37 °C TB-kan10 was
then inoculated with 20 mL of the overnight culture. The cells were induced with 1 mM IPTG at
OD600 of 2.5 to 3.0 (~4-5 h.). 1 hr. post-induction, the temperature was reduced to 28 °C.
Approximately 3.5-4 h post-induction, cells were collected by centrifugation at 8 k x g for 15
min. and cell pellets were stored at -80 °C.
For purification, 2 g cell pellets were lysed by sonication in 20 mL of lysis buffer (20
mM NaH2PO4 with 1% Triton X-100, and 1 mM fresh PMSF, pH 7.4).The sonicate was
centrifuged at 30 k x g for 30 min at 4 °C. The supernatant was then added to Clontech His60 Ni
Superflow™ resin and purified using the manufacturer’s instructions. In brief, equilibrated beads
(0.5-1 mL bed volume) were incubated on a rotator with the MSP1D1 supernatant for 1 hr. at 4
°C, then transferred to a gravity flow column where they were washed with 10-20 bed volumes
of lysis buffer, then 10-20 bed volumes of ND buffer (20 mM Tris/HCl, pH 7.4, containing 100
mM NaCl, 0.01% NaN3 and 50 mM cholate), then 10-20 bed volumes of ND buffer without
cholate, the 10 bed volumes of ND buffer without cholate, with 30 mM imidazole. MSP1D1 was
eluted in fractions (1 bed volume each) of ND buffer without cholate, with 300 mM imidazole.
The fractions were pooled and dialyzed overnight against 1,000 X v/v ND buffer without
cholate. The dialyzed protein was then concentrated using 10 kDa cutoff Amicon® Ultra
![Page 33: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/33.jpg)
14
centrifugal filter units, to 100 µL and stored at 4 °C for immediate use, or at -80 °C for long-term
storage. Purity was checked with SDS-PAGE, and concentration measured by Pierce® 660 nm
protein assay (Thermo Scientific) before use.
LC-TOF analysis of MSP1D1
A Waters LCT-Premier mass spectrometer was used to determine the intact mass of
MSP1D1. The instrument was calibrated with 500 fmol/mL horse myoglobin (Sigma-Aldrich)
before and after reach run. Instrument conditions were as follows: source temperature, 80°C;
desolvation, 175°C; capillary voltage, 3200 V; and cone voltage, 35 V. Dialyzed, detergent-free
MSP1D1 samples in ND buffer without cholate (200 pmol) were injected onto a self-packed
POROS 20 R2 2 mm x 20 mm trap column which traps the protein but allows buffer salts
through. Samples were manually desalted with an appropriate (>5 x the volume of the sample)
volume of 0.1% formic acid in H2O. The desalted protein was then eluted from the column with
a 15-75% gradient of acetonitrile containing 0.05% TFA at flow rate 50 µL/min in 4 min.
ND-MGL co-purification
Tabaco etch virus (TEV) protease was used to remove the 6-his tag from MSP1D1 using
the manufacturer’s (Sigma-Aldrich) protocol. In brief, MSP1D1 in ND buffer without cholate
was diluted to 1-2 mg/mL in dialysis buffer (25 mM Tris-HCL, pH 8.0 containing 200 mM
NaCl). TEV protease was added at a ratio of 1:100 (w/w) TEV/MSP1D1. This mixture was
dialyzed against 4 L of dialysis buffer at 4 °C overnight. MSP1D1 and TEV protease were
removed by IMAC using Talon® resin according to the manufacturer’s protocol, and (-)MSP
was spin-concentrated as described previously. Purity of (-)MSP was measured by SDS-PAGE
and concentration was determined by absorption at λ 280 using the molar absorptivity constant
18,200. ND assembly was performed with a (-)MSP/POPC/POPG/WT hMGL/cholate/Triton X-
![Page 34: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/34.jpg)
15
100 ratio of 1/47/31/0.31/156/0.5%. The mixture was incubated for 1 h on ice, and cholate
detergent was removed during a gentle 10 hr. rotation with SM-2 biobeads at 4°C. IMAC
purification was then performed using Talon® resin according to the manufacturer’s protocol to
isolate WT hMGL and ND-MGL. Pooled eluent was purified by size-exclusion chromatography
with an Amersham-Pharmacia AKTA FPLC Protein Purifier System (GE Healthcare Life
Sciences, Pittsburgh, PA) on a Superdex 200 10/300 column eluted with 20 mM Tris–HCl, pH
7.4, containing 100 mM NaCl and 0.5 mM EDTA at 0.5 mL/min. Column eluate absorbance was
monitored at 280 nm, and SDS-PAGE was used to evaluate the purity of the fractions.
ND self-assembly and isolation
Purified MSP1D1 in ND buffer was added to a solubilized mixture of 1-palmitoyl-2-
oleoylphosphatidylcholine (POPC)- 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol (POPG)
(3:2 molar ratio) with sodium cholate, and the final molar ratio was adjusted to 1:78:200
(MSP1D1:phospholipid:sodium cholate). NDs were formed and purified as described above.
FPLC fractions containing purified NDs were collected and concentrated for experimental use.
ND concentration was calculated form the absorbance at 280 nm and the MS1D1 molar
extinction coefficient 21,000, accounting for two MSP1D1 molecules per disc.
Proton NMR analysis
L169S, L176S double hMGL mutant (sol-hMGL) was expressed and purified as hMGL
(above) and used for detergent-free solution NMR study. NMR analysis was performed
according to the protocol developed by Karageorgos et al.49 In brief, Enzyme samples for NMR
were prepared in a solution of 93% H2O–7% D2O (v/v) containing 50 mM Tris, 100 mM NaCl,
pH 8.0. sol-hMGL protein concentration was 200 mM and NDs in the same buffer were titrated
in at a molar ratio of ND/sol-hMGL of 1/64 or 1/32.
![Page 35: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/35.jpg)
16
All 1D 1H NMR spectra were obtained at 37 °C on a 700-MHz Bruker AVANCE II
NMR spectrometer equipped with a 5 mm triple resonance probe. NMR spectra for low-field
exchangeable protons were recorded using the 1331 pulse sequence with the excitation
maximum at 16 ppm to minimize water excitation at 4.7 ppm. Acquisition was performed with a
901 flip angle, recycle delay 0.6 s, and 32 K data points for 4 K scans. Data were processed and
analyzed using the Topspin 2.1 software package (Bruker). Exponential weighting resulting in a
30 Hz line broadening was applied. The proton chemical shift values were directly referenced to
4,4-dimethyl-4-silapentane-1-sulfonic acid at 0 ppm.
Densitometry analysis
Nanodisc samples, and controls (MSP and MGL at known concentrations) were separated
by SDS-PAGE and stained with Comassie. Gel images were acquired using an Alpha Innotech
FluorChem SP MultiImage™ light cabinet. Images were processed using Image Processing and
Analysis in Java (ImageJ) software freely available here: http://imagej.nih.gov/ij/ from the
National Institute of Health (NIH).
Dynamic Light Scattering
DLS experiments were carried out on a Malvern Zetasizer Nano-S (Malvern Inc., UK)
instrument. Samples containing ND and detergent-free WT hMGL in ND buffer were added in a
2/1 (ND/MGL) stoichiometric ratio in the DLS cuvette at 25 °C. Readings were recorded every
15 sec for 15 min and Z-average (the intensity-based harmonic mean particle size) values were
calculated using the Malvern software, version 6.
TEM imaging of nanodiscs
A single drop of nanodisc-containing solution was added to a carbon-coated, copper,
TEM square-grid (Agar Scientific). This drop was allowed to dry for 1 min, and then excess
![Page 36: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/36.jpg)
17
buffer was wicked away using Whatman #4 filter paper. The sample was negatively stained with
a 1.5% uranyl acetate or phosphotungstic acid solution in DI water. The grid was then washed 3
times with DI water and dried completely before imaging using a JEOL JEM-1010 general
purpose transmission electron microscope, with digital image acquisition operated at 75 kV.
![Page 37: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/37.jpg)
18
Schemes
Scheme 1: Workflow for co-purification of ND-MGL.
a) Purification and concentration of untagged MSP1D1. [inset: in red, the residues cleaved by
TEV protease, in black, the sequence of (-)MSP1D1]. b) Formation of ND-MGL using (-
)MSP1D1 and the subsequent co-purification of the complex using IMAC for the 6-His tag on
WT hMGL and SEC.
![Page 38: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/38.jpg)
19
Scheme 2: Determination of MGL conformation by proton NMR spectroscopy.
(Scheme provided by Sergiy Tyukhtenko49) MGL exists in solution in two defined states, open
(active) and shielded (closed) which have distinct downfield resonance patterns. The
conformation of MGL can be controlled by changing the pH of the aqueous buffer.
![Page 39: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/39.jpg)
20
Figures
Fig. 1. Identity and purity of MSP1D1.
(a) FPLC chromatogram for MSP1D1 showing multimeric state. [Inset: pure MSP1D1 SDS-
PAGE image] (b) LC-TOF ESI-MS chromatogram showing intact mass of MSP1D1 [Inset:
signal to noise ratio was 67]
![Page 40: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/40.jpg)
21
Fig. 2. SDS-PAGE analysis of ND-MGL formation.
4 µL of prestained SDS-PAGE standards #161-0318 ladder were added to lanes 1 and 15. Lane
2: MSP1D1, Lane 3: MSP1D1 and TEV protease, Lane 4: wash, Lane 5: his tag cleaved
MSP1D1, Lane 6: concentration of his tag cleaved MSP1D1, Lane 7: ND formation mixture,
Lane 8: unbound fraction, Lane 9: pooled elution, Lane 10: concentration of pooled elution, Lane
11: WT hMGL, Lane 12: Talon® resin from MSP cleavage protocol, Lane 13: Talon® resin
from complex isolation wash, Lane 14: Talon® resin from complex isolation
![Page 41: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/41.jpg)
22
Fig. 3. Downfield resonances of ND-MGL complex formation using proton NMR.
Lane 1: Downfield resonance “fingerprint” for “open” conformation MGL. Lane 2: Fingerprint
for MGL at pH 8.0 showing a mixture of open and “shielded” conformations. Lane 3:
Fingerprint for MGL with ND added at a stoichiometric ratio of 1 to 64. Lane 4: Fingerprint for
MGL with ND added at a stoichiometric ratio of 1 to 32.
![Page 42: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/42.jpg)
23
Fig. 4. Densitometry Analysis of ND-MGL Complex.
a) SDS-PAGE gel showing 4 µL of prestained SDS-PAGE standards #161-0318 ladder, empty
NDs, ND-MGLs, and MSP/MGL standards. b) Standard curve for MSP1D1. c) Standard curve
for WT hMGL. d) ImageJ densitomograms for the corresponding cyan squares in panel a.
![Page 43: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/43.jpg)
24
Fig. 5. ND-MGL Association Kinetics as Measured by DLS.
Complex association is highly dynamic, but a metastable (low variance from the linear
regression trend line of Z-average vs. time) state is achieved within 15 minutes. Inset:
normalized trend line representing dynamic instability reaching metastability over time.
![Page 44: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/44.jpg)
25
Fig. 6. TEM Image of ND-MGL.
Negative stained (1.5% uranyl acetate solution) image of ND-MGL. Red arrows show ND-MGL.
Inset: 100 nm scale bar.
![Page 45: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/45.jpg)
26
Chapter 2
Membrane Phospholipid Bilayer as a Determinant of Monoacylglycerol Lipase
Kinetic Profile and Conformational Repertoire24
![Page 46: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/46.jpg)
27
Introduction
A member of the α/β serine-hydrolase superfamily, monoacylglycerol lipase (MGL) is a
lipid hydrolase featuring a characteristic serine (Ser122)-histidine (His269)-aspartic acid (Asp239)
catalytic triad.50 MGL is primarily responsible for deactivating 2-arachidonoylglycerol (2-AG),
the predominant endocannabinoid signaling lipid in the central nervous system, which is
synthesized on-demand from membrane phospholipid precursors.23,51,52 The hydrolysis of 2-AG
by MGL also links the endocannabinoid and eicosanoid signaling systems by generating
arachidonic acid precursor for eicosanoid biosynthesis.50,52 Since 2-AG acts as a full agonist
capable of activating both principal 7-transmembrane cannabinoid receptors, designated CB1R
and CB2R, MGL represents a major control point for 2-AG-mediated cannabiniergic
transmission that influences myriad (patho)physiological processes from psychobehavioral status
to energy metabolism.53,54 Increased tissue 2-AG levels consequent to pharmacological or
genetic MGL ablation are associated with preclinical therapeutic benefit against pain,8,9
inflammation,10,11 neurodegenerative disorders,12 psychological stressors,13 nausea/emesis,14 and
cancer pathogenesis.2,15 Although protracted MGL inhibition invites functional CB1R
desensitization in rodents,55 such salutary results in preclinical disease models have helped
validate MGL as a drug target, focusing interest on the design and application of temporally-
tuned human MGL (hMGL) inhibitors as medicines capable of elevating 2-AG tone and,
indirectly, CB1R transmission to therapeutic levels with less risk of inciting the adverse events
observed with systemic application of direct CB1R agonists.56,57
Lipases are acyl hydrolases that cleave long-chain triacylglycerols at the boundary
between aqueous and lipid-substrate phases, and their biocatalysis is activated at the interface.
The interfacial potentiation of lipolysis has been attributed to factors such as increased local
![Page 47: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/47.jpg)
28
substrate concentration in close proximity to the enzyme and optimized orientation of
triacylglycerol scissile ester bonds.58 Many lipases feature a lid domain that regulates substrate
access to the binding pocket/active site,59 and crystallographic data have supported inference
that lipase structural changes upon association between the enzyme’s lid region and the boundary
of a lipid matrix also contribute to interfacial lipase activation. Atomic-level analysis of
Rhizomucor miehei lipase, for example, suggested that this enzyme’s activation-associated
conformational change reflects a hinge-type motion involving displacement of its lid domain so
as to enhance the hydrophobic area for both enzyme interaction at the lipid interface and
substrate binding.60 The mechanism of other lipases appears to involve more complex motions of
multiple enzyme helices upon association with triacylglycerol substrate.61 Several studies have
demonstrated that 2-AG hydrolytic activity is found at varying proportions between membrane
and soluble tissue subfractions, depending upon cell/tissue type. In mouse brain, 2-AG hydrolase
activity is primarily (~90%) membrane-associated,23 whereas in rat macrophages and
gastrointestinal tract MGL activity is enriched in the cytosol.62,63 The enzymatic properties of
cytosolic and membrane-associated MGL differ as well: in rat gastrointestinal tissue, the latter is
less sensitive to pharmacological inhibition.63 These collective data have invited the hypothesis
that, in situ, MGL interacts reversibly with cell membranes, allowing the enzyme to extract 2-
AG substrate from membrane-associated pools and into its hydrophobic substrate-binding pocket
containing the catalytic triad, thereby facilitating substrate engagement.50
Recent X-ray analyses of apo and liganded hMGL variants have suggested a mechanistic
rationale for this hypothesis.47,64,65 Reminiscent of many other lipid hydrolases, the (h)MGL
active site is gated by a flexible lid domain positioned to shield the entrance to the enzyme’s
substrate-binding pocket and thereby regulate substrate access to the catalytic center. A
![Page 48: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/48.jpg)
29
comparison of the crystal structures of apo-hMGL and hMGL in complex with a reversible
inhibitor has supported the view that the hMGL lid domain also participates in anchoring the
enzyme reversibly to the cell membrane during the catalytic cycle and in structural
rearrangements upon inhibitor binding, eliciting a shift from an “open” apo-enzyme to a
“closed,” ligand-bound form in which the active site is shielded.47,64 In contrast to this purported
mechanism, a crystal structure of hMGL covalently bound to a serine-reactive carbamylating
agent displayed an open-- not closed-- conformation.65 Thus, although static representations of
unique states of apo- and liganded-hMGL variants are available at atomic resolution, ambiguities
remain concerning the structural and functional ramifications of hMGL-membrane interaction.
In the current study, we have chosen to examine this issue by using purified recombinant
hMGL and phospholipid bilayer nanodiscs. A nanodisc is a discoidal form of high density
lipoprotein composed of a nanometer-sized phospholipid bilayer surrounded by two α-helical
membrane scaffold proteins (MSPs).66 Nanodiscs represent a unique, water-soluble biomimetic
system for studying membrane-associated proteins, for monodisperse nanodiscs do not suffer
from the propensity for aggregation, geometric distortion, and heterogeneity characteristic of
other structured lipid platforms such as micelles, bicelles, and liposomes.67,68 In conjunction with
a nanodisc-hMGL reconstitution system, we have used hydrogen exchange mass spectrometry
(HX MS) and molecular dynamics (MD) simulation as conformational-analysis methods to gain
insight into membrane influence on hMGL catalysis, structure, and ligand engagement. Peptide-
level HX MS involves experimental quantification of protein amide-hydrogen exchange with
heavier deuterium isotope in D2O media, the extent and kinetics of deuteration in peptide
fragments generated through digestion of the intact protein reflective of the regional solvent
accessibility of the protein as a proxy for protein conformational state and dynamics.69 MD
![Page 49: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/49.jpg)
30
simulation is a computational approach toward modeling protein structure, dynamics, and
interactions.70 Our data constitute evidence indicating that hMGL interaction with the nanodisc
phospholipid bilayer involves a transition from a solution to a membrane-associated
conformation, as evidenced primarily by structural changes in the major helical component
(helix α4) of the hMGL lid domain and neighboring regions. These conformational changes may
help stabilize an open hMGL conformation at the membrane-water interface, facilitate hMGL-
ligand (substrate, inhibitor) interaction, and enhance catalysis.
![Page 50: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/50.jpg)
31
Results and Discussion
Phospholipid bilayer nanodisc characterization
Nanodiscs are formed through a controlled self-assembly process from a defined molar
ratio of phospholipid micelles in detergent and a stabilizing MSP to yield monodisperse,
nanometer-size discoidal phospholipid bilayers encircled by the MSP, whose length defines the
diameter of the disc.66,71 For this study, purified scaffold protein MSP1D166 was mixed with
micelles composed of sodium cholate and either 1-palmitoyl-2-oleoyl-sn-glycero-3-
phosphocholine (POPC) only or a 3:2 molar ratio of POPC and 1-palmitoyl-2-oleoyl-sn-glycero-
3-phosphoglycerol (POPG). From an initial MSP1D1:phospholipid:sodium cholate molar ratio
of 1:78:200, gradual detergent removal was used to effect component assembly. The resulting
nanodiscs, as isolated by fast protein liquid chromatography (FPLC) on a calibrated size-
exclusion column, evidenced the expected66,72 Stokes hydrodynamic diameter of ~10 nm (Fig.
S1a, red) and by SDS-PAGE contained MSP1D1 as the sole protein component (Fig. S1b, red),
substantiating the purity and integrity of our nanodisc preparation
Phospholipid bilayer nanodiscs enhance hMGL catalytic activity and substrate affinity
Diacylphosphoglycerides such as POPC and POPG are not MGL substrates,50,52 and the
charged head groups of bilayer phospholipids typically endow the surface of biological
membranes with a net negative charge.73 These considerations, along with MGL’s membrane
association observed in various tissues,23,62,63 led us to examine initially whether anionic
phospholipid bilayer nanodiscs containing a 3:2 POPC:POPG molar ratio might influence the
kinetic properties of hMGL, the recombinant enzyme expressed and purified as previously
detailed by this laboratory.74
![Page 51: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/51.jpg)
32
As compared to hMGL in aqueous Tris buffer, the presence of POPC/POPG nanodiscs
increased by ~3-fold the enzyme’s rate of hydrolysis (Vmax) of the fluorogenic reporter substrate,
arachidonoyl 7-hydroxy-6-methoxy-4-methylcoumarin ester (AHMMCE),74,75 and enhanced by
~2.5-fold the enzyme’s affinity for this substrate (Km) (Table 1). The POPC/POPG nanodiscs
elicited a similar enhancement of hMGL kinetic properties for hydrolysis of the enzyme’s natural
endocannabinoid substrate, 2-AG (Table 1). Nanodisc enhancement of hMGL substrate turnover
and affinity was independent of phospholipid bilayer charge, since charge-neutral POPC-bilayer
nanodiscs increased hMGL Vmax and decreased its Km to extents comparable to those of anionic
POPC/POPG nanodiscs (Table 1). Although the nonionic surfactant Triton X-100 can serve as a
hydrophobic phase that helps solubilize both lipases and their triacylglycerol substrates to elicit
apparent lipase activation,76 we found that Triton X-100 at a final concentration of 0.05 mM (i.e.,
~ 2-fold its critical micelle concentration76) did not affect hMGL substrate affinity and increased
hMGL substrate turnover by ~1.5-fold relative to the enzyme in buffer alone (Table 1). Thus,
Triton X-100 micelles affected hMGL’s Vmax only modestly as compared to the enhanced effect
of either negatively-charged or charge-neutral phospholipid bilayer nanodiscs on both hMGL
Vmax and Km.
The coincident enhancement of hMGL activity and substrate affinity induced by
phospholipid-bilayer nanodiscs suggests that these biomembrane mimetics facilitate hMGL
interaction with 2-AG or AHMMCE in a manner distinct from merely serving as a solubilization
depot for hydrophobic substrate, since quantitatively parallel effects in hMGL kinetic properties
were not induced by detergent micelles. Since both anionic and charge-neutral nanodiscs
enhanced hMGL activity and substrate affinity (Table 1), it is tempting to hypothesize that
hydrophobic interactions between the structured nanodisc phospholipid bilayer and hMGL may
![Page 52: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/52.jpg)
33
form and establish an interfacial microenvironment that enhances hMGL kinetic properties
underpinning by facilitating 2-AG/AHMMCE diffusion from the membrane into the enzyme’s
open, hydrophobic substrate-binding pocket.
hMGL interacts with phospholipid bilayer nanodiscs
Our hypothesis that a hydrophobic association between hMGL and phospholipid bilayer
nanodiscs enhances the enzyme’s kinetic properties is congruent with the concept that physical
interaction between the hydrophobic lid region of lipases with an α/β hydrolase fold and their
lipid-phase substrates helps govern lipase catalysis by influencing substrate supply/accessibility,
orientation, and partitioning from the lipid phase to the enzyme’s substrate-binding pocket.58,77
The paradigm for interfacial effects on lipase activity extends to conformational rearrangement
of the enzyme’s lid domain as a mechanism for gating substrate access to the active site.59 These
concepts led us to probe experimentally whether hMGL associates with the nanodiscs
themselves. For this purpose, we analyzed the POPC/POPG nanodisc and hMGL preparations
themselves and an hMGL-nanodisc mixture by size-exclusion FPLC. The results demonstrate
that two distinct nanodisc-containing populations with similar, but differentiable, Stokes
hydrodynamic diameters are resolvable from hMGL itself (Fig. S1a, green), the hMGL-nanodisc
mixture (Fig. S1a, black) evidencing a mean Stokes diameter greater than the nanodiscs alone
(Fig. S1a, red). Only the hMGL-nanodisc mixture contained both MSP1D1and hMGL protein
(Fig. S1b). These data offer provisional evidence that hMGL associates with nanodiscs to form
hMGL-nanodisc complexes having a mean Stokes diameter greater than either the enzyme or the
nanodiscs.
