The Lynchburg Times 1/6/2011

Post on 09-Apr-2018

223 views 0 download

Transcript of The Lynchburg Times 1/6/2011

  • 8/8/2019 The Lynchburg Times 1/6/2011

    1/16

    The Lynchburg Times

    FREEVol. II, Issue 1 January 6, 2011

    in Kroger, Food Lion, McDonalds & hundreds of other places!FREE

    Armed robbery OnMonday, December 13, 2010 atap-proximately 6:45 p.m. members of theLynchburgPoliceDepartmentrespondedtothe1600blockofBedfordAve.foranarmedrobbery.Uponarrivingonthescene,policeofficerslocatedthecrimescenewhichwasdeterminedtobe1601and16011/2BedfordAve.Thevictim,apizzadeliverydriver,ad-

    visedthatafterarrivingattheresidenceandwalkingontotheporchtodeliveranorder,hewasconfrontedbyanunknownarmedblackmalesuspectwearingahoodedtypejack-etandstockingcap.Thevictimdescribedthehoodofthejacketashavingfuraroundit.Accordingtothevictim,thesuspectwasarmedwithashotgunanddemandedbothmoneyandthepizzas.Thevictimwasnotinjuredduringtheincident.Anundisclosedamountofmoneywastakenduringtherob-bery. The robbery is under investigation anddetectivesareexaminingsimilaritiestotheotherreportedrobberiesthathaveoccurredoverthepastcoupleofweeks. AnyonewithanyinformationregardingthiscrimeortheidentityofthesuspectsisaskedtocallDetectiveR.G.Millerat(434)455-6160orCrimeStoppersat1-888-798-5900,visittheCentralVirginiaCrimeStopperswebsiteatwww.cvcrimestoppers.orgtoenteraweb

    tip, ortextCVCS plus your messageto274637.

    Exclusive:

    Va. reality TV couplein court Fri. against

    RadarOnline.com exec

    Flames Cash a hit withlocal businesses

    9

    13

  • 8/8/2019 The Lynchburg Times 1/6/2011

    2/16

    Page The Lynchburg Times January 6 - 1, 011 Read every issue online at www.lynchburgtimes.com

    The Lynchburg Timeswww.lynchburgtimes.com

    Publisher & Editor:

    Dan McDermottdan@lynchburgtimes.com

    Advertising Sales Manager:

    Angie Buterakosangie@AdvertiseLynchburg.com

    540-683-9197

    Sales Team:

    Kendra Heath: 434-209-3046kendra@AdvertiseLynchburg.com

    Sceauncia Parr: 434-207-8581sparr@AdvertiseLynchburg.com:

    Dianne ranks: 434-258-3326dianne@AdvertiseLynchburg.com

    Sta Writers:

    Yvonne BehrensYvonne@lynchburgtimes.com

    Lauren Sattereldlauren@lynchburgtimes.com

    Emily Williamsemily@lynchburgtimes.com

    By Lorie Showalter

    Te Lynchburg imes

    Did you know that you and ev-ery American who earns a wageor sel-employment income justreceived a two percent raise e-ective January 1st this year!

    Tats right, the two percentincome raise applies to every-

    one who earns a wage, whetherthey pay income taxes or notand you dont need to le any-thing to get it.

    So while major news outletsreported that the bill PresidentObama signed is basically anextension to the Bush-era taxcuts and ederal unemploymentbenets, a look at the ne printo the Act reveals there was asmall gold nugget or eachAmerican wage earner.

    O course, its up to employersto keep up to date on these nepoints and most businesses, ithey havent heard about theraise, will realize it when theirpayroll sotware is updated orthe coming year.

    However, this shouldnt be tak-en or granted, especially i thecompany or business you workor calculates payroll manuallyand the individual who calcu-lates your paycheck isnt awareo this new change as its a re-cent and somewhat last minute

    income raise implementation.So, what you need to do is

    pay attention to the amount o your rst check or year 2011

    and make sure that your FICA

    withholding is no more than 4.2percent o your gross pay. I youdo not see the raise reected inyour paycheck, go see payroll orhuman resources and let themknow they need to contact theIRS, or go to the IRS website,obtain the proper inormationand correct any oversight.

