Post on 23-Oct-2020
KSP (Eg5) Inhibition – Therapeutic Target for Multiple DiseasesThe Kinesin Spindle Protein (KSP; a.k.a. Eg5 or KIF11) is a plus end-directed Kinesin-5 (a.k.a. BimC) subfamily member and has been the focus of significant drug development efforts for decades. Currently, KSP (or its homologs) is a target for anti-mitotics (can-cer)1,2, anti-parasitics (malaria)3, and anti-fungals4. As a microtu-bule (MT) cross-linking enzyme, KSP plays a critical role in mitotic spindle pole separation, and its inhibition results in the formation of monoaster spindles which is thought to lead to mitotic catas-trophe and apoptosis (Fig. 1). The targeting of KSP as a treatment for cancer is well-documented1,2,5,6. The purpose of this newslet-ter is to briefly discuss KSP homologs as a therapeutic target for parasitic and fungal diseases. KSP: A Treatment Target for Fungal and Parasitic DiseasesDrugs that target KSP are attractive because the prevalent treat-ments either produce deleterious side effects or the infectious organisms have developed resistance to currently utilized drugs. The human KSP protein has multiple druggable allosteric sites3, raising hopes that KSP homologs in parasites and fungi can be tar-geted for therapeutic intervention.
Biopharmaceutical companies focus on screening compounds from multiples sources looking for broad spectrum anti-fungals that target KSP homologs. Model fungal cells include Saccharo-myces cerevisiae and Aspergillus nidulans which are used in con-junction with mammalian cells to confirm species selectivity and lack of off-target effects4.
Besides fungi, parasites are also a focus of KSP inhibitor research. L. Liu et al3 screened compounds for their efficacy at targeting KSP homologs in Plasmodium falciparum and P. vivax to evalulate malaria treatments. The authors exploited the KSP allosteric site characterized by Loop 5 (L5). L5 is an element in the a2 helix of the KSP motor domain that defines an allosteric site consisting of a conserved region along with the L5 element which significantly varies in length and sequence across kinesins and/or KSP homo-logs (Table 1). These variations confer inhibitor selectivity, making L5 an ideal target for allosteric inhibitors. Indeed, it helps form the surface pocket that the KSP inhibitor monastrol binds8,9. Thus, the L5 element offers excellent drug specificity and prevents cross-reactivity between different species3.
Inhibitors were screened for their ability to modulate the basal and MT-stimulated ATPase activity of KSP homologs from Plasmo-dium falciparum and P. vivax as well as human KSP to confirm each inhibitor’s specificity for the parasitic kinesin and lack of off-target effects3. Three different classes of Plasmodium KSP inhibi-tors were identified: 1). those selective for Plasmodium kinesins; 2). those that inhibited both parasite and human KSP; and 3). those selective for human KSP. Determination of the inhibitors’ binding site/sites on KSP is underway.
Table 1. Sequence Alignment for Loop 5 of KSP Homologs
HsKSP MEGERSPNEEYT-------------------WE--EDPLAGI
PvKSP MEGKILEHLKQYDNNKKVDLNESINSDISYCYELCENEDTGL
PfKSP MEGRILEHLKHAEG-KKVDLSDSVNSDINYYYELCDSDDTGI
Hs: human; Pv: P. vivax; Pf: P. falciparum. Adapted from ref. 3.
Cytoskeleton Kinesin Motors and Custom Services At Cytoskeleton, we have recombinant kinesin motor domains that include the Eg5 homolog BimC motor domain proteins from the filamentous fungi A. nidulans (Cat. # BM01) and A. fumiga-tus (Cat. # EG02). We also offer compound screening assays with these kinesins or as part of a multi-motor protein screen. More-over, if the kinesin protein or assay is unavailable, we offer custom protein expression/purification and assay development services. In combination with our kinesin panel screen, we can also evalu-ate compounds for their effects on microtubule polymerization to identify the mechanism of action for anti-parasitic and anti-fungal compounds coming from phenotypic screens and/or as a useful counterscreen for kinesin inhibitor drug discovery efforts that desire to steer their SAR efforts away from compound effects on tubulin polymerization or species cross-reactivity.
The Role of KSP (Eg5) in Cell Division
Figure 1 Schematic representation of the mitotic spindle and KSP (Eg5) cross-linking spindle microtubules. Adapted from ref. 2.