![Page 53: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/53.jpg)
34
hMGL interaction with nanodiscs modifies enzyme regional conformation
We next investigated experimentally whether phospholipid bilayer nanodiscs influence
hMGL conformation in the two regions of α/β lipid hydrolases that are most critical for substrate
interaction and turnover: the lid and the substrate-binding pocket/active site domains.58,59,77 For
this purpose, we used peptide-level HX MS to compare the kinetics with which these hMGL
regions exchange amide hydrogens for heavier deuterium isotope (i.e., the degree of solvent
accessibility) when the intact, functional enzyme is incubated in D2O medium in the presence or
absence of POPC/POPG nanodiscs. Deuterium uptake into hMGL was monitored over
incubation periods of 10 sec to 4 h, after which times pepsin hydrolysates were generated and
analyzed by MS to determine the extent of hMGL deuteration in peptides within the enzyme’s
lid domain and substrate-binding pocket. At a given pH and temperature, deuteration rate is
modulated by protein conformational properties: rapid deuterium exchange is characteristic of
more disordered, solvent-exposed protein regions. Conversely, slower, limited exchange
indicates a more compact, solvent-shielded protein state.69 The difference between deuterium
incorporation into hMGL peptides in the absence or presence of phospholipid-bilayer nanodiscs
serves as proxy for nanodisc structural impact on the enzyme. Since peptide-level HX MS
readout is based on the masses of peptides assignable to the protein under study (here, hMGL),69
the presence of MSP1D1 in some hMGL samples does not interfere with HX MS analysis of the
enzyme itself.
Supplementary Table S1 lists the common peptic peptides identified through electrospray
ionization-MS/MS (ESI-MS/MS) from three independent hMGL preparations for enzyme in the
absence or presence of nanodiscs, along with the maximum possible deuterium incorporation for
each respective peptide. This peptide subfamily includes peptic peptides representing the hMGL
![Page 54: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/54.jpg)
35
lid and substrate binding pocket/active site domains that are the focus of the current study.
Specifically, residues 101-137 have been localized to the bottom of the substrate-binding pocket
and encompass the catalytic-triad Ser.64,65 Residues 158-191 span what has been considered apo-
hMGL’s lid domain, with residues 166-178 encompassing helix α4, which is flanked by residues
158-165 (leading from sheet β6 into helix α4) and residues 179-191 (loop conjoining helices α4
and α5).64,65 Residues 217-223 encompass helix α6 which, along with residues 224-241, are in
the vicinity of the active site.64,65
The peptide-level HX MS results for the hMGL lid domain and substrate-binding
pocket/active-site region are plotted in Fig. 1a, and the peptides considered are highlighted in the
hMGL structure representation (PDB ID: 3JW8)47 in Fig. 1b. The limited, gradual deuteration of
peptides 101-125 and 126-137 indicates that the distal region of the substrate binding pocket
containing catalytic Ser129 maintains only modest solvent exposure whether nanodiscs are
present or not and is likely a stable structural element of the enzyme without significant
breathing/unfolding motions. Peptide 224-241 was likewise shielded from solvent, but appeared
somewhat dynamic, since it acquired significant deuterium over time to become labeled to 46%
of maximum by 10 min, regardless of the presence of nanodiscs. Deuterium uptake into hMGL
lid-domain peptides 158-166, 166-178, and 182-191 was extremely rapid, indicative of high
solvent exposure. Within the lid domain, however, deuteration of peptide 166-178 constituting
helix α4 was markedly suppressed before 10 min in the presence of nanodiscs and increased
thereafter to parallel the peptide’s deuterium uptake in the absence of nanodiscs. Yet the
deuterium exchange in hMGL peptides 158-166 and 182-191 flanking helix α4 was unaffected
by the nanodiscs. A nanodisc-induced suppression of deuterium uptake into peptide 217-223
(i.e., helix α6) was also evident with an even more protracted approach to maximal deuteration
![Page 55: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/55.jpg)
36
than was observed for the influence of nanodiscs on lid-domain helix α4. Especially as compared
to hMGL helices α4 and α6, other hMGL peptic peptides identified but not considered in Fig. 1
generally evidenced modest deuterium uptake that remained unaffected by the phospholipid
bilayer nanodiscs (data not shown). This latter observation is congruent with the ordered,
shielded nature of the core of eukaryotic α/β-hydrolases across species,78 a characteristic shared
by apo-hMGL, as evident in a refined homology model of the enzyme79 and the finding that
wild-type apo-hMGL and unliganded variants crystalize as compact globular proteins.64,65
The nanodisc-induced suppression of deuterium uptake by hMGL helix-α4 peptide 166-
178 along with the nanodisc’s enhancement of hMGL reaction velocity and substrate affinity
suggest that this region of the enzyme’s lid domain associates with the nanodisc phospholipid
bilayer, the interaction serving both to shield this lid region from solvent and facilitate access of
lipid substrate to the lid-gated ligand-binding pocket. By analogy with other lipases,59 it has been
speculated that, in situ, hMGL substrate diffuses into the enzyme’s binding site from a
biomembrane pool by virtue of hMGL-membrane association.23,47,50,52,64,65 To the authors’ best
knowledge, the present study provides the first experimental evidence supporting such a
mechanism for hMGL. As observed for hMGL helix α4 peptide 166-178, nanodiscs acutely
suppressed deuteration of helix α6 peptide 217-223 which is localized near the active site,64,65
suggesting that hMGL interaction with the nanodisc phospholipid bilayer hinders the solvent
accessibility of this enzyme region also. Nanodisc shielding of the hMGL active-site region may
also be appreciated from the less dynamic and more protected nature of peptide 224-241 (as
indicated by its attenuated deuterium uptake) in the presence of nanodiscs. Collectively, these
data indicate that hMGL association with phospholipid bilayer nanodiscs influences hMGL
conformation within the enzyme’s lid domain and the vicinity of its active site.
![Page 56: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/56.jpg)
37
Covalent hMGL inhibitor modulates enzyme conformation in the presence of nanodiscs
Potent MGL inhibitors share intrinsic lipophilicity with both the hMGL endocannabinoid
substrate, 2-AG, and the reporter substrate, AHMMCE.9,10,15,50,52,53,56,57 In light of our
demonstration that phospholipid bilayer nanodiscs enhance hMGL kinetic properties and induce
enzyme lid-domain and active-site conformational changes consonant with hMGL-nanodisc
association, we used HX MS to determine the potential influence of a small-molecule inhibitor
on these hMGL regions in the presence of POPC/POPG nanodiscs. For this purpose, we selected
AM6580 (Fig. 2a) as being representative of the principal class of covalent hMGL inhibitors,
agents with the potential to carbamylate the enzyme’s catalytic serine.50,57 We previously
demonstrated that AM6580 inhibits hMGL with nanomolar potency75 and now provide evidence
from matrix-assisted laser desorption ionization-time of flight (MALDI-TOF/TOF) MS
substantiating that AM6580’s fluorenyl piprazine moiety covalently modifies hMGL catalytic
Ser129, resulting in the expected hMGL mass increase of 277 Da (Fig. S2).
In the presence of phospholipid bilayer nanodiscs, AM6580 did not influence deuterium
uptake into the hMGL lid domain (peptides 158-166, 166-178, and 182-191) (Fig. 2b). In
contrast, carbamylation of hMGL Ser129 by AM6580 significantly reduced deuterium uptake in
the vicinity of the enzyme’s active site [i.e., peptides 217-223 (helix-α6), 224-240, and 242-256
(from sheet β7 to helix α7 and including Asp246 in the catalytic triad)].64,65 Interaction between
the AM6580-derived fluorenyl moiety and hydrophobic residues in carbamylated hMGL may be
responsible for shielding helix-α6 peptide 217-223, as suggested by docking the fluorenyl
piprazine moiety from AM6580 into the active site of the hMGL structure representation PDB
ID: 3JWE65 (Fig. 2c). The fluorenyl piprazine group covalently attached to hMGL Ser129 may
also render the enzyme’s active-site region more rigid and less dynamic. Notably, in the presence
![Page 57: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/57.jpg)
38
of nanodiscs, deuterium uptake by the helix-α4 lid peptide (residues 166-178) was the same
whether hMGL was inhibited or not (Fig. 2b), suggesting that the inhibitor enters the enzyme’s
substrate-binding pocket from the nanodisc phospholipid bilayer via a membrane-associated lid,
the inhibited enzyme remaining associated with the nanodisc in an open conformation.
MD simulations predict hMGL interaction topology with nanodiscs
As a computational approach for characterizing further the conformational impact of
hMGL membrane interaction, we next performed MD simulations with POPC/POPG nanodiscs
and hMGL modeled from the X-ray structure of wild-type hMGL (PDB ID: 3JW8)47 in an open
conformation. Following 10 ns of MD simulation, significant components of the hMGL lid
region were found to interact with the bilayer. Lid-domain helix α4 penetrated into the nanodisc
phospholipid bilayer, whereas helix α6 in the vicinity of the lid evidenced a less intimate
membrane association, whether the enzyme was in its unliganded apo form (Fig. 3a), or
carbamylated by AM6580 inhibitor (Fig. 3b).
Superposition based on Cα positions of the starting hMGL model with hMGL after 10 ns
of MD simulations revealed that the majority of Cα atoms could be superimposed with very little
difference, whereas helices α4 and α6 displayed large variations after 10 ns simulations (Fig. 4).
Helix α4 rotated 31° counter-clockwise in the same plane away from the hMGL active-site
opening, resulting in the helix α4 ends being separated by a distance of 5.5Å. Helix α4 rotation
was accompanied by simultaneous motion of the loop region connecting helices α4 and α5
(residues 177-192).64,65 In particular, residues Leu179 and Ile182 shifted and were present as
different rotamers, substantially altering the hMGL active-site conformation. Helix α6 has
rotated 22° counter-clockwise in the same plane away from the active site. The net result of these
![Page 58: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/58.jpg)
39
collective conformational changes is an increased opening of the hMGL substrate-binding pocket
and accessibility of the active site.
![Page 59: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/59.jpg)
40
Conclusions
Crystallographic analyses of various apo and liganded hMGL variants47,64,65 have
furnished atomic-level structural detail on a few static conformational states of an enzyme that
has garnered intense interest as a therapeutic target.50,53,57,58 Despite documentation that MGL
exists in situ as a membrane-associated enzyme23,62,63 and observations that lipase association
with supramolecular lipid assemblies activates these enzymes,58,59 direct experimental evidence
regarding the potential influence of membrane association on hMGL molecular properties is
lacking. Our biochemical, HX MS, and computational analyses of the impact of a well-
recognized biomembrane mimetic, the phospholipid bilayer nanodisc, on hMGL kinetic
properties and conformation constitute the first detailed study to address this subject. The
collective data provide evidence that a subdomain within the hMGL lid associates intimately
with the membrane phospholipid bilayer through hydrophobic interaction, creating an interfacial
microenvironment that enhances the enzyme’s kinetic properties. Our HX MS and MD
simulation data indicate that the process of hMGL membrane association involves hMGL lid-
domain helix α4 and, more distally, helix α6 and is accompanied by dynamic regional alterations
in the conformation of these helices and in the enzyme’s active-site region that would help
stabilize an open hMGL conformation at the lipid/water boundary receptive to substrate/inhibitor
partitioning from the membrane bilayer and into the enzyme’s substrate-binding pocket. The
shielding of select hMGL regions in proximity to the active site upon Ser129 carbamylation by
AM6580 demonstrates directly that considerable conformational plasticity is associated with
regions of the enzyme proximal to the active-site in response to covalent inhibitors. The
emergence of covalent enzyme inhibitors as potential drug candidates for various diseases80 and
the identification of serine-reactive carbamylating agents as the lead chemical class of hMGL
![Page 60: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/60.jpg)
41
inhibitors50,57 make this observation particularly relevant to the design and targeting of hMGL
inhibitors as potential medications. More generally, the present study demonstrates the
suitability of peptide-level HX MS combined with nanodisc technology for investigating the
structure-function correlates of enzyme-membrane interaction.
![Page 61: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/61.jpg)
42
Materials and Methods
Materials
SDS-PAGE supplies, SM-2 bio beads, and Bio Spin columns were purchased from Bio-
Rad (Hercules, CA). MS-grade trypsin (Trypsin Gold) was from Promega (Madison, WI).
AM6580 and AHMMCE were synthesized at the Center for Drug Discovery, Northeastern
University (Boston, MA) by standard routes. HPLC grade acetonitrile,
ethylenediaminetetraacetic acid (EDTA 99%) and 85% phosphoric acid were purchased from
Fisher Scientific (Pittsburgh, PA). Arachidonic acid was from Nu-Check Prep (Elysian, MN),
and 2-AG was a generous gift from the National Institute on Drug Abuse (Bethesda, MD). Fatty
acid-free bovine serum albumin, magnesium chloride tetrahydrate, and Trizma base were
purchased from Sigma-Aldrich (St. Louis, MO). The plasmid expressing MSP1D1 was from
Add Gene (Cambridge, MA). POPC and POPG were purchased from Avanti Polar Lipids
(Alabaster, AL) as stock solutions in chloroform. 1,2-Deuterium oxide (>99%) was purchased
from Cambridge Isotope Laboratories (Andover, MA).
Methods
Purification of recombinant wild-type hMGL
Recombinant hexa-His-tagged, wild-type human hMGL was expressed in E. coli and
purified by cobalt affinity chromatography, as previously detailed.74 Chromatographic fractions
were pooled and dialyzed against 50 mM Tris-HCl, pH 8.0, containing 100 mM NaCl, and
protein concentration was estimated by absorbance at 280 nm. Purity was monitored by SDS-
PAGE.
![Page 62: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/62.jpg)
43
MSP1D1 purification
MSP1D1 was expressed and purified as described.81,82 The protein was isolated by cobalt
affinity chromatography, and purity was monitored by SDS-PAGE. Fractions containing
MSP1D1 were pooled and dialyzed against 20 mM Tris-HCl, pH 7.4, containing 100 mM NaCl,
0.5 mM EDTA, and 0.01% NaN3. Protein concentration was estimated by absorbance at 280 nm.
Nanodisc self-assembly and isolation
Purified MSP1D1 in 20 mM Tris-HCl, pH 7.4, containing 100 mM NaCl, 0.5 mM
EDTA, and 0.01% NaN3 was added to a solubilized mixture of either POPC/sodium cholate or
POPC-POPG (3:2 molar ratio)/sodium cholate, and the final molar ratio was adjusted to 1:78:200
(MSP1D1: phospholipid: sodium cholate). The mixture was incubated for 1 h over ice, and
cholate detergent was removed during a gentle 10-h rotation with SM-2 bio beads at 4 °C.
Nanodiscs were purified by size-exclusion chromatography with an Amersham-Pharmacia
ÄKTA FPLC Protein Purifier System (GE Healthcare Life Sciences, Pittsburgh, PA) on a
Superdex 200 10/300 column eluted with 20 mM Tris-HCl, pH 7.4, containing 100 mM NaCl
and 0.5 mM EDTA at 0.5 mL/min. Column eluate absorbance was monitored at 280 nm, and
SDS-PAGE was used to evaluate the purity of the nanodisc-containing fractions. FPLC fractions
containing purified nanodiscs were collected and concentrated for experimental use. Nanodisc
concentration was calculated form the absorbance at 280 nm and the MS1D1 molar extinction
coefficient, accounting for 2 MSP1D1 molecules per disc.
FPLC analysis of nanodiscs incubated with hMGL
Purified, detergent-free hMGL was incubated with purified nanodiscs for 30 min at room
temperature at an hMGL:nanodisc molar ratio of 1:2. Samples of hMGL alone and the hMGL-
nanodisc co-incubation were analyzed by FPLC as detailed above for nanodiscs.
![Page 63: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/63.jpg)
44
Determination of hMGL kinetic properties
hMGL kinetic constants were determined by measuring the hydrolysis of either natural
substrate (2-AG) or fluorogenic reporter substrate (AHMMCE) with methods adapted from our
prior work.36 In brief, 2-AG at varying concentrations (10 to 400 μM) was incubated at 37 °C
with either 2.9 nM hMGL alone or 2.9 nM hMGL with nanodiscs at an MGL:nanodisc molar
ratio of 1:2 in TME buffer (25 mM Tris base, 5 mM MgCl2, and 1 mM EDTA, pH 7.4) in a total
reaction volume of 300 μL. Reaction samples (50 μL) were taken immediately at the start of the
incubation and after 4 min, diluted 1:2 by volume with acetonitrile, and centrifuged at 20,000 x g
for 5 min at 4°C. A 20-μL aliquot of each supernatant was subjected to reverse-phase HPLC on
an Agilent Zorbax XDB-C18 column (4.6 mm x 150 mm, 3.5 µm) (Agilent Technologies, Santa
Clara, CA). Mobile phase A was 100% acetonitrile, and mobile phase B consisted of 8.5%
aqueous phosphoric acid/acetonitrile (60:40, v/v) with the following gradient at a flow rate of 1
mL/min: 100% mobile phase B for 2 min, 5% mobile phase B for 5 min, 100% mobile phase B
for 1 min followed by a 5-min injection delay. In an 8-min run, 2-AG was eluted at 4.2 min, and
arachidonic acid at 5.0 min, allowing the reaction to be followed by either substrate utilization or
product formation.
A fluorogenic hMGL assay based upon the conversion of AHMMCE reporter substrate to
coumarin fluorophore was conducted as described.74 Reaction samples at room temperature
included various concentrations of AHMMCE incubated with either 2.9 nM hMGL alone, 2.9
nM hMGL with 0.05 mM Triton X-100, or 2.9 nM hMGL with 5.8 nM nanodiscs in 50 mM
Tris-HCl buffer, pH 7.4, at a reaction volume of 200 μL. Fluorescence readings at 360 nm/460
nm (λexcitation/ λemission) were taken every 15 min for up to 2 h, and relative fluorescence units were
converted to the amount of coumarin fluorophore formed based upon a coumarin standard curve.
![Page 64: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/64.jpg)
45
Michaelis-Menten kinetic parameters were derived with Prism software (GraphPad, San
Diego, CA). Apparent Km and Vmax values are the means ± SD for triplicate determinations across
three independent enzyme preparations. Statistical significance of group-mean differences was
evaluated by a two-sample independent t-test, the significance level set at p ≤ 0.05.
Peptide-based HX MS analysis
Continuous labeling hydrogen-deuterium exchange experiments83 were initiated by
diluting 10-fold 12 μL of an hMGL-nanodisc mixture (5 μM hMGL and 10 μM nanodiscs) into
99% deuterium oxide buffer (50 mM Tris-HCl containing 100 mM NaCl, pH 7.6) at room
temperature. At selected times ranging from 10 sec to 4 h after the introduction of D2O, samples
of the exchange reaction were taken and immediately quenched by acidifying to pH 2.5 with
formic acid and placed on ice to limit back-exchange.84 After quenching, nanodiscs were rapidly
disassembled with the addition of ice-cold sodium cholate in a 25:1 molar ratio of sodium
cholate:nanodisc phospholipid.85 Porcine pepsin (1.2 μL of a 10 mg/mL stock solution) was
added to digest the sample during a 5-min incubation on ice. In the last minute of digestion, ZrO2
beads were added to the digestion mixture to facilitate phospholipid removal. The sample was
filtered through a prechilled, 0.45-μm cellulose acetate membrane by centrifugation at 18,000 x g
and 4 °C for 1 min at to trap both the pepsin and ZrO2 beads. The flow-through was injected
without delay into a precolumn trap (Waters VanGuard C18, 2.1 mm × 5 mm, 1.7 μm) and
desalted with 0.05% formic acid in water for 5 min. The trap was placed in-line with a second
identical pre-column directly connected to the analytical column (Waters Xbridge C18, 1.0 mm
× 100 mm, 1.7 μm). HX data were acquired on a Waters nanoAcquity UPLC with HDX
Technology. Peptides originating from hMGL pepsinolysis were identified from triplicate
analyses of undeuterated control enzyme samples using Waters ProteinLynx Global Server 2.4.
![Page 65: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/65.jpg)
46
All reported peptide-based HX MS data were derived from triplicate hMGL preparations, each
analyzed in triplicate. The error of peptide HX MS measurements was ± 0.50, as determined by
replicate analyses of peptide standard and prior HX MS data from this experimental setup.86,87
MALDI-TOF/TOF MS analysis of hMGL covalent modification by AM6580
Purified hMGL was incubated with AM6580 (molar ratio 1:5, enzyme:inhibitor) at room
temperature for 1 h, at which time the enzyme was verified by direct biochemical assay to be
inhibited (above). The incubation was terminated by desalting using a Bio-Spin 6 column and 25
mM ammonium bicarbonate buffer, pH 8.0, containing 0.05% CYMAL. The desalted enzyme
sample was digested overnight with 200 ng Trypsin Gold. Equal volumes of the trypic digest and
α-cyano-4-hydroxycinnamic acid matrix (5 mg/mL in aqueous 50% acetonitrile-0.1%
trifluoroacetic acid) (0.5 μL each) were co-crystallized. MS characterization of hMGL covalent
modification by AM6580 were acquired on a 4800 MALDI-TOF/TOF mass spectrometer
(Applied Biosystems, Framingham, MA) fitted with a 200-Hz solid-state ultraviolet laser
(wavelength 355 nm) from samples spotted on Opti-TOF 384-well plate inserts.