    Congress not only extendedthe current, lower individual in-come tax rates through 2010 inthe recently enacted ax Relie,Unemployment Insurance Re-authorization and Job CreationAct o 2010 (2010 ax RelieAct), it also extended a numbero benecial tax breaks or am-ilies and individuals. Trough2012, the law extended signi-cant tax incentives or educa-tion, children and energy-sav-ing home improvements.

    Reduction o FICA withhold-

    ing tax

    Tis is where youre going tosee your two percent raise, itwill be calculated through yourFICA withholding and show upin your pocket! Under currentlaw, employees pay a 6.2 percentSocial Security tax on all wagesearned up to $106,800 and sel-employed individuals pay 12.4percent Social Security sel-em-

    ployment taxes on all their sel-employment income up to thesame threshold.

    For 2011, the Act gives a two-

    percentage-point payroll/sel-

    employment tax holiday oremployees and the sel-em-ployed. As a result, employeeswill pay only 4.2 percent So-cial Security tax on wages andsel-employment individualswill pay only 10.4 percent So-cial Security sel-employmenttaxes on their income up to the

    threshold. Wage earners andthe sel-employed will keep twopercent more o their earnings,but or calendar year 2011 only,unless extended.

    Te maximum savings or ex-tra income or 2011 will thenbe $2,136 or two percent o$106,800. Keep in mind the ex-tra income in this computationis based on the up to amount o$106,800 as mentioned above.

    Individual tax rates

    Te 2010 ax Relie Act ex-tends all o the current lowerindividual tax rates across theboard or all taxpayers at 10, 15,25, 28, 33 and 35 percent or twoyears through 2012. In addition,under the new law, the size othe 15 percent tax bracket ormarried couples ling jointlyand surviving spouses remainsdouble that o the 15 percenttax bracket or individual l-ers, thus continuing to provide

    marriage penalty relie.Congress also extended the

    deduction or state and localsales taxes in lieu o the state

    Guess what? Everyone just got a raise!2010 Tax Relief Act extends tax breaks, lowers FICA withholding

  • 8/8/2019 The Lynchburg Times 1/6/2011

    3/16

    January 6 - 1, 011 The Lynchburg Times Page Read every issue online at www.lynchburgtimes.com

    This could be your ad

    for just $15 per weekSmallAds@LynchburgTimes.com

    540-671-1239

    Let me haul away

    your junk metal

    forFREE!

    GGary: 540-683-6811

    ProfessionalDiscJockeyServiceforWeddings,Reunions,Birthdays,AnniversariesandSpecialEvents.

    Richard Kent : 434 528-3553sgtm90@wmconnect.comOn the web: www.sgtm.biz

    Shantaras Goats Milk Soaps And LotionsComeseeusatournewboothintheHeritageCraftersMallintheCommunityMarket.9amto2pm,Tues-Sat.Wemakeavarietyofgoatsmilksoaps,includingdeadseasaltsoaps,celticseasaltsoaps,petsoaps,essentialoilsoaps,fragranceoilsoaps,castilesoaps,andmore.

    www.shantaraacres.com 434-426-4049

    FOR SALE1999 Ford R

    a

    nger Ltd4wd, 5 speed manual, newinspection, new tires, new

    brakes, new alt, new belts, new4wd shift motor, new radio/cd

    player, cruise, tilt, tow pkg,bed liner, camper shell

    Well Maintained, 168,000 k

    O

    nly $5

    400.00434-

    237-5137 or 434

    -4

    20-

    4097

    Forest Photo ClubJoin us every third Monday ofeach month at 7pm at theForest Presbyterian Church.www.lojophotography.comJoin our forum at www.mylynchburg.net

    434-845-8554Service Available 23 Hours a day

    Accepting MC, Visa and Discover

    FREE Workshop on The 5 Secrets to Perma-nent Weight Loss by Dr. Jeffrey Tanzar, Wellness

    Consultant -Tuesday January 18th, 6pm at 1088Vista Park Drive, Suite C in Forest. Learn the causes

    and solutions to weight gain. Reserve your spottoday. Seating is Limited. Call 434-385-1110

    and local income tax deductionthrough 2011.