References1. Sarli V. and Giannis A. 2008. Targeting the kinesin spindle protein: Basic principles and clinical implications. Clin. Cancer Res. 14, 7583-7587.2. Wojcik E.J. et al. 2013. Kinesin-5: Cross-bridging mechanism to targeted clinical therapy. Gene. 531, 133-149.3. Liu L. et al. 2014. Small-molecule screen for candidate antimalarials tar-geting Plasmodium kinesin-5. J. Biol. Chem. 289, 16601-16614.4. Nislow C.E. et al. “Antifungal assay”. US Patent 6,284,480. 4 September 2001.5. Cytoskeleton 2014 Q2 CSD Newsletter. KSP/Eg5 Inhibition in Cancer: Theory and Therapy. www.cytoskeleton.com.6. Cytoskeleton 2014 Q3 CSD Newsletter. Drugable site selection for KSP inhibitors. www.cytoskeleton.com.7. Waitzman J.S. et al. 2011. The loop 5 element structurally and kineti-cally coordinates dimers of the kuman kinesin-5, Eg5. Biophys. J. 101, 2760-2769.8. Yan Y. et al. 2004. Inhibition of a mitotic motor protein: Where, how, and conformational consequences. J. Mol. Biol. 335, 547–554.9. Liu L. et al. 2011. Loop 5-directed compounds inhibit chimeric kine-sin-5 motors. Implications for conserved allosteric mechanisms. J. Biol. Chem. 286, 6201-6210.
New
sCitati
onsCustom
Modules
w w w . c y t o s k e l e t o n . c o m
Future Topics
Quarter 2, 2015
TBD
Catalog Products
Actin Proteins
Activation Assays
Antibodies
ECM Proteins
ELISA Kits
G-LISA® Kits
Pull-down Assays
Motor Proteins
Small G-Proteins
Tubulin & FtsZ Proteins
Contact Us
P: 1 (303) 322.2254
F: 1 (303) 322.2257
tservice@cytoskeleton.com
www.cytoskeleton.com
This Issue Contains
KSP/Eg5 Inhibition in Parasites and FungiRelated CitationsCustom Modules
Q1 2 0 1 5
+
+
+
+
+ +
+ ++
+
+
+
++
+++
+Eg5
metaphasespindle
chromosome
w w w . c y t o s k e l e t o n . c o m
Custom Modules
Type Format Deliverable Module # Timeline (wks)
Eg5 Kinesin motor assayMicrotubule stimulated ATPase assay, kinetic, absorbance at 360nm
96 assays, consisting of 40 duplicate single concentrations (or 5 x IC50s), plus eight control wells. PDF Report with Executive Summary, Introduction, Methods, Results and Data Analysis.
CDS050 or CDS051
2
Cardiac Myosin motor assayCa2+/Sarcomere (thin filament) stimulated ATPase assay, kinetic, absorbance at 360nm
Same as CDS052.CDS056 2
Dynein motor assayMicrotubule stimulated ATPase assay, kinetic, absorbance at 360nm Same as CDS052.
CDS065 2
Tubulin polymerizationTubulin (>99% pure) Polymerization Assay, kinetic, fluorescence at 360nm/410nm
96 assays, with 40 duplicate single concentrations or 5 x IC50s, plus eight control wells (vinblastine, nocodazole or taxol). PDF Report with Executive Summary, Introduction, Methods, Results and Data Analysis.
CDS009 or CDS010
2
GEF/GTPase exchange assay
GTP exchange factor plus Small G-protein (e.g. Rho or Ras) with mant-GTP reporter. Kinetic, fluorescence at 360nm/450nm
60 assays consisting of either 28 duplicate reactions plus 4 controls, or 5 x IC50s plus 1 x control IC50. PDF report with Executive Summary, Introduction, Methods, Results and Data Analysis.
CDS100 2
• Merck & Co., Inc.
• Eli Lilly & Co.
• Amgen, Inc.
• Abbott Laboratories
• Pfizer, Inc.
• Astra-Zeneca plc
• GlaxoSmithKline plc
• Genentech, Inc.
• Johnson & Johnson
• Bristol-Meyers Squibb
Like our regular product offerings, the Custom Services Department emphasizes quality products and services. We understand that accuracy and timeliness are critical elements for a successful project. Choose
from more than twenty defined modules (for a full list, visit www.cytoskeleton.com/custom-services), and then contact Technical Support (tservice@cytoskeleton.com) to guide you through the process.
About Custom Services Clients Include:
Type Name Deliverable Module # Timeline (wks)
Recombinant Small Protein Small protein or protein domain (