![Page 66: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/66.jpg)
47
Computational methods
MD simulation setup. A 128-lipid, racemic POPG bilayer neutralized with 128 Na+
counter ions and hydrated with 3527 water molecules was used as the basis of a POPC/POPG
bilayer.51 All water molecules and ions were removed. Since the experimental nanodisc
contained POPC and L-POPG in a 3:2 molar ratio, all D-POPG and 11 L-POPG lipid molecules
were replaced with POPC, and 3 L-POPG lipid molecules were removed. This resulted in a
phospholipid bilayer containing 75 POPC and 50 L-POPG lipid molecules, which was solvated
with 4270 water molecules and neutralized with 50 Na+ counter ions. The system was fully
minimized with steepest descent, and 40 ns of unrestrained MD were then performed to produce
a fully-solvated, fully-equilibrated POPC/POPG bilayer (simulation procedure below). The
potential energy reached a stable plateau after 3 ns. After 10 ns, the area of the xy plane per lipid
fluctuated around 69.7 Å2, a value within the experimental range for POPC (63.0-68.3 Å2) and
probable range for POPG (64-70 Å2).88,89 Two simulation systems were established: one with
unliganded, wild-type hMGL (PDB ID: 3JW8),47 the other with hMGL covalently carbamylated
by AM6580. The carbamylating moiety of AM6580 was docked to hMGL (PDB ID: 3JWE)47
using Glide at the XP level,90 and a covalent bond was made between this moiety and the
catalytic Ser122 (i.e., Ser129 for the 6-His-tagged hMGL). To enable MD simulation of a
covalently-bound ligand, a custom residue was defined as Ser122 carbamylated by AM6580 and
was parameterized.91
MD simulation procedure. Unmodified and AM6580-carbamylated hMGL were placed
with the enzyme’s lid domain partially embedded in the POPC/POPG bilayer, as given by the
Orientations of Proteins in Membranes database.92,93 Any lipid or water molecules clashing with
the enzyme were removed. The system was made electrically neutral and minimized with
![Page 67: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/67.jpg)
48
steepest descents to relax unfavorable intermolecular contacts. To stabilize the lipid environment
during production dynamics, equilibration MD was performed for 2 ns, with all heavy atoms in
the protein positionally restrained with a force constant of 1000 kJ mol−1 nm−2. Unconstrained
production MD was performed for 10 ns on each system. All MD simulations were performed in
the NPT (isothermal– isobaric) ensemble with periodic boundary conditions. A temperature of
300 K was maintained with time constant 0.1 ps by an extension of the Berendsen thermostat to
which a properly constructed random force was added.94 Semi-isotropic pressure coupling was
used, with the reference pressure set at 1.0 bar and time constant at 5 ps. Coulomb and short-
range neighbor list cut-offs were both set to 0.9 nm, and Lennard-Jones cut-offs were set to 1.2
nm. The electrostatic interactions were computed using the Particle-Mesh Ewald method with an
interpolation order of 4 and a maximum grid spacing of 0.12 nm.95,96 A time-step of 2 fs was
used, and pair lists were updated every 10 steps. The LINCS algorithm97 was employed to
preserve bond lengths. The simple point charge water model98 was used in all simulations. The
simulations were carried out with the GROMACS program, version 4.5.5, using the
GROMOS96 53a6 force field.88,99,100
![Page 68: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/68.jpg)
49
Tables
Table 1. Kinetic parameters for hydrolysis of AHMMCE and 2-AG by hMGL in the
presence and absence of detergent or phospholipid bilayer nanodiscs.
For AHMMCE substrate, buffer was 50 mM Tris-HCl, pH 7.4. For 2-AG substrate, TME buffer
(25 mM Tris base, 5 mM MgCl2, and 1 mM EDTA, pH 7.4) was used. Apparent Km and Vmax
values are the means ± SD for triplicate determinations across three independent enzyme
preparations. Statistical significance of group-mean differences was evaluated by a two-sample
independent t-test, the significance level set at p ≤ 0.05. n.d., not determined.
![Page 69: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/69.jpg)
50
Figures
Fig. 1. Localization of conformational changes in hMGL induced by phospholipid bilayer
nanodiscs.
a) Deuterium incorporation curves derived from hydrogen-exchange mass spectra for the hMGL
peptic peptides designated by their amino-acid residue numbers. Relative deuterium uptake (Da)
is plotted vs. time of hMGL incubation in D2O in the absence (blue lines, ) or presence (red
lines, ) of POPC/POPG bilayer nanodiscs. The maximum amount of deuterium incorporation
possible for each respective peptide is designated on the y-axis of each kinetic plot. Data were
obtained through peptide-based HX MS analysis of hMGL. The error of peptide HX MS
mesurements with this experimental setup was ± 0.50 Da as determined by replicate analysis of
peptide standards in prior HX MS work with this instrumentation. b) The hMGL peptides for
which deuterium uptake curves are presented in panel (a), above, are highlighted in the hMGL
structure representation derived from (PDB ID: 3JW8).
![Page 70: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/70.jpg)
51
Fig. 2. Localization of conformational changes in hMGL induced through active-site Ser
carbamylation by the covalent inhibitor, AM6580.
a) Deuterium incorporation curves derived from hydrogen-exchange mass spectra for the hMGL
peptic peptides designated by their amino-acid residue numbers. Relative deuterium uptake (Da)
is plotted vs. time of hMGL incubation in D2O in the presence of POPC/POPG phospholipid
bilayer nanodiscs without (red lines, ) or with (green lines, ) AM6580. The maximum
amount of deuterium incorporation possible for each respective peptide is designated on the y-
axis of each kinetic plot. Data were obtained through peptide-based HX MS analysis of hMGL.
The error of peptide HX MS mesurements with this experimental setup was ± 0.50 Da as
determined by replicate analysis of peptide standards in prior HX MS work with this
instrumentation.49,50 b) Structure of AM6580. c) Schematic depicting the docking of the
AM6580-derived fluorenyl piprazine group covalently attached to hMGL active-site Ser122 (i.e.,
Ser129 for the 6-His-tagged hMGL) in a portion of the hMGL structure representation derived
from (PDB ID: 3JW8). Helix-α6 peptide 217-223 (orange) is shielded by the carbamylating
group modification at Ser122.
![Page 71: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/71.jpg)
52
Fig. 3. MD simulation of hMGL interaction with membrane phospholipid bilayer.
Snapshots of hMGL (structure derived from PDB ID: 3JW8) with a phospholipid bilayer
membrane of the same composition as in the experimental nanodiscs (POPC: POPG, 3:2 molar
ratio) after 10 sec of MD simulation. The enzyme is depicted: a) unliganded as apo-hMGL and
b) occupied with carbamylating inhibitor, AM6580, in the active site. Helix α4 in the lid domain
and helix α6 in the vicinity of the active site are depicted in red, and AM6580 is shown in green.
![Page 72: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/72.jpg)
53
Fig. 4. Cartoon superposition of the X-ray structure of hMGL (cyan, PDB ID: 3JW8) and
the model of hMGL obtained after 10 ns of MD simulation at a water/phospholipid
interface (gray).
The structures are virtually identical, except for helices α4 and α6 and the loop region from
amino-acid residues 177 to 192 connecting helices α4 and α5. The movements of helices α4 and
α6 induced by a phospholipid bilayer (POPC:POPG, 3:2 molar ratio) are indicated by red arrows.
a) side view of hMGL; b) top view of hMGL rotated 90° from the orientation in panel a, as
indicated. The active-site Ser122 (i.e., Ser129 for the 6-His-tagged hMGL) is depicted in orange.
![Page 73: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/73.jpg)
54
Supplemental Material
Supplemental Tables
Table S1. Peptic peptides common to hMGL in the absence or presence of nanodiscs.
Peptides were identified by ESI-MS/MS and are shown with their respective sequence number,
length, amino-acid sequence, z, m/z, and maximum possible deuterium incorporation.
Start End Length Peptide Sequence z m/z Max Deuterium
Incorporation
18 25 8 PQSIPYQD 2 474.24 6
38 52 15 FCRYWKPTGTPKALI 3 594.32 12
40 53 14 RYWKPTGTPKALIF 3 559.98 11
54 68 15 VSHGAGEHSGRYEEL 3 543.25 14
74 87 14 GLDLLVFAHDHVGH 2 765.39 13
78 95 18 LVFAHDHVGHGQSEGERM 3 669.32 17
101 125 25 HVFVRDVLQHVDSMQKDYPGLPVFL 4 735.63 22
126 137 12 LGHSMGGAIAIL 2 570.31 11
138 148 11 TAAERPGHFAG 2 557.27 9
138 149 12 TAAERPGHFAGM 2 623.35 10
138 151 14 TAAERPGHFAGMVL 2 728.87 12
150 157 8 VLISPLVL 1 835.53 6
158 166 9 ANPESATTF 1 937.42 7
166 178 13 FKVLAAKVLNLVL 2 714.47 12
167 178 12 KVLAAKVLNLVL 2 631.93 11
182 191 10 SLGPIDSSVL 1 987.53 8
217 223 7 GIQLLNA 1 728.43 6
224 239 16 VSRVERALPKLTVPFL 3 609.04 13
224 241 18 VSRVERALPKLTVPFLLL 3 684.42 15
242 256 15 QGSADRLCDSKGAYL 3 528.58 14
261 275 15 AKSQDKTLKIYEGAY 3 572.30 14
![Page 74: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/74.jpg)
55
Supplementary Figures
Fig. S1. Analysis of hMGL
(green line), POPC/POPG phospholipid bilayer nanodiscs (red line), and hMGL-nanodisc
mixture (black line) by a) size-exclusion fast protein liquid chromatography and b) SDS-PAGE.
The calibration scale for the size-exclusion column is shown and was derived from proteins of
known Stokes diameter: thyroglobulin (bovine thyroid) (17 nm), ferritin (horse spleen) (12.2
nm), catalase (bovine liver) (10.4 nm), albumin (bovine serum) (7.1 nm).
![Page 75: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/75.jpg)
56
Fig. S2. Demonstration that AM6580 covalently inhibits hMGL by carbamylation of the
enzyme’s Ser129 nucleophile.
a) MALDI-TOF/TOF MS mapping of a tryptic digest of purified recombinant hMGL. b) Tryptic
hMGL peptide that contains the hMGL nucleophile Ser129. c) New hMGL tryptic peptide after
incubation with AM6580, showing a mass increase of 277 Da. d) Illustration of the
carbamylation reaction between hMGL Ser129 of hMGL and AM6580.
![Page 76: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/76.jpg)
57
Chapter 3
Expression and Purification of Full-length rFAAH and Subsequent Incorporation
within the Nanodisc Model
![Page 77: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/77.jpg)
58
Introduction
Serine hydrolases such as fatty acid amide hydrolase (FAAH) comprise the largest, and --
structurally and functionally -- most diverse class of enzymes within the human proteome.101
These enzymes actuate the catabolism of amide, ester, and thioester bonds in biosignaling
molecules, proteins, and xenobiotics. This process is mechanistically dependent upon a catalytic
triad, Ser241, Ser217, and Lys142, for FAAH (PDB: 1MT5)20 and proceeds through the formation of
a covalent, acyl-enzyme complex intermediate that is subsequently hydrolyzed by a
water/hydroxide-induced saponification process that regenerates the catalytic serine. FAAH is
the only characterized mammalian amidase in the serine hydrolase family of enzymes,102 and it is
extremely hydrophobic. FAAH has three domains that interact with biological membranes, the
NH2-terminal transmembrane domain (residues 9-29), the α18 domain (residues 410-426), and
the α19 “lid” domain (residues 429-438).20 Despite the wealth of structural, chemical, and
biochemical information available for this enzyme, the only molecular dynamic studies to date
for this enzyme have been in silico simulations (most recently reviewed by Palermo et al.).102
Due to the unique nature of this enzyme’s structure, with a comprehensive molecular dynamic
analysis in a biological membrane, it should be possible to design inhibitors with exceptional
selectivity for FAAH. Such inhibitors could target either the orthosteric, cytoplasmic channel
and/or the hydrophobic enzyme-acyl chain pocket through the membrane in a manner consistent
with the mechanism by which FAAH accesses its primary substrate, anandamide (AEA).20
FAAH rapidly degrades AEA, forming arachidonic acid (AA) and ethanolamine (EA).103
AEA is a partial-to-full agonist at CB1 (assay-dependent) and a weak partial agonist at CB2.104 It
is synthesized from N-arachidonoyl phosphatidyl-ethanolamine (NAPE) when dephosphorylated
by phospholipase-D.105 NAPE is synthesized from dietary lecithin and phosphatidyl-
![Page 78: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/78.jpg)
59
ethanolamine (PE) via enzymatic n-acyltransferase activity whereby AA is bioconjugated to
PE.106 Inhibition of FAAH leads to increased levels of AEA, which has been shown to be
therapeutic for treating pain and inflammation.107-109 Increased expression levels of FAAH have
also been found in breast,110 prostate,111,112 and lung carcinomas,113 as well as in lymphocytic
leukemia,114 making FAAH inhibition an essential target for therapeutic development.
Presented here is the expression and purification of full-length rFAAH. Traditional
purification schemes did not yield pure protein due to the hydrophobic nature of FAAH and the
significant portion of histidine-rich proteins present in the raw E. coli lysate. These factors lead
to either insufficient binding to the IMAC resin in the presence of imidazole or an abundance of
nonspecific protein binding. To circumvent these limitations, a fractionation-purification
protocol was used to remove soluble and insoluble proteins (leaving only solubilized membrane
proteins or “membrane fraction”) before purification. This membrane fraction was used to purify
rFAAH for expression in the nanodisc model and in parallel, to generate a solubilized membrane
protein library (SMPL).115 ND-rFAAH was also purified from the SMPL, although this method
had a low yield. This represents the first time FAAH has been incorporated into the ND system.
Protein dynamics for purified rFAAH and ND-rFAAH were then studied using hydrogen-
deuterium exchange mass spectrometry (HX MS). Peptide-level HX MS examines solvent
accessibility over time by measuring changes in peptide mass after exposure to D2O, which will
exchange deuterium with the hydrogen atoms on the “backbone” amide nitrogens of proteins.69
This study represents the first, non-simulated, molecular dynamic study for FAAH both in
solution and in an intact membrane.
![Page 79: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/79.jpg)
60
Results and Discussion
Purification of full length rFAAH
The E. coli sonicate showed activity in the fluorescence assay116 comparable to that seen
in a control lysate, and no activity was lost during membrane solubilization (Fig. 1). The pelleted
insoluble fraction retained some ability to breakdown the substrate (greater than the blank), but
significantly less than the solubilized membrane fraction (Fig. 1 blue). These results suggest that
rFAAH completely partitions into the membrane fraction and can be solubilized using n-
dodecyl-beta-D-maltoside (DDM) (1 %) in aqueous buffer. This solubilized membrane fraction
was used to purify C-terminal 6-his tagged full-length rFAAH by IMAC. SDS-PAGE analysis of
the purification showed that despite a high-capacity resin, only a small portion of the rFAAH
bound to the resin (Fig. 2). However, little loss was observed when washing the resin either with
buffer B (20 mM Na2PO4 pH = 7.8 with 500 mM NaCl and 1% DDM), or buffer B that
contained 50 mM imidazole (IMA) (Fig. 2). To isolate pure rFAAH, FPLC-SEC was used (Fig.
3a). Fractions 7 through 17 (mL) were analyzed by SDS-PAGE, and fraction 10 appeared to
have the highest purity (Fig. 3b). This fraction was tested for activity using the fluorogenic
substrate assay at increasing sample concentrations. This fraction showed activity which
increased in a concentration dependent manor (Fig. 3c). Unfortunately, the activity level
measured here was low as compared to the sonicate and membrane fraction. This decrease was
attributable to significant dilution and not a loss in protein abundance or intrinsic activity,
although some protein was undoubtedly lost in the SEC column. This small-scale experiment
demonstrated a superior method for purifying full length rFAAH for incorporation into the ND
model.
![Page 80: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/80.jpg)
61
rFAAH incorporation into the nanodisc biological membrane model
To express full-length rFAAH in the ND model, two methods were used: an adapted
version of the SMPL technique,115 and in parallel, the Sligar et al.25 method of combined self-
assembly. Using the Sligar technique, purified rFAAH was incubated with MSP1D1, POPC and
POPG, and disc self-assembly was catalyzed by detergent removal with hydrophobic-adsorbent
beads. FPLC-SEC was used to isolate the ND-rFAAH population, and a clear peak was visible at
~12 mL (Fig. 4a). Coomassie stained SDS-PAGE analysis of the pooled fractions 9 through 13
(mL) inclusive showed clear bands for MSP1D1 and rFAAH (Fig. 5) indicating the formation of
ND-rFAAH.
In the SMPL technique, MSP1D1 was added to the membrane fraction with POPC and
POPG, to augment the native lipid population, and detergent removal beads were used to
catalyze ND formation. FPLC-SEC was used to separate the population of unincorporated
proteins and aggregates from the SMPL, and a clear ND peak population was observed between
fractions 9 and 13 (mL) inclusive (Fig. 4b). Coomassie stained SDS-PAGE analysis of the
pooled fractions 9 through 13 (mL) inclusive showed clear bands for MSP1D1 and rFAAH as
well as several other bands (Fig. 5) indicating the formation of ND-rFAAH and the SMPL.
Either technique would be viable for ND-rFAAH preparation, but in this experiment,
purifying rFAAH from the detergent-solubilized membrane fraction before Sligar synthesis gave
a higher yield, and a more pure population of ND-rFAAH (data not shown). When the additional
step of removing the 6-his tag from MSP1D1 that is necessary for purifying ND-rFAAH from
the SMPL is considered, the data suggest that the traditional method should be used to prepare
ND-rFAAH in the future.
![Page 81: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/81.jpg)
62
In-solution dynamics of rFAAH
Peptide-level HX MS was used to measure the dynamics for rFAAH in solution over a 4-
hour time period. No deuterium uptake was measured in the peptic peptide (residues 10 – 23
LSGVSGVCLACSLL) from the transmembrane (TM) domain (residues 9 – 29,
TLSGVSGVCLACSLLSAAVVL) or in the active site peptic peptides (residues 138 – 148,
PVSLKECFSYK, 208 – 230, WKSSKSPGGSSGGEGALIGSGGS, and 227 – 242
SGGSPLGLGTDIGGSI) (Fig. 6, Fig. 7). This indicates that the TM domain is shielded from the
solvent when FAAH is in solution. This could be due to interaction between the protein and
detergent micelles, or through dimerization in solution. Unfortunately, the proposed dimerization
sites (residues 299 – 314, CEHLFTLDPTVPPSSL and Trp445) were not covered by our peptic
digest (Fig. 6, Fig S2). Similarly, the membrane binding domain α18 (residues 410 – 426,
LPSWFKRLLSLPSWFKRLLSL) and the lid domain α19 (residues 429 – 438, LAAFLNSMRP)
were also not covered (Fig. 6, Fig S2).
![Page 82: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/82.jpg)
63
Conclusions
In this study, catalytically active full length rFAAH was successfully expressed, purified,
and incorporated into NDs. This represents the first experiment where a mammalian amidase,
serine hydrolase was studied using this model. A fractionation purification protocol was
necessary to first separate the solubilizable membrane proteins from other proteins in the E. coli
lysate. Following this critical step, direct IMAC purification was achieved, as well as formation
of a SMPL. From the SMPL, ND-rFAAH was successfully isolated. Additionally, traditional
methods were employed to isolate ND-rFAAH. These protocols for isolating the membrane-
protein pool, and for disc formation, are generalizable to other hydrophobic mammalian
recombinant proteins expressed in E. coli. For the purification of rFAAH, the FPLC-SEC
purification step, while giving some information on the oligomeric state of rFAAH in solution,
should not be necessary to isolate protein of acceptable purity for ND formation in the future.
Preliminary analysis of the in-solution protein dynamics for rFAAH reviled areas of high
exchange, and zero to low exchange over the four hour time period used. Notably, the lack of
exchange in the active site domain, and the transmembrane domain support previous findings
that these hydrophobic regions interact directly with the membrane, and are not accessible to the
cytosol.20 The shielding from exchange in the TM domain in particular suggests that in solution
rFAAH may exist as a dimer imbedded within detergent micelles. This makes rFAAH an
excellent target for analysis in the ND membrane model, which is compatible with peptide-level
HX MS analysis.
![Page 83: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/83.jpg)
64
Materials and Methods
Materials
SDS-PAGE supplies, SM-2 biobeads, and Bio Spin columns were purchased from Bio-
Rad (Hercules, CA). Culture media, standard laboratory chemicals, and buffers were purchased
from Fisher Chemical (Pittsburgh, PA) and Sigma Chemical Co. (St. Louis, MO). The plasmid
expressing MSP1D1 was purchased from Add Gene (Cambridge, MA). POPC and POPG were
purchased from Avanti Polar Lipids (Alabaster, AL) as stock solutions in chloroform. 1,2-
Deuterium oxide (>99%) was purchased from Cambridge Isotope Laboratories (Andover, MA).
Methods
Expression and Purification of rFAAH
Full length rFAAH was purified from E. coli (BL21-CodonPlus (DE3)-RIPL) that was
transformed with the pTrcHis2-TOPO vector containing full length, wild type rFAAH. A 1L cell
pellet (~4-5 g) was suspend in 40 mL of Buffer A (20 mM Na2PO4, 100 mM NaCl, pH = 7.8)
and rotated for 15 min. Cells were lysed cells by probe sonication (55 sec pulse, on 1 sec, off 5
sec), spun at 5,000 x g for 20 min, and the pellet was discarded. The supernatant was centrifuged
at 100,000 x g for 1hr and the supernatant was discarded. The cell pellet was suspended in buffer
A (40 mL) and spun at 100,000 x g for 1hr. This wash step was then repeated 2 more times. The
resulting cell pellet was suspended in 40 mL of Buffer B (20 mM Na2PO4, 500 mM NaCl, 1%
DDM, pH = 7.8) and spun at 100,000 x g for 1hr. The supernatant (“membrane fraction”) was
added to 1.0 mL (bed volume) of His60 Ni Superflow™ resin (Clonetech) pre-equilibrated with
buffer B and mixed at 4°C for 1 hr. The suspension was transferred to a gravity-flow column and
the resin was washed with 10 mL of Buffer B, then 10 mL of Buffer B with 20 mM imidazole,
followed by 10 mL of Buffer B with 50 mM imidazole. rFAAH was eluted with 5 to 6 mL of
![Page 84: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/84.jpg)
65
Buffer B with 200 mM imidazole. Size exclusion chromatography was performed as described
above using a Superdex 200 10/300 GL column and Gel Filtration Buffer (10 mM Tris/HCl, 150
mM NaCl, 0.015% LDAO, pH = 8.0). Purified rFAAH samples were stored at -80°C in Gel
Filtration Buffer with 10% Glycerol.
Assay of rFAAH activity using AAMCA
A fluorometric assay was used to evaluate the catalytic activity of rFAAH. This was
monitored by the hydrolysis of the fluorogenic substrate: N-arachidonoyl,7-amino-4-
methylcoumarin amide (AAMCA) to form the fluorescent product 7-amino-4-methylcoumarin
(AMC). DMSO (10 µL), rFAAH samples, and AAMCA (final concentration 20 μM) were added
to a total volume of 200 μL in assay buffer (50 mM Tris-HCl, pH 9.0) in a 96-well plate. The
reaction was allowed to proceed for 10 hr at 25°C. Fluorescence readings were taken every 15
minutes at 360 nm/460 nm (λexcitation/λemission) on a BioTek Synergy HT Microplate Reader
(BioTek Instruments, Winooski, VT).