    More marriage penalty relie

    In addition to expanding the15 percent income tax ratebracket, the 2010 ax Relie Actalso maintains the increasedbasic standard deduction or joint lers. Trough 2012, thestandard deduction or marriedtaxpayers ling jointly, as wellas surviving spouses, is twice

    the basic standard deductionamount or single individuals.For example, the standard de-

    duction or single individualsor 2011 is $5,800, or marriedtaxpayers ling jointly; the stan-dard deduction or 2011 will be$11,600.

    No personal exemption phase-

    out

    Higher income individualsand amilies will also benetrom the ability to claim an un-reduced personal exemption.Beore 2010, taxpayers withincome over certain amountswere subject to phaseout o

    their personal exemption.

    However under the 2010 axRelie Act, personal exemptionsare not reduced or an addition-al two years through 2012.

    Expanded child tax credit

    Te 2010 ax Relie Act ex-tends the $1,000 child tax creditor two more years, throughDecember 31st, 2012. Te childtax credit can be claimed oreach qualiying child under age17 (at the close o the year) that

    the taxpayer can claim as a de-pendent.However, the amount o the

    credit is reduced as a taxpayersincome increases. Te credit isreduced (but not below zero) by$50 or each $1,000 o modiedadjusted gross income (AGI)above $110,000 or joint lersand above $75,000 or others.Te new law also extends otherenhancements to the credit, in-cluding the ability to oset boththe regular tax and alternativeminimum tax.

    Dependent care credit

    Te 2010 ax Relie Act ex-

    tends the enhanced dependent

    care credit or two years through2012. A taxpayer who incurs ex-penses to care or a child underage 13 or or an incapacitateddependent or spouse in order

    to enable the taxpayer to workor look or work, is eligible toclaim the dependent care cred-it. Te maximum credit thatcan be claimed through 2012 is$3,000 or one qualiying indi-vidual and $6,000 or more thanone qualiying individual.

    Additionally, the maximum

    credit rate is 35 percent. Tus,or 2010 the maximum depen-dent care credit is $1,050 (35percent o up to $3,000 o eligi-ble expenses) or one qualiyingindividual and $2,100 or morethan one qualiying individual(35 percent o up to $6,000 oqualied eligible expenses).

    Incentives or energy-efcient

    improvements

    Te Act also rewards indi-viduals and amilies who makeenergy-saving improvementsto their homes. For example,the new law extends through2011 (only one year on this one)

    the popular Code Sec. 25C tax

    credit, which provides a creditor expenses or qualied ener-gy efciency improvements andproperty, such as urnaces, wa-ter heaters, insulation materi-

    als, exterior windows, skylights,doors and other items.

    Additional ino

    In addition to the above men-tioned perks there are tax ben-ets or education also includedas well as an extension or the

    earned income tax credit (EIC)or two more years through2012. Te new law also simpli-es computation o the EIC.

    For more detailed inormationsee the IRS web address www.irs.gov/newsroom/index.html

  • 8/8/2019 The Lynchburg Times 1/6/2011

    4/16

    Page The Lynchburg Times January 6 - 1, 011 Read every issue online at www.lynchburgtimes.com

    By Roger BianchiniTe Lynchburg imes

    According to the daughter o a mankilled when he was struck by a carwhile walking to work along Fair-grounds Road the evening o Dec. 28,the sequence o events leading to theatal accident may have been initiatedby a well-intentioned Warren CountySheris Ofce deputy.

    Virginia State Police Press OfcerSgt. F. L. yler reports that 59-year-old

    James Alred Oldeld died as a result oinjuries sustained when he was struck

    at 10:25 p.m. by a 2002 Chevy Avalon

    driven by Joshua William Stanley, 27,o Martinsburg, West Virginia. Te ac-cident occurred three tenths o a mileeast o Route 522 on Fairgrounds Roadas Oldeld was walking west. Oldeldwas own by medical helicopter toWinchester Medical Center where hewas pronounced dead at 12:40 a.m. onDec. 29.

    Our understanding is that the dep-uty was turning around to tell him he

    needed to wear a reector and theother driver was coming out o Fergu-sons and looked in his rear view mir-ror at the deputys lights and didnt seedad, Oldelds daughter Joanna Mor-gan told us. She said she believes thedriver exiting Fergusons believed hewas being pulled over by the deputy,possibly or expired tags, when he be-gan to pull to the side o the road andstruck her ather.

    Joanna said her dad, who lives oFairgrounds Road, was walking toFamily Dollar or the third shit whichbegan at 11 p.m. She added that herdad lost his car to a nance companyshe had less than kind words or re-cently and had just decided to con-tinue walking to work as a cost savingmeasure in the tight economy.

    Te accident is being investigatedby VSP rooper P. M. Ne, who wasassisted at the scene by the WarrenCounty Sheris Ofce and county reand rescue. No charges were initiallyled and the investigation continuedthe rst week o January.

    He was a proessional painter. Heloved art, loved to draw and go shingwith the kids. He was just a general,good person and there arent many othose around. And he was a devoutChristian and thats made it easieron us because we know hes gone toheaven. I dont know what else to tell you about daddy other than we lovehim and miss him, Joanna concluded.

    Te amily sent us this statement to

    accompany this story:

    James Jimmy Oldeld, born No- vember 26, 1951, went unexpectedlyto be with the Lord on December29, 2010. He was a riend to manyand loved by those who knew him.When people met Jimmy they met a

    riend. We will all miss you Jimmy.

    Love, your daughters, Joanna Morgan,Nancy and Jamie Oldeld, and yourgrandchildren, Ashlan and JessicaMorgan, Brennan Paul Dalton and therest o our amily. May you rest in theLords arms.

    Join the discussion on our

    new site:

    Chat

    Local Profles

    Free Classifeds

    Login with:

    When good intentions go horribly wrongFatal accident may have been result of intended safety warning

    James Jimmy Oldeld, 1951-

    2010

  • 8/8/2019 The Lynchburg Times 1/6/2011

    5/16

    January 6 - 1, 011 The Lynchburg Times Page Read every issue online at www.lynchburgtimes.com

    WLNI FML Y N C H B U R G

    Voted BEST MORNING SHOWin the state by

    the Virginia Association of Broadcasters

    Join Brian and Mari Weekdays from 6am - 10am on The Morningline.

    Keep up with whats going on around the Greater Lynchburg area. If itshappening locally, were talking about it on the Morningline. Join the

    conversation by calling the studio line at 846-8255 or 866-338-1059.

    Glenn Beck10am - Noon

    6pm - 7pm

    RushLimbaugh

    Noon - 3pm

    SeanHannity3pm - 6pm

    NealBoortz

    7pm - 10pm

    JasonLewis

    10pm - Midnight

    The Morninglinewith Brian & Mari

    6am - 10am

    NewsTalk

    105.9

    105.9 FM6am - 10am

    Centra joins innovativeclinical study

    Centra recentlyjoined a growing list ofkeymedicalcentersnationwidethatareim-

    plantingtheMISAGOTMPeripheralStentSystem,partoftheOSPREYclinicaltrial.CentraisoneoffivefacilitiesintheUnitedStates to successfully implant this stent.Ron Morford, M.D., cardiologist with theCentraStroobantsHeartCenterperformedtheprocedure.Stenting isa minimallyin-vasive procedure performed to improvebloodflowinthebodysarteries.Duringthisprocedurea small wiremesh tubecalledastentispermanentlyplacedinthenewly

    openedarterytohelpitremainopen. Approximately eight million Americanssufferfromperipheralarterydisease(PAD),accordingtothe AmericanHeartAssocia-tion.PADisanarrowingofthearteriesinthe legs or arms and often undiagnosedbecause the symptoms can be mistakenfor other conditions. The most commonsymptomsarecrampingandpainor tired-nessinthelegorhipmuscleswhilewalkingorclimbingstairs.Typically,the paingoes