Solubilized membrane protein library (SMPL) method for rFAAH nanodisc incorporation
Purified MSP1D1 in ND buffer (20 mM Tris/HCl, pH 7.4, containing 100 mM NaCl, and
0.01% NaN3) was added to a the rFAAH membrane fraction described above. A solubilized
mixture of POPC-POPG (3:2 molar ratio)/sodium cholate was also added, and the final molar
ratio was adjusted to 1:0.5:5.5:2.3:20 (MSP1D1:total membrane protein:phospholipid:native
lipid:sodium cholate). The mixture was incubated for 1 h on ice, and cholate detergent was
removed during a gentle 10 hr rotation with SM-2 biobeads at 4°C. This self-assembly mixture
was added to a 1.0 mL (bed volume) of His60 Ni Superflow™ resin (Clonetech) pre-equilibrated
with ND buffer and mixed at 4°C for 1 hr. The suspension was transferred to a gravity-flow
column and the resin was washed with 10 mL of ND buffer, then 10 mL of ND buffer with 20
![Page 85: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/85.jpg)
66
mM imidazole, then 10 mL of ND buffer with 50 mM imidazole. ND-rFAAH was then eluted
with 5 to 6 mL of ND buffer with 200 mM imidazole. Size exclusion chromatography was
performed as described above, using a Superdex 200 10/300 GL column in ND buffer with 0.5
mM EDTA.
Coself-assembly of purified rFAAH
Purified MSP1D1 in ND buffer nd rFAAH in buffer B was added to a solubilized mixture
of POPC-POPG (3:2 molar ratio)/sodium cholate, and the final molar ratio was adjusted to
1:0.5:75:200 (MSP1D1:phospholipid:sodium cholate). The mixture was incubated for 1 h on ice,
and cholate detergent was removed during a gentle 10 hr rotation with SM-2 biobeads at 4°C.
Nanodiscs were purified by size-exclusion chromatography with an Amersham-Pharmacia €A
KTA FPLC Protein Purifier System (GE Healthcare Life Sciences, Pittsburgh, PA) on a
Superdex 200 10/300 column eluted with 20 mM Tris–HCl, pH 7.4, containing 100 mM NaCl at
0.5 mL/min. Column eluate absorbance was monitored at 280 nm, and SDS-PAGE was used to
evaluate the purity of the nanodisc-containing fractions.
Peptide-level HX MS analysis
Continuous labeling hydrogen-deuterium exchange experiments were initiated by diluting
10-fold 12 µL of a rFAAH–nanodisc mixture (5 µM rFAAH and 10 µM nanodiscs) into 99%
D2O buffer (50 mM Tris/HCl containing 100 mM NaCl, pH 7.6) at room temperature. At
selected times ranging from 10 s to 4 h after the introduction of D2O, samples of the exchange
reaction were taken and immediately quenched by acidifying to pH 2.5 with formic acid on ice to
limit back exchange, and nanodiscs were rapidly disassembled with the addition of ice-cold
sodium cholate in a 25:1 molar ratio of sodium cholate to nanodisc phospholipid. Porcine pepsin
(1.2 µL of a 10 mg/mL stock solution) was added to digest the sample during a 5 min incubation
![Page 86: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/86.jpg)
67
on ice. In the last minute of digestion, ZrO2 beads were added to the digestion mixture to
facilitate phospholipid removal. The sample was filtered through a prechilled, 0.45 µm cellulose
acetate membrane by centrifugation at 18,000 x g and 4°C for 1 min to trap both the pepsin and
ZrO2 beads. The flow through was injected without delay into a precolumn trap (Waters
VanGuard C18, 2.1 mm 3 5 mm, 1.7 µm) and desalted with 0.05% formic acid in water for 5
min. The trap was placed in line with a second identical precolumn directly connected to the
analytical column (Waters BEH C18, 1.0 mm 3 100 mm, 1.7 lm). HX data were acquired on a
Waters nanoAcquity UPLC with HDX Technology. Peptides originating from rFAAH
pepsinolysis were identified from triplicate analyses of undeuterated control enzyme samples,
with use of Waters Protein-Lynx Global Server 2.4.
![Page 87: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/87.jpg)
68
Figures
Fig. 1. rFAAH membrane fraction activity tracking using the fluorogenic substrate
AAMCA.
Relative fluorescent units vs. time for: in black circles, autohydrolysis of the fluorogenic
substrate. In blue, the insoluble portion of the membrane fraction. In green, the solubilized
membrane fraction. In black triangles, the sonicate without cellular debris. In red, control WT
rFAAH lysate (~6 mg/mL total protein) isolated from rat brain homogenate (n=6).
![Page 88: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/88.jpg)
69
Fig. 2. Coomassie stained SDS-PAGE analysis of rFAAH purification from solubilized
membrane fraction.
4 µL of prestained SDS-PAGE standards #161-0373 ladder were run between lanes 2 and 3.
Lane 1: membrane fraction before IMAC. Lane 2: membrane fraction after IMAC. Lane 3:
unbound fraction. Lane 4: Wash with buffer B. Lane 5: wash with buffer B containing 50 mM
imidazole. Lane 6: purified rFAAH. Lane 7: IMAC resin. rFAAH was successfully purified from
the membrane fraction and no irreversible binding to the Ni++ IMAC resin was observed.
![Page 89: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/89.jpg)
70
Fig. 3. FPLC-SEC separation for purified rFAAH.
a) FPLC-SEC chromatogram for purified rFAAH. b) Coomassie stained SDS-PAGE for
fractions 7 through 17. c) Activity analysis for varying volumes (µL) of fraction 10 using the
fluorogenic substrate AAMCA.
![Page 90: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/90.jpg)
71
Fig. 4. FPLC-SEC separation for purified ND-rFAAH.
a) Chromatogram for ND-rFAAH isolated using the Sligar method. b) Chromatogram for SMPL
separation.
![Page 91: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/91.jpg)
72
Fig. 5. Coomassie stained SDS-PAGE for ND-rFAAH.
Lane 1: “L” 4 µL of prestained SDS-PAGE standards #161-0373 ladder. Lane 2: “P” ND-
rFAAH isolated using the Sligar method. Lane 3: “DS” SMPL including ND-rFAAH
![Page 92: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/92.jpg)
73
Fig. 6. Uptake plots for rFAAH in solution.
From left to right are the peptic peptides, Top: 10-23, 62-69, 75-82, 83-97, 98-104, Middle: 138-148, 182-195, 186-212, 208-230,
227-242, Bottom: 277-290, 380-407, 454-461, 508-523, 552-562
![Page 93: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/93.jpg)
74
Fig. 7. In-solution dynamics for rFAAH (PDB: 1mt5)20.
Residues 10 – 23 in the TM domain are indicated in black. These showed no exchange over 4
hours indicating that this hydrophobic domain is shielded from the solvent, perhaps through
dimerization. The protein is oriented in a top-down view, such that the membrane bilayer would
be parallel with the page, under/behind the protein as represented. The blue arrows indicate
residues 229 – 314, the suspected oligomerization domain.
![Page 94: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/94.jpg)
75
Supplementary Data
Coverage of peptic peptides for rFAAH and MSP1D1 nanodiscs
Peptic peptide coverage for MSP1D1 in samples of ND-rFAAH was 93.7% (Fig. S1).
Coverage of the peptic peptides for undeuterated control samples of rFAAH in solution was
77.9% (data not shown), but only 52.1% coverage was achieved for the deuterium exchange
rFAAH in solution sample (Fig. S2). Coverage of the peptic peptides for rFAAH in ND-rFAAH,
was only 27.4% (data not shown). Digestion conditions need to be optimized in order to get
greater coverage for rFAAH, both in solution, and in the ND system. Additionally, IMAC
purification of ND-rFAAH using untagged MSP1D1 may lead to detecting a greater percent
coverage for this protein since it would decrease the relative signal intensity coming from
MSP1D1.
![Page 95: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/95.jpg)
76
Supplementary Figures
Fig. S1. Coverage map for MSP1D1 in ND-rFAAH samples.
![Page 96: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/96.jpg)
77
Fig. S2. Coverage map for rFAAH in solution.
![Page 97: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/97.jpg)
78
Acknowledgements
Michael Johnsona, Brent Kocherta,b, Thomas Walesb, John R. Engenb, Mark K. Williamsa ,
David Janeroa, Alexandros Makriyannis*,a,c
a Center for Drug Discovery, Department of Pharmaceutical Sciences, Northeastern University,
116 Mugar Life Sciences Building, 360 Huntington Avenue, Boston, MA, 02115 USA.
b Department of Chemistry and Chemical Biology and Barnett Institute of Chemical and
Biological Analysis, Northeastern University, Boston, MA, 02115, USA.
c MAK Scientific LLC, 801 Albany Street Suite 107/108, Boston, MA, 02119, USA
* To whom correspondence should be addressed
Tel.: +1-617-373-4200; fax: +1-617-373-7493; e-mail: [email protected]
![Page 98: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/98.jpg)
79
Chapter 4
Mechanistic Analysis of Human Monoacylglycerol Lipase Inhibition by the
Sulfonyl Fluoride-based Inhibitor AM3506
![Page 99: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/99.jpg)
80
Introduction
The endocannabinoid system comprises receptor proteins (CB1 and CB2), signaling
lipids (endocannabinoids -- ECBs), catabolic and anabolic enzymes, transport proteins, and
allosteric receptor modulators. The CB1 receptor is the most abundant G-protein coupled
receptor (GPCR) in the central nervous system (CNS)117. CB1 is also found, albeit at lower
concentrations, in various peripheral tissues. The CB2 receptor is expressed primarily in cells of
the immune system, but is also present in the brain, liver, pancreas, and bone118. The two
receptors have relatively low sequence homology (about 44% overall -- 68% in the
transmembrane “TM” domain119), and receptor-selective agonists and antagonists have been
developed. Both CB1 and CB2 primarily signal through the Gαi/o pathway (inhibiting adenylate
cyclase),120 but signaling also occurs via mitogen-activated protein (MAP) kinase121, and β-
arrestin122, as well as Gβγ regulation of calcium and potassium flux123. Cannabinoid signaling is
retrograde in nature. Signaling compounds are synthesized “on-demand” in the postsynaptic
neuron, and then signal at presynaptic neurons, thus decreasing neurotransmission from the
presynaptic neuron onto the postsynaptic cell (feedback)124. CB receptors also demonstrate
biased agonism (a.k.a. functional selectivity), a ligand-dependent selectivity for specific signal
transduction pathways125, possibly due to various ligand-bound structural conformations, homo
and hetro-multimeric state of the receptor, allosterism, and/or test system-dependent effects. This
makes the regulation of the cannabinoid system both complex and fascinating through the
perspective of investigating structure-function relationships.
The endocannabinoid metabolome consists of eicosanoid lipids (oxidized 20-carbon fatty
acids) in their acid (e.g. arachidonic acid “AA”), ethanolamide (e.g. arachidonoyl ethanolamide -
- anandamide “AEA”), monoacyl-glycerol derivatized (e.g. 2-arachidonoyl glycerol “2-AG”),
![Page 100: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/100.jpg)
81
ether (e.g. arachidonoyl glycerol-ether), amino acid conjugated (e.g. arachidonoyl-serine), or
hormone-conjugated (e.g. arachidonoyl-dopamine) form. AEA and 2-AG are the primary
signaling ligands. AEA is a partial-to-full agonist at CB1 (assay-dependent), and a weak partial
agonist at CB2104; it is synthesized from phospholipase-D cleavage of N-arachidonoyl
phosphatidyl-ethanolamine (NAPE)105. NAPE is synthesized from dietary lecithin and
phosphatidyl-ethanolamine (PE), via enzymatic “N-acyltransferase” activity, by conjugating AA
to PE. AEA is degraded rapidly by fatty acid amide hydrolase (FAAH) forming AA and
ethanolamine126. 2-AG is a full agonist at both CB1 and CB2 receptors127,128, and is synthesized
from diacylglycerol (DAG) by DAG lipase (DAGL), which is located in the postsynaptic
membrane117; 2-AG is catabolized (inactivated) by MGL to form AA and glycerol.
The endocannabinoid system plays a major role in regulating several disease states,
including: cancer, stroke, Multiple Sclerosis, Parkinson’s, Huntington’s and Alzheimer’s
diseases, amyotrophic lateral sclerosis, epilepsy, schizophrenia, anxiety/depression, insomnia,
nausea, drug and alcohol addiction, cardiovascular disease, glaucoma, gastrointestinal/liver
disease, arthritis, and osteoporosis117 to name a few. Regulation of the ECB system directly
inhibits the growth, migration, and invasion of cancer cells2. These anti-proliferative and anti-
metastatic effects make the cannabinoid system an ideal target for drug discovery efforts.
Various cannabinoids, including cannabidiol, AEA, 2-AG, and ECB transport inhibitors, also
induce apoptotic cell death129. Elevated ECB levels due to MGL and/or FAAH inhibition have
marked anti-nociceptive, anti-allodynic, and anti-inflammatory effects as well11. MGL inhibition
specifically limits AA proinflammatory and tumorigenic eicosanoid signaling15. As such, MGL
inhibitors have a lot of promise for the treatment of inflammatory disorders, and cancer.
![Page 101: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/101.jpg)
82
Serine hydrolases such as MGL and FAAH comprise the largest, and structurally, and
functionally most diverse class of enzymes within the human proteome. These enzymes actuate
the catabolism of amide, ester, and thioester bonds in biosignaling molecules, proteins, and
xenobiotics. This process is mechanistically dependent upon a catalytic triad (Ser122, His269, and
Asp239 for MGL, Ser241, Ser217, and Lys142 for FAAH50) and proceeds through the formation of a
covalent, acyl-enzyme complex intermediate that is subsequently hydrolyzed by a
water/hydroxide-induced saponification process that regenerates the catalytic serine. MGL, like
other characterized metabolic serine hydrolases, such as acetylcholinesterase (AChE) has the
classic α/β-hydrolase fold and the GXSXG consensus motif3. MGL hydrolyses various fatty acid
glycerol’s, including 2-AG (the primary signaling lipid of the endocannabinoid metabolome) and
regulates a fatty acid network, that can promote cancer cell growth, migration, and invasion.
MGL inhibition has been observed in the presence of hexadecylsulphonyl fluoride
(AM374) and phenylmethylsulphonyl fluoride (PMSF)130. Brain Serine Hydrolase activity, as
measured by competitive activity based protein profiling (ABPP), also demonstrates that MGL,
α-β Hydrolase Domain Containing Enzyme 6 (ABHD6), and FAAH, are completely inhibited by
5-(4-hydroxyphenyl) pentanesulfonyl fluoride (AM3506)131. Direct investigation of serine
residues in sulfonylated-enzymes is a challenge, since the sulfonyl group can be rapidly
eliminated in the form of a sulfonate anion132. Use of Matrix Assisted Laser Desorption
Ionization, Time of Flight, Tandem Mass Spectrometry (MALDI-TOF MS/MS) is valuable for
examining the mechanism of inhibition of these enzymes by sulphonyl fluorides. In the present
study, we characterized AM3506-inhibited serine hydrolases using a comprehensive mass
spectrometric analysis.
![Page 102: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/102.jpg)
83
Results
Covalent inhibition of hMGL, H121S hMGL, and rFAAH by AM3506
AM3506 reacts stoichiometrically with hMGL to generate an inactive, monosulfonyl
enzyme product. Using sensitive, fluorescence-based assays, AM3506 inhibits hMGL in the
nanomolar range with an IC50 of 236 nM (Fig. 1). Maximal hMGL, H121S hMGL (data not
shown), ΔTM-rFAAH, and MBP-hFAAH inhibition by AM3506, at a fixed substrate
concentration of 20 µM AHMMCE or AAMCA, is obtained at a compound to enzyme molar
ratio of 10:1.
Intact mass analysis of hMGL inhibited by AM3506
Following the determination that AM3506 inhibits hMGL, LC-TOF mass spectrometry
was used to confirm the attachment of the covalent ligand to hMGL. The spectrum of inhibitor-
free sample shows two prominent peaks with average masses of 34,123.6 Da (calculated
34,123.2 Da) and 34,179.4 (+56 Da addition that represents hMGL with one divalent cation
equivalent, from the affinity resin in purification) (Fig. 2a). The average intact mass of AM3506-
treated hMGL is 225.2 Da greater than that of the unmodified enzyme, a result consistent with
enzyme sulfonylation by AM3506 and the consequent calculated mass increase of 226.2 Da (Fig.
2b). These data suggest that AM3506 interacts stoichiometrically with hMGL, producing the
monosulfonyl enzyme. Samples of hMGL incubated with AM3506 at pH 12.0 show a new peak
with an average mass of 34,161.4 Da (Fig. 2c). This new peak is 18 Da less massive than the
expected 34,179.4 Da peak. This modification is characteristic of a β-elimination reaction
following the sulfonylation of the catalytic serine (Scheme 1).
![Page 103: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/103.jpg)
84
MALDI-TOF analysis of hMGL and H121S hMGL inhibited by AM3506
To pinpoint the specific sulfonylation site, AM3506-inactivated hMGL samples were
subjected to overnight, in-solution trypsin digestion and the tryptic peptides were analyzed by
MALDI-TOF MS. A comparison of the spectra of the tryptic digest from native and AM3506-
treated hMGL reveal (in the latter) a new peptide at m/z 5,233.11 with mass 18 Da less than the
peptide containing the catalytic serine at m/z 5,251.10
(DYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAK --
position 117-172) (Fig. 3a). The 18 Da decrease was provisionally attributed to a β-elimination
reaction, which led to the conversion of sulfonyl serine to dehydroalanine. Intermediate peptides
attributable to sulfonylation of the catalytic serine (+226.2 mass increase) were not observed by
MALDI-TOF analysis. Because there are three serine residues in the tryptic fragment, tandem
MS was performed on both the modified and unmodified ions to determine the exact serine
residue modified by AM3506. The MS/MS spectra of the m/z 5251.10 and m/z 5,233.11 ions
derived from trypsin digests of untreated, and AM3506-treated hMGL, are shown (Fig. 3b).
MS/MS spectral optimization was complicated by the high molecular weights involved, as well
as the low intensity of the peptides in question. However, Ser122 is unambiguously detectable, as
the residue that was converted to dehydroalanine.
It can be hypothesized that an alkaline microenvironment, provided by the Ser122-adjacent
His121, is essential for this β-elimination reaction. To examine this, the mutant H121S hMGL was
expressed and purified. This mutant retained catalytic activity comparable to that of the wild type
and was inhibited by AM3506 (Fig. 4a). H121S hMGL was treated with AM3506 at a compound
to enzyme molar ratio of 10:1, and then subjected to overnight trypsin digestion. The MS spectra
of the tryptic digest from untreated H121S hMGL and AM3506-treated H121S hMGL are
![Page 104: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/104.jpg)
85
virtually identical; the 18 Da lighter peak is absent in the latter case (Fig. 4b). This experiment
demonstrates that His121 plays an essential role in the β-elimination reaction.
MALDI-TOF MS analysis of the Michael addition reaction
If the β-elimination reaction converted Ser122 to a dehydroalanine residue, activated thiols
would act as Michael donors, creating specific hMGL thio-conjugates. In this proof-of-concept
experiment, tryptic digests of hMGL, and H121S-hMGL, pretreated with AM3506 were
incubated with either thiophenol or beta-mercaptoethanol (βME). Each sample was then
subjected to MALDI-TOF analysis. A comparison of the spectra from the tryptic digest of either
untreated and thiophenol-treated hMGL revealed that the latter contains a new, modified peptide
with a 92 Da increase in mass (m/z 5,342.8 Da) (Fig. 5a) that is consistent with the addition of
thiophenol to the dehydroalanine via the Michael addition reaction. Also, the spectra of βME-
treated samples revealed a new peptide with a 60 Da increase in mass (m/z 5,310.74 Da) that is
consistent with the addition of βME to dehydroalanine via Michael addition (Fig. 5b). The
successful conjugate addition confirms the formation of a dehydroalanine residue in hMGL,
treated with AM3506, and this transmuted residue’s availability for nucleophilic addition.
![Page 105: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/105.jpg)
86
Conclusions
We have characterized the molecular mechanism of hMGL’s inhibition by AM3506
through a comprehensive mass spectrometric (MS) analysis. The reaction of AM3506 with both
MGL and FAAH exhibited a “one–to-one” stoichiometry. We showed that AM3506-based
inhibition of MGL occurs through sulfonylation of the catalytic serine (Ser122), followed by a
His121 mediated β-elimination reaction that resulted in desulfonylation of the inactivated enzyme
and the subsequent formation of a dehydroalanine122 residue. To confirm the formation of
dehydroalanine, a Michael acceptor, we performed conjugate addition (Michael reaction) using
the activated thiols, thiophenol and betamercaptoethanol as nucleophiles. A comparison of the
spectra of the tryptic digest from untreated and thiol-treated hMGL confirmed the addition of
these thiols to dehydroalanine122. Additionally, intact hMGL pretreated with AM3506, was
incubated with thiophenol after adjusting the pH to 12.0 to catalyze dehydroalanine formation,
and the intact mass was analyzed by LC-MS. The spectrum showed a peak with an average mass
of 34215.2 Da (+91.6 Da), a mass consistent with the formation of S-phenyl cysteine and the
consequent calculated mass increase of 92.1 Da (Supplementary Data, Fig S1)
To provide evidence that His121 is essential in directing the desulfonylation via β-
elimination mechanism, we expressed and purified mutant H121S hMGL and treated it with
AM3506. We did not observe any new peptides attributable to the β-elimination mechanism.
Similarly, we did not observe any peptides attributable to β-elimination in AM3506-treated fatty
acid amide hydrolase (FAAH), a serine hydrolase enzyme that has no histidine preceding the
catalytic serine (Supplementary Data, Fig. S2, Fig. S3, and Fig. S4). We attempted to analyze a
rFAAH I250H mutant in the attempt to induce β-elimination, but unfortunately this mutant was
catalytically silent (data not shown). LC-MS/MS analysis of this mutant showed no difference in
![Page 106: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/106.jpg)
87
the 221-251 peptide upon incubation with AM3506 (Supplementary Data, Fig S5a). In the
rFAAH sample that was treated with AM3506, no β-elimination occurred because the mutant did
not interact with AM3506 (Supplementary Data, Fig S5b).
In general, desulfonylation of a sulfonyl enzyme can be achieved by three different
mechanisms: (1) direct displacement of the sulfonate anion by a nucleophile132 2) an
intramolecular cyclization reaction that leads to an oxazoline ring133, or 3) β-elimination to form
dehydroalanine134. FAAH clearly undergoes the first process since the catalytic serine residue is
regenerated on desulfonylation. Intramolecular cyclization requires complete departure from the
ridged structure of the peptide. While this is possible during trypsin digestion, in no case was the
presence of an oxazoline ring detected. The β-elimination mechanism has only been observed in
intact proteins for p-toluenesulfonyl chymotrypsin in 0.1 N NaOH (pH >13.0). Our discovery
that the path of desulfonylation in hMGL occurs via β-elimination during overnight trypsin
digestion (pH= 8.0) due to a specific histidine residue outside of the catalytic triad presents a
selective approach for serine hydrolase modification at the catalytic residue that confers new
function without genetic manipulation. We believe that H121 creates a microenvironment
surrounding the catalytic Ser122 in which the pH increases; and as a result, elimination is favored
over substitution21. Also, we show that increasing the pH to 12.0 causes the intact
monosulfonylated hMGL to underdo β-elimination quickly (in less than 1hr), which results in the
formation of dehydroalanine.
Nucleophilic additions to the α,β-unsaturated dehydroalanine residue by different
nucleophiles demonstrates a novel, selective approach for serine hydrolase modification.
Fluorogenic probes can now be designed using this paradigm to target catalytically active serine
![Page 107: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/107.jpg)
88
hydrolases. The ability to confer new functions on MGL specifically can enable us to study this
potential cancer-cell biomarker, and provide a greater understanding of its function within a
global, context.
![Page 108: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/108.jpg)
89
Materials and Methods
Materials
Culture media, Bio-SpinTM P-6 columns and SDS-PAGE supplies were purchased from
Bio-Rad (Hercules, CA). MS-grade trypsin (Trypsin Gold) was from Promega (Madison, WI).
AM3506 and AHMMCE were synthesized at the Center for Drug Discovery, Northeastern
University.
Methods
Expression and purification of hMGL and H121S hMGL
Expression and purification of hMGL and the histidine-to-serine single mutant human
MGL (H121S hMGL) followed a similar procedure as reported by Zvonok et al.74,135 A single E.
coli BL21 (DE3) colony, containing either pET45His6hMGL or pET45His6H121ShMGL
plasmid, was used to inoculate 20 mL of Luria broth (LB) medium containing ampicillin
(100µg/mL) and was grown overnight at 37°C with shaking (~250 rpm). The following day, 10
mL of the overnight culture was used to inoculate 1 L of fresh Luria broth-ampicillin and
allowed to grow until the culture reached an OD600 of 0.6. Protein expression was induced with
isopropyl β-D-thiogalactopyranoside (IPTG) to a final concentration of 1 mM and the
temperature lowered to 33°C. Following a 4 hr. induction, the cells were collected by
centrifugation at 5000 x g for 10 min at 4°C and stored at –80°C. For purification, the frozen
pellet was thawed on ice, re-suspended in lysis buffer (50 mM Tris, 100 mM NaCl, 1% Triton X-
100, pH=8.0) and sonicated on ice. The cell lysate was then centrifuged at 30,000g for 30 min at
4°C. The supernatant was added to 0.5 mL (bed volume) of Cobalt-NTA resin (Clonetech) pre-
equilibrated with lysis buffer and mixed for 1 hr. at 4°C. The suspension was transferred to a
gravity-flow column and washed with 20 mL lysis buffer, then with 10 mL of lysis buffer
![Page 109: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/109.jpg)
90
containing 10 mM imidazole. Finally, hMGL was eluted with 3 mL of lysis buffer containing
250 mM imidazole in 0.5 mL fractions, and the purity was checked with SDS-PAGE.
Interaction of AM3506 with hMGL and H121S hMGL
A solution containing purified hMGL or H121S hMGL (50μl of 5 µM) in lysis buffer
was incubated with AM3506 (in DMSO) at a compound-to-enzyme molar ratio of 10:1 at room
temperature for 1 hr. In control samples, DMSO was added to the enzyme solution instead of
AM3506. An aliquot of each mixture was used to check activity after 1 hr. using the fluorescent
assay method (described below). The reaction was terminated by desalting with a Bio-Spin 6
column in 25 mM ammonium bicarbonate buffer containing 0.05% CYMAL (pH 8.0). The
sample was digested with 200 ng of Trypsin Gold (Promega, Madison, WI) overnight at 37°C.
Assay of hMGL and H121S hMGL inhibition using AHMMCE
An in-house fluorometric assay135 was used to evaluate the hMGL and H121S hMGL
inhibition by AM3506, after incubation with AM3506 for 1 hr. at room temperature. MGL
activity was monitored by the hydrolysis of the fluorogenic substrate: 7-hydroxy-6-methoxy-4-
methylcoumarin ester (AHMMCE) to form the fluorescent product 7-hydroxy-6-methoxy-4-
methylcoumarin (HMMC). hMGL (30 ng) and AHMMCE (final concentration 20 μM) were
added to a total volume of 200 μL in assay buffer (50 mM Tris-HCl, pH 7.4) in a 96-well plate.
The reaction was allowed to proceed for 3 hr. at 25°C. Fluorescence readings were taken every
15 minutes at 360 nm/460 nm (λexcitation/λemission) on a BioTek Synergy HT Microplate Reader
(BioTek Instruments, Winooski, VT).
![Page 110: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/110.jpg)
91
Intact mass analysis of AM3506-treated hMGL
A Waters LCT-Premier mass spectrometer was used to determine the intact mass of
AM3506-treated hMGL samples. The instrument was calibrated with 500 fmol/mL horse
myoglobin (Sigma-Aldrich) before and after reach run. Instrument conditions were as follows:
source temperature, 80°C; desolvation, 175°C; capillary voltage, 3200 V; and cone voltage, 35
V. Dialyzed, detergent-free hMGL in buffer A (50 mM Tris, 100 mM NaCl, pH 8.0) were
incubated with AM3506 at a compound to protein molar ratio of 10:1. After 1 hr. of incubation
at pH 8.0, samples (200 pmol) were injected onto a self-packed POROS 20 R2 2 mm x 20 mm
trap column which traps the protein but allows buffer salts through. Samples were manually
desalted with an appropriate (>5 x the volume of the sample) volume of 0.1% formic acid in
H2O. The desalted protein was then eluted from the column with a 15-75% gradient of
acetonitrile containing 0.05% TFA at flow rate 50 µL/min in 4 min. The intact mass of AM3506-
treated hMGL was also determined after adjusting the pH of buffer A to 12.0.
MALDI-TOF MS analysis of tryptic digests (AM3506 hMGL and H121S hMGL)
MS data were obtained using a 4800 MALDI TOF/TOF instrument (Applied Biosystem,
Framingham, MA) equipped with a 200 Hz solid-state ultraviolet laser (wavelength 355 nm).
Samples were crystallized on a 384-well MALDI plate (Opti-TOF™ 384 Well Insert, Applied
Biosystems) by spotting 0.5 μL tryptic digest and 0.5 μL α-cyano-4-hydroxycinnamic acid
matrix (5 mg/mL in 50% water/50% acetonitrile/0.1% trifluoroacetic acid). The digested samples
were diluted 5-fold and 10-fold with α-cyano-4-hydroxycinnamic acid matrix solution and 1 μL
of the diluted samples were spotted for analysis. External calibration of the spectra was carried
out by using a mixture of 6 calibrants with masses (MH+) of 904.468, 1296.685, 1570.677,
2093.086, 2465.198, and 3657.929 corresponding to des-Arg1-bradykinin, angiotensin I, glu-
![Page 111: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/111.jpg)
92
fibrino peptide, ACTH (fragment 1–17), ACTH (fragment 18–39), and ACTH (fragment 7–38)
respectively. For data analysis, the monoisotopic peaks were compared with the theoretical
molecular weights corresponding to the expected tryptic peptides. MS-digest (University of
California, San Francisco, CA) was used to calculate the theoretical molecular weights of the
expected peptides after digestion. The maximum error limit was set to 80 parts per million
(ppm).
Additions of thiols to the tryptic digest samples of hMGL and H121S hMGL
Tryptic digest samples of hMGL and H121S hMGL (40 μL, 120 μM) pretreated with
AM3506 were incubated with either thiophenol, or beta-mercaptoethanol (βME) at a thiol to
MGL molar ratio of 2:1. The incubation was performed at 37°C for 30 min. For the thiophenol
sample, the pH was adjusted to 8.0 and for βME sample, the pH was adjusted to 12.0. Samples
were directly spotted on a 384-well MALDI plate (Opti-TOF™ 384 Well Insert, Applied
Biosystems) and crystallized by adding α-cyano-4-hydroxycinnamic acid matrix as described
above.
Addition of thiophenol to sulphonylated intact hMGL
Samples of hMGL (50 μL, 120μM) pretreated with AM3506 were incubated with
thiophenol at a thiophenol to MGL molar ratio of 2:1. The incubation was performed at room
temperature for 1 hr. at pH 8.0. After incubation, samples (200 pmol) were injected onto a self-
packed POROS 20 R2 2 mm x 20 mm trap column. Samples were manually desalted with 0.1%
formic acid in H2O. The desalted protein was then eluted from the column with a 15-75%
gradient of acetonitrile containing 0.05% TFA at flow rate 50 µL/min in 4 min.
![Page 112: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/112.jpg)
93
Schema
Scheme 1: Proposed mechanism of hMGL inactivation by AM3506.
The path of desulfonylation outlined above is consistent with the MS data.
![Page 113: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/113.jpg)
94
Figures
Fig. 1. Inhibition curves for serine hydrolases using AM3506.
a) MBP-hFAAH hydrolysis of AAMCA substrate. b) ΔTM-rFAAH hydrolysis of AAMCA
substrate. c) hMGL hydrolysis of AHMMCE substrate. d) Structure of AM3506.
![Page 114: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/114.jpg)
95
Fig. 2. LC-TOF ESI-MS analysis of hMGL enzyme masses.
a) Intact mass of unmodified hMGL at pH 8.0. b) Intact mass of AM3506-treated hMGL at pH
8.0. c) Intact mass of AM3506-treated hMGL, incubated at pH 12.0 for 1 hr. at RT.
![Page 115: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/115.jpg)
96
Fig. 3. MS/MS analysis of hMGL inactivation by AM3506.
a) MALDI-TOF MS mapping of the tryptic digest for purified hMGL. Top: a unique tryptic
peptide (m/z 5233.1) in AM3506-treated hMGL (18 Da lighter when compared to the respective
unmodified peptide). Bottom: high-resolution spectra of the precursor ion for the unmodified
peptide (m/z 5251.6) that contains the catalytic serine. b) MALDI-TOF MS/MS analysis
identifying Ser122 as the modified residue. Top: unmodified peptide. Bottom: AM3506-treated
peptide.
![Page 116: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/116.jpg)
97
Fig. 4. H121S hMGL inhibition by AM3506.
a) The activity of H121S hMGL as a function of time before and after treatment with AM3506.
b) MALDI-TOF MS analysis of AM3506-inhibited H121S hMGL. Top: mass spectra of the
tryptic peptide containing the catalytic serine. Bottom: The peptide remains unmodified
following AM3506 treatment.
![Page 117: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/117.jpg)
98
Fig. 5. MALDI TOF MS analysis of the conjugate addition of thiophenol and β-
mercaptoethanol (βME) to AM3506-treated hMGL.
a) hMGL treated with AM3506 only. b) hMGL treated with AM3506 followed by the addition of
thiophenol. c) hMGL treated with AM3506 followed by the addition of βME.
![Page 118: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/118.jpg)
99
Supplementary Data
Expression and purification of ΔTM rFAAH
The transmembrane-deleted rat FAAH (ΔTM rFAAH) was expressed in E. coli cells and
purified using a procedure adapted from Patricelli et al21. Briefly, 1L of LB medium was
inoculated with 10 mL of the overnight culture. Cultures were then induced with IPTG (1mM) at
an OD600 of 0.6-0.8 for 4 h and pelleted at 5000 rpm for 10 min. For purification, the cells (3g)
were thawed on ice, resuspended in lysis buffer (50 mM Tris, pH 8.0 containing 100 mM NaCl,
and 1% Triton X-100) and lysozyme was added to a final concentration of 1 mg/mL. The lysate
was then sonicated and centrifuged at 10,000 x g for 35 min at 4 °C. The supernatant was added
to 0.5 mL (bed volume) of pre-equilibrated cobalt -NTA beads and mixed for 1 hr. at 4 °C. The
suspension was transferred to a gravity-flow column and washed with 20 mL lysis buffer, then
with 10 mL of lysis buffer containing 10 mM imidazole, and then to 10 mL of lysis buffer
containing 30 mM imidazole. ΔTM rFAAH was eluted with 4 mL of lysis buffer containing 250
mM imidazole. The elution was transferred directly to a heparin column pre-equilibrated with
imidazole elution buffer. The heparin column was washed with 20 mL of imidazole elution
buffer, 20 mL of wash buffer 1 (20 mM HEPES (pH 7.8), 1 mM EDTA, 10% glycerol and 0.5%
CHAPS) with 150 mM NaCl, and 20 mL of wash buffer 1 with 300 mM NaCl. ΔTM FAAH was
eluted with 5 mL of buffer 1 with 700 mM NaCl. The elution fractions were desalted and
concentrated using Millipore Ultra centrifugal filter tubes (10K cut off membrane). The desalted
samples were then loaded into Sephacryl S-200 high resolution gel filtration columns
equilibrated in (20 mM HEPES (pH 7.8), 150 mM NaCl, 1mM EDTA, and 0.1% LDAO) at a
flow rate of 0.5 mL/min. Eluted fractions were concentrated and analyzed by SDS-PAGE to
confirm purity.
![Page 119: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/119.jpg)
100
Interaction of AM3506 with ΔTM rFAAH
A solution (50 μL, 4 µM) containing purified ΔTM FAAH in lysis buffer was incubated
with AM3506 at a compound:enzyme molar ratio of 2:1. The incubation was conducted at room
temperature for 1 hr. Control samples (DMSO was added to the enzyme solution instead of the
test compound) were prepared in parallel. An aliquot of each mixture was used to evaluate
activity after 1 hr. using the fluorescent assay method as described previously. The incubations
were terminated by desalting with a Bio-Spin 6 column in 25mM ammonium bicarbonate buffer
containing 0.05% CYMAL (pH 8.0), and the samples were subjected to digestion with 200 ng of
Trypsin Gold (Promega, Madison, WI) overnight at 37 °C.
Assay of ΔTM FAAH inhibition using AAMCE
The ΔTM FAAH inhibition by AM3506 was checked after incubation with AM3506 for
1 hr. at room temperature. ΔTM FAAH activity is monitored by the hydrolysis of the fluorogenic
substrate N-arachidonoyl, 7-amino-4-methylcoumarin amide (AAMCA) to form the fluorescent
product, 7-amino-4-methylcoumarin (AMC).116 Briefly, the assay was performed in a 96-well
format in 50 mM HEPES, 1 mM EDTA, 0.1% BSA, pH 7.4 buffer with ΔTM FAAH alone and
ΔTM FAAH that has been incubated with AM3506. AAMCA was then added to a final
concentration of 10 µM in a total volume of 200 µl. The incubation was continued for 4 hr.,
during which fluorescence readings at 360 nm/460 nm (λexcitation/λemission) were taken on a BioTek
Synergy HT Microplate Reader (BioTek Instruments, Winooski, VT) every 20 min.
LC/MS ESIMS Intact mass analysis of AM3506-treated ΔTM rFAAH
Waters LCT Premier mass spectrometer was used to determine the intact mass of
AM3506-treated ΔTM FAAH samples. Instrument conditions were as follows: source
![Page 120: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/120.jpg)
101
temperature, 80 °C; desolvation, 175°C; capillary voltage, 3200 V; and cone voltage, 35 V.
Dialyzed, detergent free ΔTM FAAH solutions were incubated with AM3506 at a
compound:protein molar ratio of 2:1. After 1 hour of incubation, samples (200 pmol of protein)
were injected onto a 2mm x 20mm trap column containing self-packed POROS 20 R2 which
traps the protein but allows buffer salts through. Samples were manually desalted with an
appropriate (>5x the volume of the sample) volume of 0.1% formic acid in H2O. The desalted
protein was then eluted from the column with 15-75% acetonitrile containing 0.05% TFA over 4
min. All samples were calibrated with infusing 500 fmol/mL myoglobin at 10ul/min at the end of
each run.
MS/MS Analysis of rFAAH I250H Tryptic Peptides
LC-MS/MS analysis of rFAAH I250H tryptic peptides was performed with a Waters
Synapt G2 mass spectrometer coupled to a Waters nanoACQUITY UPLC System. Separation of
the peptides was carried out on a Waters ACQUITY UPLC HSS T3 column (1.0 x 50 mm,
packed with 1.8 µM silica particles). The sample, 100 pmol of rFAAH I250H in 100 mM
NH4CO3 and 0.05% CYMAL-6 detergent, was diluted up to 50 µL in water and injected onto the
column. The sample was desalted on Waters ACQUITY UPLC BEH C18 VanGuard Pre-column
(packed with 1.7 µM BEH particles) over 3 min with 95% water and 5% acetonitrile at 60
µL/min. Mobile phase A (water and 0.1% formic acid) and B (acetonitrile and 0.1% formic acid)
were applied as a gradient (8% B to 40% B over 6 min, then 40% B for 1 min, then 40% B to
85% B over 30 seconds, then 85% for 1 min, then 85% B to 5% B over 30 seconds, then 5% B
for 3 min) over 12 min at a flow rate of 60 µL/min. MS scans were acquired from m/z 50 to
1990. Peptides were identified using Waters software (Protein Lynx Global Server 2.5).
![Page 121: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/121.jpg)
102
Assignment of Trypsin Digested Peptides from rFAAH I250H
Acquired spectra were searched by Protein Lynx Global Server 2.5 using the sequence of
rFAAH I250H. Peptides were further filtered using Waters software DynamX. Peptides could
not have an error greater than 20 ppm, must contain a minimum of two consecutive amino acid
fragments and at least 0.2 products/amino acid. Peptides belonging to rFAAH I250H that were
treated with inhibitor were searched with a side chain dehydration variable modifier on.
![Page 122: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/122.jpg)
103
Supplementary Figures
Fig. S1: LC-ESI MS analysis of hMGL enzyme masses at pH 8.0.
a) The intact mass of unmodified hMGL. b) intact mass of AM3506-treated hMGL. c) Intact
mass analysis of AM3506-pretreated hMGL that was incubated with thiophenol after adjusting
the pH to 12 to catalyze dehydroalanine formation. The analysis of C shows the covalent
attachment of AM3506; an addition of 226.1 Da to the total mass of hMGL that is consistent
with enzyme sulfonylation. There is a peak with an average mass of 34,215.2 Da (+91.6 Da), a
mass consistent with the direct replacement of sulfonyl group with thiophenol. (* indicates Co++-
6-His adduct formed during purification)
![Page 123: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/123.jpg)
104
Fig. S2. Coomassie-stained SDS-PAGE gel for purified, hexa-histidine-tagged ΔTM rFAAH
![Page 124: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/124.jpg)
105
Fig. S3. ΔTM rFAAH inhibition by AM3506.
a) The activity of ΔTM rFAAH as a function of time before and after treatment with AM3506. b)
LC-ESI MS analysis of intact masses of unmodified (top) and AM3506-treated ΔTM rFAAH
(bottom). The analysis shows the covalent attachment of AM3506; an addition of 226 Da to the
total mass of ΔTM rFAAH consistent with enzyme sulfonylation.
![Page 125: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/125.jpg)
106
Fig. S4: MS analysis of ΔTM rFAAH inhibition by AM3506.
a) MALDI-MS fingerprint of a tryptic digest of purified ΔTM rFAAH only. b) Tryptic digest of
purified ΔTM rFAAH that was treated with AM3506. The analysis shows no difference between
the two preparations; we did not observe any peptides with (-18 Da or +226 Da) mass changes in
the AM3506-treated sample. The unmodified precursor ions at m/z 2670.2 corresponds to the
tryptic peptide SPGGSSGGEGALIGSGGSPLGLGTDIGGSIR (position 221-251) which
contains the catalytic serine (Ser249) are circled.
![Page 126: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/126.jpg)
107
Fig. S5: LC-ESI MS analysis ΔTM rFAAH I250H
a) MS and MS/MS spectra of the 221-251 tryptic peptide in the +3 charge state for rFAAH
I250H mutant. b) MS and MS/MS spectra of the 221-251 tryptic peptide in the +3 charge state
for rFAAH I250H in the presence of the AM3506 inhibitor.
![Page 127: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/127.jpg)
108
Acknowledgements
Mahmoud L. Nasra,1, Michael Johnsona,1, Nikolai Zvonoka, Xiaomeng Shib, Shakiru O.
Alapafujac, Spyros P. Nikasa, Brent Kochertb, Thomas Walesb, John R. Engenb, Zhaohui Sunny
Zhoub , David Janeroa, Alexandros Makriyannis*,a,c
1 These authors contributed equally to this work.
a Center for Drug Discovery, Department of Pharmaceutical Sciences, Northeastern University,
116 Mugar Life Sciences Building, 360 Huntington Avenue, Boston, MA, 02115 USA.
b Department of Chemistry and Chemical Biology and Barnett Institute of Chemical and
Biological Analysis, Northeastern University, Boston, MA, 02115, USA.
c MAK Scientific LLC, 801 Albany Street Suite 107/108, Boston, MA, 02119, USA
* To whom correspondence should be addressed
Tel.: +1-617-373-4200; fax: +1-617-373-7493; e-mail: [email protected]
![Page 128: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/128.jpg)
109
Chapter 5
Synthesis and Characterization of a Novel, Theranostic, Click-Enabled
Nanoplatform
![Page 129: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/129.jpg)
110
Introduction
Nanomedical agents, such as gold nanoparticles (AuNPs), comprise a dynamic class of
materials with in vitro/in vivo136-139 and clinical (ClinicalTrials.gov Identifier: NCT01436123,
and NCT01270139) applications. Nanoparticles exist in a physical state between that of bulk
material and a single molecule. In this transitional state, surface, and quantum-mechanical
properties can be “tuned” simply by altering particle size and shape.140 Nanoparticles can be
synthesized to present a unique combination of magnetic,141 chemical,142 and optical143
properties, which can be optimized for biomedical applications. Using click chemistry, MGL and
FAAH inhibitors can be conjugated to these therapeutic, and diagnostic imaging
“nanoplatforms,” which can then be then utilized for hyper-thermal ablation therapy144, and MRI
contrast enhancement145,146 in real time.147 Coupling endocannabinoid-hydrolyzing enzyme
inhibiting medications to this platform in this way would expand the field from palliative, to
direct antineoplastic treatment with these agents.