    awaywith rest, butflares up again whenwalkingresumes.MostcasesofPADcanbe managed with lifestyle changes andmedicaltherapy;however,leftundiagnoseditcouldleadtootherseriousconditions.Ifyou, or someone you know suffers fromthesesymptoms,askyourphysicianifyoushouldbeevaluatedforPAD. Newapproachesinthediagnosis,preven-tionandtreatmentofheartdiseaseoccurasaresultofclinicaltrialslikethese.Thespe-

    cializedresearchstaffofTheCardiovascu-larGroupandtheCentraStroobantsHeartCenter is dedicatedto performing clinicaltrials safely and efficiently, while simulta-neously addressing the individual needsofeachresearchstudypatient.Allclinicaltrialshaveguidelinesaboutwhocanpar-ticipate.Thesecriteriaarebasedonfactorssuchasage,gender,thetypeandstageofadisease,previoustreatmenthistory,andothermedicalconditions.Centrastrialwas

    headedbyDanielCarey,M.D.andcoordi-natedbyCindyBaumann,RN.FormoreinformationabouttheclinicaltrialsthatCen-traparticipatesin,pleasevisitwww.Centra-Health.com

  • 8/8/2019 The Lynchburg Times 1/6/2011

    6/16

    Page 6 The Lynchburg Times January 6 - 1, 011 Read every issue online at www.lynchburgtimes.com

    Centra President & CEO George Dawson to retire

    From a release:

    Ater three decades o visionary leader-ship, Centra president and CEO GeorgeW. Dawson announced his retirementuesday. He expects to retire by the end o2011.

    Dawson led the transormation o Cen-tra rom two community hospitals to amajor healthcare system nationally rec-ognized or quality and saety. oday,nonprot Centra has 6,000 employees, amedical sta o more than 400, LynchburgGeneral, Virginia Baptist and Southside

    Community hospitals, health and rehabil-itation centers, a cancer center and physi-cian practices serving an area rom Bed-ord to Farmville and rom Nelson Countyto Danville. In addition, Centras servicesinclude residential and outpatient mental

    health acilities, home health and hospiceprograms, mammography centers, a sleep

    disorders center and a center or woundcare and hyperbaric medicine.

    Centra has had tremendous growth inits regional service area, earned dozens onational awards or quality, service, saetyand patient satisaction, and is known orits efciency and nancial stability.

    While Dawson is proud o these accom-plishments, he is quick to credit the re-sults to a great team. Ive been privilegedto work with so many talented and caringCentra employees and great doctors, he

    said. Centras top notch executives anddedicated community Board o Directorshave ocused on excellent patient care orthe entire region. We all have a lot o pridein what we do and accomplish together.

    All o us who live in the communities

    served by Centra owe George Dawson atremendous debt o gratitude. He has de-voted a big part o his lie to Centra andgaining the quality o care worthy o na-tional rankings, said Ken White, chair othe Centra Board o Directors. Quality ocare and patient service are the hallmarkso his leadership.

    Unortunately or our region, he wantsto retire. For several years he has told usthis day would come, but it doesnt makeit any easier to hear. Not only is everyoneat Centra in Lynchburg and Farmville los-ing his leadership, but also his day to dayriendship as a colleague.

    I will miss my Centra job, but this yearis the right time or this transition, Daw-son said. More than a year ago, Rosemaryand I decided that 2011 would be the yearwe would begin to ocus more o our timeon each other and on our other deep in-terests. I must admit, in my current role, Iam not very good at the work/lie balancechallenge.

    I shared our decision with the Centraboard and they began the important tasko succession planning. Centra is blessedto have a board o experienced region-

    al leaders and I applaud them or their

    thoughtul and consistent leadership oCentras regional healthcare mission.

    White said the Centra board has ap-pointed a search committee and has en-gaged a nationally recognized executivesearch rm to identiy candidates as Daw-sons successor. He expects the board tomake its decision on a new CEO as earlyas this summer. Current Centra execu-tives who express an interest will be con-sidered as well as candidates rom acrossthe country.