Herein we synthesize and characterize a multi-lamellar nanoplatform based on the
particles synthesized by Melancon et al.147 for imaging, drug delivery, and therapeutic
applications. These “fLPA-SPIO@AuNS” particles are comprised of a superparamagnetic iron
oxide SPIO core (Scheme 1a), which was chosen to enable deep tissue magnetic hyperthermia148,
MRI contrast enhancement, and the magnetic targeting/trapping149 of these particles. Localized
hyperthermia (or thermal ablation therapy) can be used to kill cancer cells by coagulating
intracellular proteins (inducing apoptosis) and destroying nearby blood vessels, while leaving
healthy, non-tumor cells intact.150 SPIO nanoparticles will produce localized heating when
exposed to an alternating current magnetic field,151 which can be produced in an MRI
instrument.152 The mechanism by which hyperthermia (temperature: 42–45 °C) and hyperthermic
![Page 130: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/130.jpg)
111
ablation therapy (temperature: >50 °C) proceeds is through subsequent increased immunologic
response (increased levels of peripheral blood CD4+ T cells, and serum IL-2).153 These particles
also act as T1 and T2, contrast enhancing imaging agents in the MRI,154,155 which allows for
better imaging of tumor borders, and allows for real time tracking of treatment efficacy. These
particles can also be directed to, and or confined within, tumor sites, with use of an externally
applied magnetic field.156 When the particles enter the field, the tumor cells are unable to clear
them, leading to highly precise, targeted treatments.
The dielectric SiO2 that makes up the second layer of the fLPA-SPIO@AuNS (Scheme
1a) enhances the surface plasmon resonance (SPR) of the gold shell157,158 that was designed for
biocompatibility,159,160 facile bioconjugation,161,162 and both photothermal and imaging
capabilities.163,164 SPR in gold nanoshells is the vibrational oscillation of surface electrons,
stimulated by monochromatic light. In smaller particles, light in the blue-green spectrum is
absorbed, while red light is reflected. As particle size increases, however, SPR absorption
redshifts to longer wavelengths, eventually landing in the infrared (IR) spectrum of 700 to 1,000
nm. The excitation wavelength can be further tuned by varying the thickness of the gold shell.165
This SPR phenomena leads to localized heating, which can be used to hyper thermally ablate
solid tumors. Infrared light can penetrate tissue to a depth of 1-2 cm,166 making this therapy
useful for the treatment of superficial, solid tumors.
Gold nanoshells can be functionalized with dihydrolipoic acid (LPA),162 since the dithiol
readily adsorbs onto gold surfaces.167 This can be used to facilitate conjugation of targeting,
therapeutic, or imaging agents to the fLPA-SPIO@AuNS platform (Scheme 1b). Therefore, a
modified LPA, the product of the conjugation of lipoic acid and propargyl amine (using N, N’-
Dicyclohexylcarbodiimide (DCC) as the dehydration agent) can be used to present a functional
![Page 131: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/131.jpg)
112
alkyne moiety on the surface of these particles for azide-alkyne Huisgen cycloaddition168 (‘click’
addition) of azido-functionalized entities. In this case, conjugation of a novel, azido-
functionalized MGL inhibitor could be used to target metastatic breast cancer cells.2 In this case,
the fLPA-SPIO@AuNS MGL inhibitor would act as both a targeting ligand, and an anti-
metastatic agent. Presented here is the complete synthesis, monitored using transmission electron
microscopy (TEM), dynamic light scattering spectroscopy (DLS), and nuclear magnetic
resonance imaging (MRI), of fLPA-SPIO@AuNS particles.
![Page 132: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/132.jpg)
113
Results and Discussion
TEM imaging to monitor particle synthesis
Hydrophobic superparamagnetic iron oxide nanoparticles (SPIONs) (core particles –
Scheme 1) were synthesized using a co-precipitation method.169 TEM images of these particles
showed them to be disperse, and ranging in size from around 5 to 15 nm, with an average
diameter of 10 nm (Fig. 1). These particles were of sufficient stability to store at 4 °C for future
use in nanoplatform development. The core particles were highly attracted to a neodymium
magnet, and would disperse in cyclohexane when the magnet was removed. Upon lyophilization,
the particles did not appear to oxidize (no change in color) and the NP powder could be
resuspended easily in cyclohexane.
The hydrophobic SPIONs were then coated in SiO2 using the Stöber process170 and a
monolayer of SiO-NH2 was grown on the surface of these particles to facilitate seeding with 2
nm gold nanoparticles. TEM micrographs showed a clear core-shell morphology (Fig. 2top).
Particles ranged in size from 35 to 45 nm and had an average diameter of 40 nm (Fig. 2). After
adding THPC stabilized 2 nm gold nanoparticles to the now hydrophilic population of particles
in solution, seeding was clearly evident on the surface of the particles (Fig. 2bottom).
Dynamic light scattering analysis particle synthesis
For the hydrophilic nanoparticles, dynamic light scattering (DLS), a nondestructive
analysis technique, was used to determine the hydrodynamic size of these particles. In DLS
imaging, a coherent, monochromatic light source (of a large wavelength relative to the particle
size to be measured) is used to measure particle motion in solution. This motion (beam crossing)
is then filtered through an autocorrelation function which is subsequently deconvoluted to solve
for the particle’s diffusion coefficient, which is a function of particle-in-solution hydrodynamic
![Page 133: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/133.jpg)
114
size. The intensity weighted chromatograms from the silica coated SPIONs (SC-SPOINs)
showed a hydrodynamic size of 135.8 nm with a polydispersity index (PDI) of 0.005 (Fig. 3a).
This differs greatly from the physical size of these particles as measured by TEM, and suggests
these particles have a layer of water that attaches to the particles’ surface and moves with them
in aqueous solution. This interpretation is consistent with the hydrophilicity of the surfaces of
these particles. After seeding, the particle hydrodynamic size was measured 136.6 nm with a PDI
of 0.005 (Fig. 3b). As such, no significant change in particle hydrodynamic size, or
polydispersity was detectible by DLS after particle seeding.
Following fLPA-SPIO@AuNS formation with various surfactant ratios, and solvents, a
distinct change in hydrodynamic size was evident. For fLPA-SPIO@AuNSs formed with a 2/1
ratio of LPA to SH-PEG in water, a 93.9 nm hydrodynamic size was measured with a PDI of
0.030 (Fig. 4). For fLPA-SPIO@AuNSs formed with a 1/1 ratio of LPA to SH-PEG in water, a
111.2 nm hydrodynamic size was measured with a PDI of 0.005 (Fig. 4). For fLPA-
SPIO@AuNSs formed with a 1/1 ratio of LPA to SH-PEG in 50 % DMSO(aq), a 138.8 nm
hydrodynamic size was measured with a PDI of 0.005 (Fig. 4). Many factors can contribute to
the size of gold nanoshells,171 but in this case the surfactant LPA appears to be the determining
factor. It is known that surfactants can stabilize nanoparticles, but they also mould the size and
shape of the particles.172 From these results, it appears that LPA has higher solubility in DMSO
than on the surface of SPIO@AuNS particles. As such, the more LPA available to react with the
particles, the smaller the particles hydrodynamic size will be. Another interpretation of these
results could be that the hydrophilicity of the surface changes, but the particle size is unaffected.
This interpretation does not reconcile the visible color change in the fLPA-SPIO@AuNS
![Page 134: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/134.jpg)
115
solutions, a clear sign of differing particle sizes and differing optical properties of these
populations.
T2 contrast enhancement as measured by MRI
SC-SPIONs of varying concentrations from 1 nM to 1 mM were analyzed for T2 contrast
enhancement against agar phantoms using nuclear magnetic resonance imaging (MRI) (Scheme.
2). Slices were analyzed for T2 enhancement with variable contrast (Fig. 5a). T2 values
decreased in a dose-dependent manor as expected for SPIONs, becoming significant in the µM
concentration range (Fig. 5b). Changes in T1 relaxivity were not significant, but became
pronounced for the 1 mM concentration (data not shown). Imaged slices of samples containing
µM concentrations of SC-SPIONs showed clinically relevant contrast enhancement (Fig. 5c),
similar to that of Feridex®, an FDA approved contrast agent. Relevant concentrations were
likely much lower, perhaps in the high nM range, since the concentration estimations used here
assumed no loss of iron in the synthesis of SC-SPOINs. From the TEM images, it would appear
that small and large iron oxide particles were not incorporated in the SC-SPIONs, so some loss
would be expected. Further study is required do determine the intracellular concentration of
fLPA-SPIO@AuNS particles necessary to image small neoplasms with MRI, but this study has
provided a proof of concept for this technique.
![Page 135: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/135.jpg)
116
Conclusions
In this study, a novel nanomedical agent was synthesized and characterized. This fLPA-
SPIO@AuNS nanoplatform could be coupled to a targeting moiety, such as an MGL or FAAH
inhibitor, in order to target this diagnostic imaging, and therapeutic agent to aggressive breast
cancer cells. The synthesis of the core SPIO particles was characterized by TEM. As predicted,
hydrophobic, magnetic nanoparticles with an average diameter of 10 nm were synthesized. These
particles were then coated with silica, and functionalized with a monolayer of NH2-silica. SC-
SPIONs with an average physical diameter of 40 nm, and an average hydrodynamic diameter of
~140 nm were then seeded with 2 nm gold to provide nucleation sites for gold shell growth. This
seeding did not change the hydrodynamic diameter of the particles, and this process was
monitored by TEM and DLS. Subsequent growth of the gold shell was regulated by surfactant
LPA ratio and availability for binding. A greater amount of LPA lead to thinner shell formation.
Additionally, these particles acted as T2 contrast enhancing agents in the MRI. Development of
the fLPA-SPIO@AuNS platform opens the door to a plethora of targeting, therapeutic, and
diagnostic imaging agents that could be bioconjugated via click chemistry to this nanomedical
agent. Additionally, by adjusting the size of this platform, the optical and chemical properties of
this drug can be tuned for specific applications. Due to the size of these particles, even in the
absence of additional targeting agents, bioaccumulation in tumor cells would be expected due to
the enhanced permeability and retention (EPR) effect173 for nanoparticles under 200 nm in
physical and hydrodynamic size. This makes the fLPA-SPIO@AuNS platform an attractive
launchpad for future drug discovery and development.
![Page 136: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/136.jpg)
117
Materials and Methods
Materials
Standard laboratory chemicals and buffers were purchased from Fisher Chemical
(Pittsburgh, PA) and Sigma Chemical Co. (St. Louis, MO).
Methods
SPIO Synthesis via modified co-precipitation method
5 mL of 0.1 M FeCl2 was mixed with 30 mL of 0.1 M FeCl3 in a round bottomed flask
equipped with a temperature probe, and stirred for 20 min in a chemical hood, at which point 100
mg of oleic acid was added. The solution was heated to 50°C, and 3 mL of 5 M NH4OH was
added drop wise. Heating was continued until a temperature of 80°C was reached; then this
temperature was maintained for 30 min. The clear, pale, yellow-green solution turned brown-
black, indicating the formation of iron oxide nanoparticles. The sample was then cooled to room
temperature, and MNPs were isolated using a small, neodymium magnet. Magnetic particles
were then suspended in cyclohexane.
Silica coating of SPIO nanoparticles
In a 20 mL scintillation vial, 60 μL of concentrated, aqueous ammonia, 0.53 g of Igepal
CO-520, 150 μL of cyclohexane solution containing 2 mg/mL Fe3O4 NPs, and 10 mL of
cyclohexane were vigorously stirred for 30 mins. To this, 0.5 mL of a cyclohexane solution
containing 0.056 g/mL of freshly prepared, tetraethyl orthosilicate precursor was added. The
solution was then stirred overnight (20 h) at room temperature, and 1 mL of absolute ethanol was
then added to precipitate the particles from the micro emulsion. This solution was centrifuged at
11,000 rpm for 30 min. The supernatant was discarded; the pellet was washed at least 2 times
with absolute ethanol, then dispersed in 80% ethanol (in DI water), and stored at 4°C. After one
![Page 137: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/137.jpg)
118
day, fresh (3-Aminopropyl)triethoxysilane (APTES) was added to the silica solution. This
solution was stirred for 2 hr., and then heated to boiling temperature where it was held for 4
hours (additional 80% ethanol was added, as needed, to maintain volume). Five cycles of
centrifugation and re-dispersion in pure ethanol were performed to remove any residual
reactants.
THPC-stabilized gold solution synthesis
To a flask containing 45 mL of water, 0.5 mL of freshly prepared 1 M NaOH and 1 mL
of Tetrakis(hydroxymethyl)phosphonium chloride (THPC) (12 µL of 80% THPC in water) were
added. The mixture was stirred for 5 min and then 10 mL of 5 mM HAuCl4 was added. A color
change from yellow to dark brown indicated the formation of THPC-gold.
Particle Seeding
To a 50 mL volume of THPC-stabilized gold, 500 µL of the amino-silica coated particles
was added; the mixture was stirred, and after 1 hour, the solution was centrifuged and the pellet
redispersed in DI water. The “seeded” solution was centrifuged a second time, then redispersed
in 40 mL of water.
Synthesis of LPA
(R)-Lipoic acid (3 g, 4.85 mmol) was dissolved in dry dichloromethane (50 mL) followed
by the addition of propargyl amine (933 µL, 4.85 mmol). The solution was cooled to 0°C in an
ice bath, and N,N'-dicyclohexylcarbodiimide (DCC) (27 g, 14.55 mmol) was added in one
portion. After 3 hours, an additional 10 g DCC was added. The reaction was stirred overnight
and warmed to room temperature, filtered through paper to remove DCU, and concentrated. The
crude product was re-dissolved in dichloromethane and filtered (3x) to completely remove DCU,
purified on a silica gel column, and eluted with 50% ethyl acetate/petroleum ether. 1H NMR
![Page 138: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/138.jpg)
119
(399 MHz, CDCl3) δ 5.67 (s, 1H), 4.05 (dd, J = 5.1, 2.5 Hz, 2H), 3.57 (dt, J = 12.7, 6.4 Hz, 1H),
3.22 – 3.06 (m, 2H), 2.46 (dt, J = 12.2, 6.5 Hz, 1H), 2.25 – 2.17 (m, 4H), 1.91 (dt, J = 19.8, 6.9
Hz, 2H), 1.57 – 1.38 (m, 4H). 13C NMR (100 MHz, CDCl3) δ 172.52, 79.78, 71.90, 56.62,
40.49, 38.72, 36.37, 34.84, 29.42, 29.10, 25.42.
Gold Shell Growth
To 40 mL of water, 500 µL (20 mg/mL) of K2CO3 aqueous solution was added; the
solution was stirred for 10 min, then 600 µL of 1% HAuCl4 solution was added, and it was
stirred again for 30 min. To this, 2 mL (5 mg/mL) of “seeded” particles were then added with 10
µL of 2.5 g/mL aqueous NH2OH, and the solution was gently rocked for 1 min. Then, 100 µL of
10 mg/mL mPEG2000-SH, and 5 µL of 100 mg/mL LPA in DMSO were added before shaking
for 24 hr.
Dynamic Light Scattering
The manufacturer’s protocol (Malvern Instruments) was followed and results were
recorded as intensity-weighted scans.
MRI contrast enhancement
Flame-sealed glass tubes containing water with various concentrations of SC-SPIONs
were suspended in a 1 % (w/v) agarose gel solution, which was used as a tissue phantom
following solidification. SC-SPIONs were diluted in water logarithmically, in a concentration
range of 1 nM to 1 mM. T2 was determined on a Bruker 7T MRI machine, by varying TE and
keeping TR constant with a standard gradient eco sequence, Multi-Slice-Multi-Eco. T1 was
determined by keeping TE constant and varying TR with a RARE sequence.
![Page 139: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/139.jpg)
120
Schema
Scheme 1: fLPA-SPIO@AuNS Synthetic Scheme.
a) 1) 10 nm SPIO particles are coated with silica, 2) the silica is functionalized with a monolayer
of para-amino silica, 3) 2 nm gold nanoparticles are seeded to provide nucleation sites for shell
growth, 4) gold is reduced to grow a shell on the SPIO-core, silica coated nanoparticles. b)
Dihydrolipoic acid propargyl amide is absorbed on the gold surface and click chemistry is used
to attach, in this case, an MGL inhibitor.
![Page 140: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/140.jpg)
121
Scheme 2: Agar phantoms for MRI contrast enhancement.
Sample solutions were prepared in H2O and placed in flame-sealed NMR tubes at varying
concentrations. These tubes were then embedded in a 1 % (w/v) agarose gel solution and slices
were analyzed for MRI contrast enhancement.
![Page 141: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/141.jpg)
122
Figures
Fig. 1. TEM micrographs of oleic acid stabilized Fe3O4 (SPIO) particles.
Representative images showing hydrophobic SPIO core particles with an average diameter of 10
nm. White lines show physical particle size as measured by the image processing software.
[Insets: image scale and magnification]
![Page 142: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/142.jpg)
123
Fig. 2. TEM micrographs of SiO2-NH2 coated Fe3O4 (SPIO) particles (Core-Shell) and
“seeded” particles.
Representative images showing a particle size (average diameter) of 40 nm. Black arrows
designate 2 nm gold nanoparticles beginning to adhere to the surface of the particles to provide a
nucleation site for gold shell growth. White lines show physical particle size as measured by the
image processing software. The lower images show completely seeded particles. [Insets: image
scale and magnification]
![Page 143: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/143.jpg)
124
Fig. 3. Dynamic light scattering analysis of SPIO-NH2 and seeded nanoparticles.
a) The measured hydrodynamic diameter for SPIO-NH2 particles was 135.8 nm with a
polydispersity index of 0.005. b) The measured hydrodynamic diameter for AuNP seeded SPIO-
NH2 particles was 136.6 nm with a polydispersity index of 0.005. AuNP seeding does not affect
hydrodynamic diameter for this population of particles.
![Page 144: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/144.jpg)
125
Fig. 4. Dynamic light scattering analysis of fLPA-SPIO@AuNS particles.
Surfactant ratio and abundance determines the hydrodynamic size of fLPA-SPIO@AuNS
particles during gold shell growth/functionalization. In black, a 2/1 ratio of LPA to SH-PEG in
water produced the smallest particles and represents the most surfactant. This sample showed
had the highest PDI. In red, a 1/1 ratio of LPA to SH-PEG in water produced intermediate
particles. In blue, a 1/1 ratio of LPA to SH-PEG in 50 % DMSO produced the largest particles. It
is possible that LPA has higher solubility in DMSO than on the surface of SPIO@AuNS
particles.
DLS of AuNSs
90 110 130 1500
20
40
60
80
100
1:1 (LPA:SH-PEG)in 1:1 (H2O:DMSO)
1:1 (LPA:SH-PEG)in H2O
2:1 (LPA:SH-PEG)in H2O
138.893.9 111.2
PDI=0.030 PDI=0.005 PDI=0.005
Hydrodynamic Diameter (nm)
Inte
nsit
y
![Page 145: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/145.jpg)
126
Fig. 5. Magnetic resonance images of SC-SPIONs.
a) A representative slice image of SC-SPIONs with varying contrast. b) Signal intensity vs. time
for SC-SPIONs of varying concentration (1 nM – 1 mM) showing a dose-dependent
enhancement of T2 relaxation (contrast enhancement) c) Mean T2 vs SC-SPION concentration.
T2 darkening below 100 msec is considered clinically relevant.
![Page 146: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/146.jpg)
127
Acknowledgements
Michael Johnsona, Codi Gharagouzloob, Dattatri Nageshab,c, Rajiv Kumarc, David R. Janeroa,
Alexandros Makriyannisa, Srinivas Sridhar*,b,c
a Center for Drug Discovery, Department of Pharmaceutical Sciences, Northeastern University,
Boston, MA 02115
b IGERT NSF/NCI Center for Nanomedicine Science and Technology, Northeastern University,
Boston, MA 02115
c Electronic Materials Research Institute, Department of Physics, Northeastern University,
Boston, MA 02115
* To whom correspondence should be addressed
Tel.: +1- (617)-373-2930; e-mail: [email protected]
![Page 147: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/147.jpg)
128
Chapter 6
Conclusions
![Page 148: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/148.jpg)
129
Conclusions
This work has contributed significantly to the understanding of a key regulatory pathway
involved in breast cancer progression (as well as other disease states). First, the characterization
of the nanodisc model through the use of NMR spectroscopy demonstrated that hMGL associates
with nanodiscs. This finding was confirmed through the use of copurification of (-)MSP ND in
complex with 6-his tagged MGL. This complex is formed with a stoichiometry of 1 ND-MGL
for every 6 discs assembled. This population of excess empty discs drives MGL to remain in
complex, rather than dissociating from the membrane. Additionally, determination of the length
of time required for complex formation between blank NDs and detergent-free WT hMGL in
solution provided us with yet another method for incorporating MGL in NDs, which allowed us
to examine the impact of phospholipid bilayers on MGL without the confounding data free MGL
may have provided.
Next, we used biochemical, HX MS, and computational approaches to measure the
impact of a phospholipid bilayer on the kinetic properties, and conformational dynamics of
MGL, successfully providing the first detailed study of this interaction. We demonstrated that an
area within MGL’s lid domain associates through hydrophobic interactions with the membrane,
and this association enhances the enzyme’s catabolic kinetics. Using HX MS and MD simulation
we determined that for hMGL, the lid-domain helix α4, and the distal helix α6 associated with
the membrane directly, stabilizing an open (active) conformation. Upon inhibition
(carbamylation) with AM6580, several regions of the active site of hMGL showed less
deuterium exchange. The dynamic shift in response to this covalent inhibitor provided data that
can lead to the design of novel hMGL carbamylating agents. More generally, this work
demonstrated the suitability of peptide-level HX MS for the analysis of membrane associated
![Page 149: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/149.jpg)
130
protein dynamics, and the nanodisc membrane model, for investigating the structure-function
relationship of this interaction.
Following the successful analysis of MGL in the ND model, catalytically active full
length rFAAH was successfully expressed, purified, and incorporated into NDs. This represents
the first experiment where a mammalian amidase, serine hydrolase was studied using this model.
The protocols used for isolating the membrane-protein pool, and for ND-rFAAH formation, are
generalizable to other hydrophobic mammalian recombinant proteins expressed in E. coli. The
subsequent analysis of the in-solution protein dynamics for rFAAH reviled areas of high
exchange, and zero to low exchange over the four hour time period used. Notably, the lack of
exchange in the active site domain, and the transmembrane domain support previous findings
that these hydrophobic regions interact directly with the membrane, and are not accessible to the
cytosol.20 Additionally this suggested that in solution, rFAAH may exist as a dimer imbedded
within detergent micelles. This makes rFAAH an excellent target for further analysis in the
higher fidelity ND membrane model.
Next, we characterized AM3506-inhibited hMGL and ΔTM-rFAAH via comprehensive
mass spectrometric (MS) analysis. We showed that AM3506-based inhibition of MGL occurs
through sulfonylation of the catalytic serine (Ser122), followed by a His121 mediated β-elimination
reaction that resulted in desulfonylation of the inactivated enzyme and the subsequent formation
of a dehydroalanine122 residue. To confirm the formation of dehydroalanine, a Michael acceptor,
we performed conjugate addition (Michael reaction) using the activated thiols, thiophenol and
betamercaptoethanol as nucleophiles. A comparison of the spectra of the tryptic digest from
untreated and thiol-treated hMGL confirmed the addition of these thiols to dehydroalanine122.
Additionally, intact hMGL pretreated with AM3506, incubated with thiophenol showed a peak
![Page 150: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/150.jpg)
131
with an average mass of 34215.2 Da (+91.6 Da), a mass consistent with the formation of S-
phenyl cysteine and the consequent calculated mass increase of 92.1 Da.
To provide evidence that His121 is essential in directing the desulfonylation, we
expressed and purified mutant H121S hMGL and treated it with AM3506. We did not observe
any new peptides attributable to the β-elimination mechanism. Similarly, we did not observe any
peptides attributable to β-elimination in AM3506-treated ΔTM-rFAAH which lacks any histidine
residues adjacent to the catalytic serine. We analyze a ΔTM-rFAAH I250H single mutant in the
attempt to induce β-elimination, but the mutant was catalytically silent.
Our discovery that the path of desulfonylation in AM3506-treated hMGL occurred via β-
elimination due to a specific histidine residue outside of the catalytic triad presents a selective
approach for the modification of serine hydrolases to confer new function without genetic
manipulation. Subsequent nucleophilic additions to α,β-unsaturated dehydroalanine-serine
hydrolases represents a novel, selective approach for labeling these proteins which are potential
biomarkers for certain cancers.
Following this, another approach for targeting and treating aggressive cancers was
developed. The fLPA-SPIO@AuNS nanoplatform, which could be coupled to a targeting moiety
such as an MGL or FAAH inhibitor, in order to deliver this agent to aggressive breast cancer
cells. This nanoplatform acted as a T2 contrast enhancing agent for MRI, and could be used for
hyperthermal ablation therapy. Development of this platform opened the door to a plethora of
targeting, therapeutic, and diagnostic imaging agents that could be bioconjugated via click
chemistry to this nanomedical agent. Additionally, by adjusting the size of this platform, the
optical and chemical properties can be tuned for specific applications. Due to the size of these
![Page 151: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/151.jpg)
132
particles, even in the absence of additional targeting agents, bioaccumulation in tumor cells
would be expected due to the enhanced permeability and retention (EPR) effect172 for
nanoparticles under 200 nm in physical and hydrodynamic size. This makes the fLPA-
SPIO@AuNS platform an attractive launchpad for future drug discovery and development.
The results of this work contribute significantly to the understanding of endocannabinoid-
hydrolyzing enzymes, which modulate key regulatory pathways involved in breast cancer
progression (as well as other disease states). This work has additionally opened the door for the
further development of a novel, nanomedical, pharmacologic intervention for the diagnosis and
treatment of metastatic disease.
![Page 152: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/152.jpg)
133
References
1 Altekruse SF, K. C., Krapcho M, Neyman N, Aminou R, Waldron W, Ruhl J, Howlader
N, Tatalovich Z, Cho H, Mariotto A, Eisner MP, Lewis DR, Cronin K, Chen HS, Feuer
EJ, Stinchcomb DG, Edwards BK (eds). SEER Cancer Statistics Review, 1975-2007.
(2010).
2 Nomura, D. K. et al. Monoacylglycerol lipase regulates a fatty acid network that
promotes cancer pathogenesis. Cell 140, 49-61, doi:10.1016/j.cell.2009.11.027 (2010).
3 Karlsson, M., Contreras, J. A., Hellman, U., Tornqvist, H. & Holm, C. cDNA cloning,
tissue distribution, and identification of the catalytic triad of monoglyceride lipase.
Evolutionary relationship to esterases, lysophospholipases, and haloperoxidases. J Biol
Chem 272, 27218-27223 (1997).
4 Tornqvist, H. & Belfrage, P. Purification and some properties of a monoacylglycerol-
hydrolyzing enzyme of rat adipose tissue. J Biol Chem 251, 813-819 (1976).
5 MGLL monoglyceride lipase [Homo sapiens (human)] - Gene - NCBI,
<http://www.ncbi.nlm.nih.gov/pubmed/> (2014).
6 Dinh, T. P., Freund, T. F. & Piomelli, D. A role for monoglyceride lipase in 2-
arachidonoylglycerol inactivation. Chem Phys Lipids 121, 149-158 (2002).
7 Murataeva, N., Straiker, A. & Mackie, K. Parsing the players: 2-arachidonoylglycerol
synthesis and degradation in the CNS. Br J Pharmacol 171, 1379-1391,
doi:10.1111/bph.12411 (2014).
8 Guindon, J., Guijarro, A., Piomelli, D. & Hohmann, A. G. Peripheral antinociceptive
effects of inhibitors of monoacylglycerol lipase in a rat model of inflammatory pain. Br J
Pharmacol 163, 1464-1478, doi:10.1111/j.1476-5381.2010.01192.x (2011).
9 Ghosh, S. et al. The monoacylglycerol lipase inhibitor JZL184 suppresses inflammatory
pain in the mouse carrageenan model. Life Sci 92, 498-505, doi:10.1016/j.lfs.2012.06.020
(2013).
10 Comelli, F., Giagnoni, G., Bettoni, I., Colleoni, M. & Costa, B. The inhibition of
monoacylglycerol lipase by URB602 showed an anti-inflammatory and anti-nociceptive
effect in a murine model of acute inflammation. Br J Pharmacol 152, 787-794,
doi:10.1038/sj.bjp.0707425 (2007).
11 Kinsey, S. G. et al. Inhibition of monoacylglycerol lipase attenuates nonsteroidal anti-
inflammatory drug-induced gastric hemorrhages in mice. J Pharmacol Exp Ther 338,
795-802, doi:10.1124/jpet.110.175778 (2011).
12 Melis, M. et al. Protective activation of the endocannabinoid system during ischemia in
dopamine neurons. Neurobiol Dis 24, 15-27, doi:10.1016/j.nbd.2006.04.010 (2006).
13 Sciolino, N. R., Zhou, W. & Hohmann, A. G. Enhancement of endocannabinoid signaling
with JZL184, an inhibitor of the 2-arachidonoylglycerol hydrolyzing enzyme
monoacylglycerol lipase, produces anxiolytic effects under conditions of high
environmental aversiveness in rats. Pharmacol Res 64, 226-234,
doi:10.1016/j.phrs.2011.04.010 (2011).
14 Sticht, M. A. et al. Inhibition of monoacylglycerol lipase attenuates vomiting in Suncus
murinus and 2-arachidonoyl glycerol attenuates nausea in rats. Br J Pharmacol 165,
2425-2435, doi:10.1111/j.1476-5381.2011.01407.x (2012).
![Page 153: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/153.jpg)
134
15 Nithipatikom, K. et al. A new class of inhibitors of 2-arachidonoylglycerol hydrolysis
and invasion of prostate cancer cells. Biochem Biophys Res Commun 332, 1028-1033,
doi:10.1016/j.bbrc.2005.05.049 (2005).
16 Boger, D. L. et al. Fatty acid amide hydrolase substrate specificity. Bioorg Med Chem
Lett 10, 2613-2616 (2000).
17 Deutsch, D. G. & Chin, S. A. Enzymatic synthesis and degradation of anandamide, a
cannabinoid receptor agonist. Biochem Pharmacol 46, 791-796 (1993).
18 Di Marzo, V., Bisogno, T., Sugiura, T., Melck, D. & De Petrocellis, L. The novel
endogenous cannabinoid 2-arachidonoylglycerol is inactivated by neuronal- and
basophil-like cells: connections with anandamide. Biochem J 331 ( Pt 1), 15-19 (1998).
19 Ross, R. A. Anandamide and vanilloid TRPV1 receptors. Br J Pharmacol 140, 790-801,
doi:10.1038/sj.bjp.0705467 (2003).
20 Bracey, M. H., Hanson, M. A., Masuda, K. R., Stevens, R. C. & Cravatt, B. F. Structural
adaptations in a membrane enzyme that terminates endocannabinoid signaling. Science
298, 1793-1796, doi:10.1126/science.1076535 (2002).
21 Patricelli, M. P., Lashuel, H. A., Giang, D. K., Kelly, J. W. & Cravatt, B. F. Comparative
characterization of a wild type and transmembrane domain-deleted fatty acid amide
hydrolase: identification of the transmembrane domain as a site for oligomerization.
Biochemistry 37, 15177-15187, doi:10.1021/bi981733n
22 Mileni, M. et al. Crystal structure of fatty acid amide hydrolase bound to the carbamate
inhibitor URB597: discovery of a deacylating water molecule and insight into enzyme
inactivation. J Mol Biol 400, 743-754, doi:10.1016/j.jmb.2010.05.034 (2010).
23 Blankman, J. L., Simon, G. M. & Cravatt, B. F. A comprehensive profile of brain
enzymes that hydrolyze the endocannabinoid 2-arachidonoylglycerol. Chem Biol 14,
1347-1356, doi:10.1016/j.chembiol.2007.11.006 (2007).
24 Nasr, M. L. et al. Membrane phospholipid bilayer as a determinant of monoacylglycerol
lipase kinetic profile and conformational repertoire. Protein Sci 22, 774-787,
doi:10.1002/pro.2257 (2013).
25 Bayburt, T. H., Grinkova, Y. V. & Sligar, S. G. Assembly of single bacteriorhodopsin
trimers in bilayer nanodiscs. Arch Biochem Biophys 450, 215-222,
doi:10.1016/j.abb.2006.03.013 (2006).
26 Bayburt, T. H. & Sligar, S. G. in Protein Sci Vol. 12 2476-2481 (2003).
27 Malhotra, K. & Alder, N. N. Advances in the use of nanoscale bilayers to study
membrane protein structure and function. Biotechnol Genet Eng Rev 30, 79-93,
doi:10.1080/02648725.2014.921502 (2014).
28 Seddon, A. M., Curnow, P. & Booth, P. J. Membrane proteins, lipids and detergents: not
just a soap opera. Biochim Biophys Acta 1666, 105-117,
doi:10.1016/j.bbamem.2004.04.011 (2004).
29 Mitra, N. et al. Calcium Dependent Ligand Binding and G-protein Signaling of Family B
GPCR Parathyroid Hormone 1 Receptor Purified in Nanodiscs. ACS Chem Biol 8, 617-
625, doi:10.1021/cb300466n (2013).
30 Leitz, A. J., Bayburt, T. H., Barnakov, A. N., Springer, B. A. & Sligar, S. G. Functional
reconstitution of Beta2-adrenergic receptors utilizing self-assembling Nanodisc
technology. Biotechniques 40, 601-602, 604, 606, passim (2006).
![Page 154: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/154.jpg)
135
31 Alami, M., Dalal, K., Lelj-Garolla, B., Sligar, S. G. & Duong, F. in EMBO J Vol. 26
1995-2004 (2007).
32 Frauenfeld, J. et al. Cryo-EM structure of the ribosome-SecYE complex in the membrane
environment. Nat Struct Mol Biol 18, 614-621, doi:10.1038/nsmb.2026 (2011).
33 Grinkova, Y. V. et al. The ferrous-oxy complex of human aromatase. Biochem Biophys
Res Commun 372, 379-382, doi:10.1016/j.bbrc.2008.05.011 (2008).
34 Luthra, A., Gregory, M., Grinkova, Y. V., Denisov, I. G. & Sligar, S. G. Nanodiscs in the
studies of membrane-bound cytochrome P450 enzymes. Methods Mol Biol 987, 115-127,
doi:10.1007/978-1-62703-321-3_10 (2013).
35 Denisov, I. G. & Sligar, S. G. Cytochromes P450 in nanodiscs. Biochim Biophys Acta
1814, 223-229, doi:10.1016/j.bbapap.2010.05.017 (2011).
36 Borch, J., Torta, F., Sligar, S. G. & Roepstorff, P. Nanodiscs for immobilization of lipid
bilayers and membrane receptors: kinetic analysis of cholera toxin binding to a glycolipid
receptor. Anal Chem 80, 6245-6252, doi:10.1021/ac8000644 (2008).
37 Morrissey, J. et al. Protein-membrane interactions: Blood clotting on nanoscale bilayers.
J Thromb Haemost 7, 169-172, doi:10.1111/j.1538-7836.2009.03390.x (2009).
38 Wallin, E. & von Heijne, G. Genome-wide analysis of integral membrane proteins from
eubacterial, archaean, and eukaryotic organisms. Protein Sci 7, 1029-1038,
doi:10.1002/pro.5560070420 (1998).
39 Pawley, N. H., Gans, J. D. & Nicholson, L. K. Factors determining the reliable
description of global tumbling parameters in solution NMR. J Biomol NMR 24, 215-229
(2002).
40 Yu, Z., Reid, J. C. & Yang, Y. P. Utilizing dynamic light scattering as a process
analytical technology for protein folding and aggregation monitoring in vaccine
manufacturing. J Pharm Sci 102, 4284-4290, doi:10.1002/jps.23746 (2013).
41 Hulse, W. L., Gray, J. & Forbes, R. T. Evaluating the inter and intra batch variability of
protein aggregation behaviour using Taylor dispersion analysis and dynamic light
scattering. Int J Pharm 453, 351-357, doi:10.1016/j.ijpharm.2013.05.062 (2013).
42 Li, Y., Lubchenko, V. & Vekilov, P. G. The use of dynamic light scattering and brownian
microscopy to characterize protein aggregation. Rev Sci Instrum 82, 053106,
doi:10.1063/1.3592581 (2011).
43 Rubin, J., San Miguel, A., Bommarius, A. S. & Behrens, S. H. Correlating aggregation
kinetics and stationary diffusion in protein-sodium salt systems observed with dynamic
light scattering. J Phys Chem B 114, 4383-4387, doi:10.1021/jp912126w (2010).
44 Simpanya, M. F., Ansari, R. R., Leverenz, V. & Giblin, F. J. Measurement of lens protein
aggregation in vivo using dynamic light scattering in a guinea pig/UVA model for
nuclear cataract. Photochem Photobiol 84, 1589-1595, doi:10.1111/j.1751-
1097.2008.00390.x (2008).
45 Lyutova, E. M., Kasakov, A. S. & Gurvits, B. Y. Effects of arginine on kinetics of protein
aggregation studied by dynamic laser light scattering and tubidimetry techniques.
Biotechnol Prog 23, 1411-1416, doi:10.1021/bp070209h (2007).
46 Panyukov, Y., Yudin, I., Drachev, V., Dobrov, E. & Kurganov, B. The study of
amorphous aggregation of tobacco mosaic virus coat protein by dynamic light scattering.
Biophys Chem 127, 9-18, doi:10.1016/j.bpc.2006.11.006 (2007).
![Page 155: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/155.jpg)
136
47 Schalk-Hihi, C. et al. Crystal structure of a soluble form of human monoglyceride lipase
in complex with an inhibitor at 1.35 A resolution. Protein Sci 20, 670-683,
doi:10.1002/pro.596 (2011).
48 Timothy H. Bayburt, Y. V. G., and Stephen G. Sligar. Self-Assembly of Discoidal
Phospholipid Bilayer Nanoparticles with Membrane Scaffold Proteins. Nano Letters 2,
853-856, doi:S1530-6984(02)05623-0 (2002).
49 Karageorgos, I. et al. Identification by nuclear magnetic resonance spectroscopy of an
active-site hydrogen-bond network in human monoacylglycerol lipase (hMGL):
implications for hMGL dynamics, pharmacological inhibition, and catalytic mechanism.
Mol Biosyst 6, 1381-1388, doi:10.1039/c004515b (2010).
50 Long, J. Z. & Cravatt, B. F. The metabolic serine hydrolases and their functions in
mammalian physiology and disease. Chem Rev 111, 6022-6063, doi:10.1021/cr200075y
(2011).
51 Dinh, T. P., Kathuria, S. & Piomelli, D. RNA interference suggests a primary role for
monoacylglycerol lipase in the degradation of the endocannabinoid 2-
arachidonoylglycerol. Mol Pharmacol 66, 1260-1264, doi:10.1124/mol.104.002071
(2004).
52 Savinainen, J. R., Saario, S. M. & Laitinen, J. T. The serine hydrolases MAGL, ABHD6
and ABHD12 as guardians of 2-arachidonoylglycerol signalling through cannabinoid
receptors. Acta Physiol (Oxf) 204, 267-276, doi:10.1111/j.1748-1716.2011.02280.x
(2012).
53 Janero, D. R., Vadivel, S. K. & Makriyannis, A. Pharmacotherapeutic modulation of the
endocannabinoid signalling system in psychiatric disorders: drug-discovery strategies. Int
Rev Psychiatry 21, 122-133, doi:10.1080/09540260902782778 (2009).
54 Bermudez-Silva, F. J., Cardinal, P. & Cota, D. The role of the endocannabinoid system in
the neuroendocrine regulation of energy balance. J Psychopharmacol 26, 114-124,
doi:10.1177/0269881111408458 (2012).
55 Schlosburg, J. E. et al. Chronic monoacylglycerol lipase blockade causes functional
antagonism of the endocannabinoid system. Nat Neurosci 13, 1113-1119,
doi:10.1038/nn.2616 (2010).
56 Fowler, C. J. Monoacylglycerol lipase - a target for drug development? Br J Pharmacol
166, 1568-1585, doi:10.1111/j.1476-5381.2012.01950.x (2012).
57 Mulvihill, M. M. & Nomura, D. K. Therapeutic potential of monoacylglycerol lipase
inhibitors. Life Sci 92, 492-497, doi:10.1016/j.lfs.2012.10.025 (2013).
58 Aloulou, A. et al. Exploring the specific features of interfacial enzymology based on
lipase studies. Biochim Biophys Acta 1761, 995-1013, doi:10.1016/j.bbalip.2006.06.009
(2006).
59 Rehm, S., Trodler, P. & Pleiss, J. Solvent-induced lid opening in lipases: a molecular
dynamics study. Protein Sci 19, 2122-2130, doi:10.1002/pro.493 (2010).
60 Derewenda, Z. S., Derewenda, U. & Dodson, G. G. The crystal and molecular structure
of the Rhizomucor miehei triacylglyceride lipase at 1.9 A resolution. J Mol Biol 227,
818-839 (1992).
61 Derewenda, U. et al. Conformational lability of lipases observed in the absence of an oil-
water interface: crystallographic studies of enzymes from the fungi Humicola lanuginosa
and Rhizopus delemar. J Lipid Res 35, 524-534 (1994).
![Page 156: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/156.jpg)
137
62 Di Marzo, V. et al. Biosynthesis and inactivation of the endocannabinoid 2-
arachidonoylglycerol in circulating and tumoral macrophages. Eur J Biochem 264, 258-
267 (1999).
63 Duncan, M. et al. Distribution and function of monoacylglycerol lipase in the
gastrointestinal tract. Am J Physiol Gastrointest Liver Physiol 295, G1255-1265,
doi:10.1152/ajpgi.90500.2008 (2008).
64 Labar, G. et al. Crystal structure of the human monoacylglycerol lipase, a key actor in
endocannabinoid signaling. Chembiochem 11, 218-227, doi:10.1002/cbic.200900621
(2010).
65 Bertrand, T. et al. Structural basis for human monoglyceride lipase inhibition. J Mol Biol
396, 663-673, doi:10.1016/j.jmb.2009.11.060 (2010).
66 Nath, A., Atkins, W. M. & Sligar, S. G. Applications of phospholipid bilayer nanodiscs
in the study of membranes and membrane proteins. Biochemistry 46, 2059-2069,
doi:10.1021/bi602371n (2007).
67 Garavito, R. M. & Ferguson-Miller, S. Detergents as tools in membrane biochemistry. J
Biol Chem 276, 32403-32406, doi:10.1074/jbc.R100031200 (2001).
68 Chou, J. J., Kaufman, J. D., Stahl, S. J., Wingfield, P. T. & Bax, A. Micelle-induced
curvature in a water-insoluble HIV-1 Env peptide revealed by NMR dipolar coupling
measurement in stretched polyacrylamide gel. J Am Chem Soc 124, 2450-2451 (2002).
69 Marcsisin, S. R. & Engen, J. R. Hydrogen exchange mass spectrometry: what is it and
what can it tell us? Anal Bioanal Chem 397, 967-972, doi:10.1007/s00216-010-3556-4
(2010).
70 Ho, B. K., Perahia, D. & Buckle, A. M. Hybrid approaches to molecular simulation. Curr
Opin Struct Biol 22, 386-393, doi:10.1016/j.sbi.2012.05.005 (2012).
71 Borch, J. & Hamann, T. The nanodisc: a novel tool for membrane protein studies. Biol
Chem 390, 805-814, doi:10.1515/bc.2009.091 (2009).
72 Ritchie, T. K. et al. Chapter 11 - Reconstitution of membrane proteins in phospholipid
bilayer nanodiscs. Methods Enzymol 464, 211-231, doi:10.1016/s0076-6879(09)64011-8
(2009).
73 Wang, L. Measurements and implications of the membrane dipole potential. Annu Rev
Biochem 81, 615-635, doi:10.1146/annurev-biochem-070110-123033 (2012).
74 Zvonok, N. et al. Full mass spectrometric characterization of human monoacylglycerol
lipase generated by large-scale expression and single-step purification. J Proteome Res 7,
2158-2164, doi:10.1021/pr700839z (2008).
75 Karageorgos, I. et al. Endocannabinoid enzyme engineering: soluble human thio-
monoacylglycerol lipase (sol-S-hMGL). ACS Chem Neurosci 3, 393-399,
doi:10.1021/cn3000263 (2012).
76 Diaz, J. C., Cordova, J., Baratti, J., Carriere, F. & Abousalham, A. Effect of nonionic
surfactants on Rhizopus homothallicus lipase activity: a comparative kinetic study. Mol
Biotechnol 35, 205-214 (2007).
77 Reis, P., Holmberg, K., Watzke, H., Leser, M. E. & Miller, R. Lipases at interfaces: a
review. Adv Colloid Interface Sci 147-148, 237-250, doi:10.1016/j.cis.2008.06.001
(2009).
78 Carr, P. D. & Ollis, D. L. Alpha/beta hydrolase fold: an update. Protein Pept Lett 16,
1137-1148 (2009).
![Page 157: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/157.jpg)
138
79 Bowman, A. L. & Makriyannis, A. Refined homology model of monoacylglycerol lipase:
toward a selective inhibitor. J Comput Aided Mol Des 23, 799-806, doi:10.1007/s10822-
009-9289-9 (2009).
80 Kalgutkar, A. S. & Dalvie, D. K. Drug discovery for a new generation of covalent drugs.
Expert Opin Drug Discov 7, 561-581, doi:10.1517/17460441.2012.688744 (2012).
81 Baas, B. J., Denisov, I. G. & Sligar, S. G. Homotropic cooperativity of monomeric
cytochrome P450 3A4 in a nanoscale native bilayer environment. Arch Biochem Biophys
430, 218-228, doi:10.1016/j.abb.2004.07.003 (2004).
82 Denisov, I. G., Grinkova, Y. V., Lazarides, A. A. & Sligar, S. G. Directed self-assembly
of monodisperse phospholipid bilayer Nanodiscs with controlled size. J Am Chem Soc
126, 3477-3487, doi:10.1021/ja0393574 (2004).
83 Wales, T. E. & Engen, J. R. Hydrogen exchange mass spectrometry for the analysis of
protein dynamics. Mass Spectrom Rev 25, 158-170, doi:10.1002/mas.20064 (2006).
84 Zhang, Z. & Smith, D. L. Determination of amide hydrogen exchange by mass
spectrometry: a new tool for protein structure elucidation. Protein Sci 2, 522-531 (1993).
85 Hebling, C. M. et al. Conformational Analysis of Membrane Proteins in Phospholipid
Bilayer Nanodiscs by Hydrogen Exchange Mass Spectrometry. doi:10.1021/ac100962c
(2010).
86 Houde, D., Berkowitz, S. A. & Engen, J. R. The utility of hydrogen/deuterium exchange
mass spectrometry in biopharmaceutical comparability studies. J Pharm Sci 100, 2071-
2086, doi:10.1002/jps.22432 (2011).
87 Marcsisin, S. R. et al. On the solution conformation and dynamics of the HIV-1 viral
infectivity factor. J Mol Biol 410, 1008-1022, doi:10.1016/j.jmb.2011.04.053 (2011).
88 Kukol, A. Lipid Models for United-Atom Molecular Dynamics Simulations of Proteins.
doi:10.1021/ct8003468 (2009).
89 Janosi, L. & Gorfe, A. A. Simulating POPC and POPC/POPG Bilayers: Conserved
Packing and Altered Surface Reactivity. doi:10.1021/ct100381g (2010).
90 Trotter, B. W. et al. Imidazopyridine CB2 agonists: optimization of CB2/CB1 selectivity
and implications for in vivo analgesic efficacy. Bioorg Med Chem Lett 21, 2354-2358,
doi:10.1016/j.bmcl.2011.02.082 (2011).
91 Malde, A. K. et al. An Automated Force Field Topology Builder (ATB) and Repository:
Version 1.0. doi:10.1021/ct200196m (2011).
92 Lomize, M. A., Lomize, A. L., Pogozheva, I. D. & Mosberg, H. I. OPM: Orientations of
Proteins in Membranes database. doi:10.1093/bioinformatics/btk023 (2006).
93 Lomize, M. A., Pogozheva, I. D., Joo, H., Mosberg, H. I. & Lomize, A. L. OPM database
and PPM web server: resources for positioning of proteins in membranes. Nucleic Acids
Res 40, D370-376, doi:10.1093/nar/gkr703 (2012).
94 Bussi, G., Donadio, D. & Parrinello, M. Canonical sampling through velocity rescaling. J
Chem Phys 126, 014101, doi:10.1063/1.2408420 (2007).
95 Darden, T., York, D. & Pedersen, L. Particle mesh Ewald: An N⋅ log(N) method for
Ewald sums in large systems. Journal of Chemical physics 98, 10089-10092,
doi:doi:10.1063/1.464397 (1993).
96 Essmann, U. et al. A smooth particle mesh Ewald method. Journal of Chemical physics
103, 8577-8593, doi:doi:10.1063/1.470117 (1995).
![Page 158: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/158.jpg)
139
97 Berk Hess, H. B., Herman J.C. Berendsen, Johannes G.E.M. Fraaije. LINCS: A Linear
Constraint Solver for Molecular Simulations. J. Comput. Chem 18, 1463-1472 (1997).
98 Berendsen, H. J. C. et al. Interaction Models for Water in Relation to Protein Hydration.
331-342, doi:10.1007/978-94-015-7658-1_21 (1981).
99 Hess*, B., Kutzner, C., Spoel, D. v. d. & Lindahl, E. GROMACS 4: Algorithms for
Highly Efficient, Load-Balanced, and Scalable Molecular Simulation. J. Chem. Theory
Comput. 4, 435-447, doi:S1549-9618(70)00301-6 (2008).
100 van Gunsteren, W. F., Billeter, S. R., Eising, A. A., Hünenberger, P. H., Krüger, P.,
Mark, A. E., Scott, W. R. P. & Tironi, I. G. Biomolecular Simulation: The
GROMOS96 Manual and User Guide. (1996).
101 Simon, G. M. & Cravatt, B. F. in J Biol Chem Vol. 285 11051-11055 (2010).
102 Palermo, G., Rothlisberger, U., Cavalli, A. & De Vivo, M. Computational insights into
function and inhibition of fatty acid amide hydrolase. Eur J Med Chem,
doi:10.1016/j.ejmech.2014.09.037 (2014).
103 Patricelli, M. P. & Cravatt, B. F. Fatty acid amide hydrolase competitively degrades
bioactive amides and esters through a nonconventional catalytic mechanism.
Biochemistry 38, 14125-14130 (1999).
104 Gonsiorek, W. et al. Endocannabinoid 2-arachidonyl glycerol is a full agonist through
human type 2 cannabinoid receptor: antagonism by anandamide. Mol Pharmacol 57,
1045-1050 (2000).
105 Schmid, P. C., Reddy, P. V., Natarajan, V. & Schmid, H. H. Metabolism of N-
acylethanolamine phospholipids by a mammalian phosphodiesterase of the phospholipase
D type. J Biol Chem 258, 9302-9306 (1983).
106 Cadas, H., di Tomaso, E. & Piomelli, D. Occurrence and biosynthesis of endogenous
cannabinoid precursor, N-arachidonoyl phosphatidylethanolamine, in rat brain. J
Neurosci 17, 1226-1242 (1997).
107 Fowler, C. J., Jonsson, K. O. & Tiger, G. Fatty acid amide hydrolase: biochemistry,
pharmacology, and therapeutic possibilities for an enzyme hydrolyzing anandamide, 2-
arachidonoylglycerol, palmitoylethanolamide, and oleamide. Biochem Pharmacol 62,
517-526 (2001).
108 Boger, D. L. et al. Exceptionally potent inhibitors of fatty acid amide hydrolase: the
enzyme responsible for degradation of endogenous oleamide and anandamide. Proc Natl
Acad Sci U S A 97, 5044-5049 (2000).
109 Cravatt, B. F. et al. Supersensitivity to anandamide and enhanced endogenous
cannabinoid signaling in mice lacking fatty acid amide hydrolase. Proc Natl Acad Sci U S
A 98, 9371-9376, doi:10.1073/pnas.161191698 (2001).
110 Li, H. et al. Inhibition of fatty acid amide hydrolase activates Nrf2 signalling and induces
heme oxygenase 1 transcription in breast cancer cells. Br J Pharmacol 170, 489-505,
doi:10.1111/bph.12111 (2013).
111 Endsley, M. P. et al. Expression and function of fatty acid amide hydrolase in prostate
cancer. Int J Cancer 123, 1318-1326, doi:10.1002/ijc.23674 (2008).
112 Thors, L. et al. Fatty acid amide hydrolase in prostate cancer: association with disease
severity and outcome, CB1 receptor expression and regulation by IL-4. PLoS One 5,
e12275, doi:10.1371/journal.pone.0012275 (2010).
![Page 159: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/159.jpg)
140
113 Ravi, J., Sneh, A., Shilo, K., Nasser, M. W. & Ganju, R. K. FAAH inhibition enhances
anandamide mediated anti-tumorigenic effects in non-small cell lung cancer by
downregulating the EGF/EGFR pathway. Oncotarget 5, 2475-2486 (2014).
114 Masoodi, M. et al. A role for oleoylethanolamide in chronic lymphocytic leukemia.
Leukemia 28, 1381-1387, doi:10.1038/leu.2014.10 (2014).
115 Marty, M. T., Wilcox, K. C., Klein, W. L. & Sligar, S. G. Nanodisc-solubilized
membrane protein library reflects the membrane proteome. Anal Bioanal Chem 405,
4009-4016, doi:10.1007/s00216-013-6790-8 (2013).
116 Ramarao, M. K. et al. A fluorescence-based assay for fatty acid amide hydrolase
compatible with high-throughput screening. Anal Biochem 343, 143-151,
doi:10.1016/j.ab.2005.04.032 (2005).
117 Pacher, P., Batkai, S. & Kunos, G. The endocannabinoid system as an emerging target of
pharmacotherapy. Pharmacol Rev 58, 389-462, doi:10.1124/pr.58.3.2 (2006).
118 Munro, S., Thomas, K. L. & Abu-Shaar, M. Molecular characterization of a peripheral
receptor for cannabinoids. Nature 365, 61-65, doi:10.1038/365061a0 (1993).
119 Lutz, B. Molecular biology of cannabinoid receptors. Prostaglandins Leukot Essent Fatty
Acids 66, 123-142, doi:10.1054/plef.2001.0342 (2002).
120 Ben-Shabat, S. et al. An entourage effect: inactive endogenous fatty acid glycerol esters
enhance 2-arachidonoyl-glycerol cannabinoid activity. Eur J Pharmacol 353, 23-31
(1998).
121 Wartmann, M., Campbell, D., Subramanian, A., Burstein, S. H. & Davis, R. J. The MAP
kinase signal transduction pathway is activated by the endogenous cannabinoid
anandamide. FEBS Lett 359, 133-136 (1995).
122 Jin, W. et al. Distinct domains of the CB1 cannabinoid receptor mediate desensitization
and internalization. J Neurosci 19, 3773-3780 (1999).
123 Mackie, K., Lai, Y., Westenbroek, R. & Mitchell, R. Cannabinoids activate an inwardly
rectifying potassium conductance and inhibit Q-type calcium currents in AtT20 cells
transfected with rat brain cannabinoid receptor. J Neurosci 15, 6552-6561 (1995).
124 Varma, N., Carlson, G. C., Ledent, C. & Alger, B. E. Metabotropic glutamate receptors
drive the endocannabinoid system in hippocampus. J Neurosci 21, Rc188 (2001).
125 Mukhopadhyay, S. & Howlett, A. C. Chemically distinct ligands promote differential
CB1 cannabinoid receptor-Gi protein interactions. Mol Pharmacol 67, 2016-2024,
doi:10.1124/mol.104.003558 (2005).
126 Di Marzo, V. et al. Formation and inactivation of endogenous cannabinoid anandamide
in central neurons. Nature 372, 686-691, doi:10.1038/372686a0 (1994).
127 Mechoulam, R. et al. Identification of an endogenous 2-monoglyceride, present in canine
gut, that binds to cannabinoid receptors. Biochem Pharmacol 50, 83-90 (1995).
128 Sugiura, T. et al. 2-Arachidonoylglycerol: a possible endogenous cannabinoid receptor
ligand in brain. Biochem Biophys Res Commun 215, 89-97 (1995).
129 Herrera, B. et al. The CB2 cannabinoid receptor signals apoptosis via ceramide-
dependent activation of the mitochondrial intrinsic pathway. Exp Cell Res 312, 2121-
2131, doi:10.1016/j.yexcr.2006.03.009 (2006).
130 Saario, S. M., Savinainen, J. R., Laitinen, J. T., Jarvinen, T. & Niemi, R. Monoglyceride
lipase-like enzymatic activity is responsible for hydrolysis of 2-arachidonoylglycerol in
![Page 160: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/160.jpg)
141
rat cerebellar membranes. Biochem Pharmacol 67, 1381-1387,
doi:10.1016/j.bcp.2003.12.003 (2004).
131 Godlewski, G. et al. Inhibitor of fatty acid amide hydrolase normalizes cardiovascular
function in hypertension without adverse metabolic effects. Chem Biol 17, 1256-1266,
doi:10.1016/j.chembiol.2010.08.013 (2010).
132 Gold, A. M. & Fahrney, D. I. Sulfonyl Fluorides as Inhibitors of Esterases. II. Formation
and Reactions of Phenylmethanesulfonyl Alpha-Chymotrypsin. Biochemistry 3, 783-791
(1964).
133 Gold, A. M. SULFONYL FLUORIDES AS INHIBITORS OF ESTERASES. 3.
IDENTIFICATION OF SERINE AS THE SITE OF SULFONYLATION IN
PHENYLMETHANESULFONYL ALPHA-CHYMOTRYPSIN. Biochemistry 4, 897-
901 (1965).
134 Strumeyer, D. H., White, W. N. & Koshland, D. E., Jr. Role of Serine in Chymotrypsin
Action. Conversion of the Active Serine to Dehydroalanine. Proc Natl Acad Sci U S A
50, 931-935 (1963).
135 Zvonok, N. et al. Covalent inhibitors of human monoacylglycerol lipase: ligand-assisted
characterization of the catalytic site by mass spectrometry and mutational analysis. Chem
Biol 15, 854-862, doi:10.1016/j.chembiol.2008.06.008 (2008).
136 Dykman, L. & Khlebtsov, N. Gold nanoparticles in biomedical applications: recent
advances and perspectives. Chem Soc Rev 41, 2256-2282, doi:10.1039/c1cs15166e
(2012).
137 Bao, C. et al. A promising road with challenges: where are gold nanoparticles in
translational research? Nanomedicine (Lond) 9, 2353-2370, doi:10.2217/nnm.14.155
(2014).
138 Khlebtsov, N. & Dykman, L. Biodistribution and toxicity of engineered gold
nanoparticles: a review of in vitro and in vivo studies. Chem Soc Rev 40, 1647-1671,
doi:10.1039/c0cs00018c (2011).
139 Jain, S., Hirst, D. G. & O'Sullivan, J. M. in Br J Radiol Vol. 85 101-113 (2012).
140 Kim, B. Y., Rutka, J. T. & Chan, W. C. Nanomedicine. N Engl J Med 363, 2434-2443,
doi:10.1056/NEJMra0912273 (2010).
141 Rabias, I. et al. Rapid magnetic heating treatment by highly charged maghemite
nanoparticles on Wistar rats exocranial glioma tumors at microliter volume.
Biomicrofluidics 4 (2010).
142 Liu, H. et al. Multifunctional gold nanoshells on silica nanorattles: a platform for the
combination of photothermal therapy and chemotherapy with low systemic toxicity.
Angew Chem Int Ed Engl 50, 891-895, doi:10.1002/anie.201002820 (2011).
143 Ji, X. et al. Bifunctional Gold Nanoshells with a Superparamagnetic Iron Oxide-Silica
Core Suitable for Both MR Imaging and Photothermal Therapy. J Phys Chem C
Nanomater Interfaces 111, 6245, doi:10.1021/jp0702245 (2007).
144 Vogl, T. J., Zegelman, A., Bechstein, W. O., Zeuzem, S. & Zangos, S. [Treatment of liver
metastases of colorectal carcinoma: overview of hyperthermal ablation methods]. Dtsch
Med Wochenschr 138, 792-798, doi:10.1055/s-0032-1332997 (2013).
145 Hadjipanayis, C. G. et al. Metallic Iron Nanoparticles for MRI Contrast Enhancement
and Local Hyperthermia**. Small 4, 1925-1929, doi:10.1002/smll.200800261 (2008).
![Page 161: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/161.jpg)
142
146 Huang, J. et al. Casein-Coated Iron Oxide Nanoparticles for High MRI Contrast
Enhancement and Efficient Cell Targeting. ACS Applied Materials & Interfaces 5, 4632-
4639, doi:10.1021/am400713j (2013).
147 Melancon, M. P. et al. Theranostics with multifunctional magnetic gold nanoshells:
photothermal therapy and t2* magnetic resonance imaging. Invest Radiol 46, 132-140,
doi:10.1097/RLI.0b013e3181f8e7d8 (2011).
148 Banobre-Lopez, M., Teijeiro, A. & Rivas, J. Magnetic nanoparticle-based hyperthermia
for cancer treatment. Rep Pract Oncol Radiother 18, 397-400,
doi:10.1016/j.rpor.2013.09.011 (2013).
149 Schleich, N. et al. Comparison of active, passive and magnetic targeting to tumors of
multifunctional paclitaxel/SPIO-loaded nanoparticles for tumor imaging and therapy. J
Control Release 194c, 82-91, doi:10.1016/j.jconrel.2014.07.059 (2014).
150 Hilger, I. et al. Thermal ablation of tumors using magnetic nanoparticles: an in vivo
feasibility study. Invest Radiol 37, 580-586, doi:10.1097/01.rli.0000028491.19254.ee
(2002).
151 Elsherbini, A. A. M. & El-Shahawy, A. Effect of SPIO Nanoparticle Concentrations on
Temperature Changes for Hyperthermia via MRI. Journal of Nanomaterials 2013,
doi:doi:10.1155/2013/467878 (2013).
152 Ider, Y. Z. & Muftuler, L. T. Measurement of AC magnetic field distribution using
magnetic resonance imaging. IEEE Trans Med Imaging 16, 617-622,
doi:10.1109/42.640752 (1997).
153 Small, W. C., Nelson, R. C. & Bernardino, M. E. Dual contrast enhancement of both T1-
and T2-weighted sequences using ultrasmall superparamagnetic iron oxide. Magn Reson
Imaging 11, 645-654 (1993).
154 Gilad, A. A. et al. Feasibility of concurrent dual contrast enhancement using CEST
contrast agents and superparamagnetic iron oxide particles. Magn Reson Med 61, 970-
974, doi:10.1002/mrm.21928 (2009).
155 Ittrich, H., Peldschus, K., Raabe, N., Kaul, M. & Adam, G. Superparamagnetic iron oxide
nanoparticles in biomedicine: applications and developments in diagnostics and therapy.
Rofo 185, 1149-1166, doi:10.1055/s-0033-1335438 (2013).
156 Sun, Y. & Xia, Y. Increased sensitivity of surface plasmon resonance of gold nanoshells
compared to that of gold solid colloids in response to environmental changes. Anal Chem
74, 5297-5305 (2002).
157 Ji, X. et al. Bifunctional Gold Nanoshells with a Superparamagnetic Iron Oxide-Silica
Core Suitable for Both MR Imaging and Photothermal Therapy. J Phys Chem C
Nanomater Interfaces 111, 6245-6251, doi:10.1021/jp0702245 (2007).
158 Brongersma, M. L. in Nat Mater Vol. 2 296-297 (2003).
159 Ng, V. W. K. et al. Miktoarm star conjugated multifunctional gold nanoshells: synthesis
and an evaluation of biocompatibility and cellular uptake. Journal of Materials Chemistry
B 2, 6334-6344, doi:10.1039/C4TB00722K (2014).
160 Loo, C. et al. Gold nanoshell bioconjugates for molecular imaging in living cells. Opt
Lett 30, 1012-1014 (2005).
161 Roux, S. et al. Synthesis, characterization of dihydrolipoic acid capped gold
nanoparticles, and functionalization by the electroluminescent luminol. Langmuir 21,
2526-2536, doi:10.1021/la048082i (2005).
![Page 162: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/162.jpg)
143
162 Sanchez-Gaytan, B. L. et al. Controlling the Topography and Surface Plasmon
Resonance of Gold Nanoshells by a Templated Surfactant-Assisted Seed Growth
Method. The Journal of Physical Chemistry C 117, 8916-8923, doi:10.1021/jp401189k
(2013).
163 Erickson, T. A. & Tunnell, J. W. in Nanotechnologies for the Life Sciences (Wiley-
VCH Verlag GmbH & Co. KGaA, 2007).
164 Loo, C. et al. Nanoshell-enabled photonics-based imaging and therapy of cancer. Technol
Cancer Res Treat 3, 33-40 (2004).
165 Smith, A. M., Mancini, M. C. & Nie, S. Second window for in vivo imaging. Nat
Nanotechnol 4, 710-711, doi:10.1038/nnano.2009.326 (2009).
166 Nuzzo, R. G. & Allara, D. L. Adsorption of bifunctional organic disulfides on gold
surfaces. Journal of the American Chemical Society 105, 4481-4483,
doi:10.1021/ja00351a063 (1983).
167 Huisgen, R. Centenary Lecture - 1,3-Dipolar Cycloadditions. Proceedings of the
Chemical Society, 357-396, doi:10.1039/PS9610000357 (1961).
168 Laurent, S. et al. Magnetic iron oxide nanoparticles: synthesis, stabilization,
vectorization, physicochemical characterizations, and biological applications. Chem Rev
108, 2064-2110, doi:10.1021/cr068445e (2008).
169 Stöber, W., Fink, A. & Bohn, E. Controlled growth of monodisperse silica spheres in the
micron size range. Journal of Colloid and Interface Science 26, 62-69,
doi:http://dx.doi.org/10.1016/0021-9797(68)90272-5 (1968).
170 Rasch, M. R., Sokolov, K. V. & Korgel, B. A. Limitations on the Optical Tunability of
Small Diameter Gold Nanoshells. Langmuir 25, 11777-11785, doi:10.1021/la901249j
(2009).
171 Das, A., Chadha, R., Maiti, N. & Kapoor, S. Role of Surfactant in the Formation of Gold
Nanoparticles in Aqueous Medium. Journal of Nanoparticles 2014,
doi:doi:10.1155/2014/916429 (2014).
172 Greish, K. Enhanced permeability and retention (EPR) effect for anticancer
nanomedicine drug targeting. Methods Mol Biol 624, 25-37, doi:10.1007/978-1-60761-
609-2_3 (2010).
![Page 163: Analysis of the structure and function of endocannabinoid ... · Drug Discovery including but not limited to: David Janero, Raymond Booth, Mahmoud Nasr, Sergiy Tyukhtenko, Anna Bowman,](https://reader036.fdocuments.us/reader036/viewer/2022081407/5f2556869914ed15c262222f/html5/thumbnails/163.jpg)
144
Appendix
Awards
For work presented here, the author has received the following awards:
1. University Academic Excellence Award
2. NSF/NCI (IGERT) Nanomedicine Fellowship
3. American Foundation for Pharmaceutical Education Fellowship (Twice)
4. Provost’s Certificate of Excellence in Research Award
5. GBMSDG Annual Advances in Separation Science and Mass Spectrometry Symposium
First Place Award
6. John L. Neumeyer Research Achievement Award
Thank you to all those who have contributed to this work, and to those agencies that have
recognized its significance with the commendations above.