    It is natural, I think, or people toperhaps wonder whether there will be achange in our direction as we transitionto new leadership. Te answer to that isno. I want to make it clear that the Centraboard remains strongly committed to thestrategy o a locally governed, nonprotintegrated healthcare system providing abroad range o healthcare services to cen-tral and southside Virginia, White said.

    About George Dawson

    A native o Crozet, Virginia, Dawsonhas lielong ties to central Virginia andhas spent most o his adult lie in this re-

    gion o Virginia. He came to Lynchburg

    After three decades of leadership, Centra president and CEOGeorge W. Dawson announced his retirement Tuesday. He expectsto retire by the end of 2011.

    Link Rd.robbery update

    OnThursday, December 30, 2010 atap-proximately0634hrs,membersoftheLynch-burgPolice Department executeda search

    warrantontheresidenceat83FederalStreet,andservedarrestwarrantsonCharlesAntho-nyHorsley.BothwarrantswereinconnectionwiththeTuesday,December21,2010homeinvasion robbery that occurred in the3000blockofLinkRd.Horsleywasarrestedandcharged with Robbery, Abduction, Burglary,andthreecountsofusingafirearmduringthecommissionofafelony.Theinvestigationison-going. Thisisthesecondarrestintheconnectionwiththe reportedincident on Tuesday, De-

    cember21,2010atapproximately11:21a.m.MembersoftheLynchburgPoliceDepartmentrespondedtothe3000blockofLinkRd.forreportofanarmedrobbery.Uponarrivingonthescene,policeofficerslocatedamalevic-

    timwhowasnotharmedduringtheincident.Thevictimreportedthathewasspeakingwithavisitorathisresidencewhenanunknownblack male suspect entered the residence,pointeda chromecoloredhandgun at thevictimanddemandedmoney.Theunknownsuspectisdescribedasablackmale,late20sorearly30s,approximately175lbs.,goateetypebeard,andwasreportedtobewearing

    blackcoloredclothingatthetimeoftherob-bery.Thesuspecttiedthevictimupandtookthevictimswalletwhichcontainedanundis-closedamountofmoneyandtworingsoffofhisfingers.Thesuspectlefttravelinginanunknowndirection. Detectivesare currentlyfollowinguponleads.Informationgatheredatthistimeindicatesthattherobberywasnotarandomact.Additionalinformationwillfollow. AnyonewithanyinformationregardingthiscrimeortheidentityofthesuspectisaskedtocallDetectiveJ.T.Loydat455-6178,orCrime

    Stoppers at 1-888-798-5900, visitthe Cen-tralVirginiaCrimeStopperswebsiteatwww.cvcrimestoppers.orgtoenterawebtip,ortextCVCSplusyourmessageto274637.

  • 8/8/2019 The Lynchburg Times 1/6/2011

    7/16

  • 8/8/2019 The Lynchburg Times 1/6/2011

    8/16

    Page The Lynchburg Times January 6 - 1, 011 Read every issue online at www.lynchburgtimes.com

    Copyright2011KingFeaturesSyndicate,Inc.

    OnJan.23,1775,LondonmerchantspetitionParliamentforrelieffromthefinancialhardshipputuponthembythecurtailmentoftradewiththeNorthAmericancolonies.Most criticaltothe merchants concerns werethe 2 millionpoundssterlinginoutstandingdebtsowedtothembytheirNorthAmericancounterparts.

    OnJan.18,1882,A.A.Milne,creatorofWin-nie-the-Pooh,isborn.Milnewrotehisvolumesofverseforhisson,ChristopherRobin:WhenWe Were Very Young (1924), Winnie-the-

    Pooh(1926),NowWeAreSix(1927)andTheHouseatPoohCorner(1928).

    OnJan.19,1915,duringWorldWarI,Brit-ainsuffersitsfirstcasualtiesfromanairattackwhentwoGermanzeppelinsdropbombsonGreatYarmouthandKingsLynnontheeast-erncoastofEngland.Thezeppelin,amotor-drivenrigidairship,wasdevelopedbyGermaninventorFerdinandGrafvonZeppelinin1900.

    OnJan.17,1953,aprototypeChevroletCor-

    vettesportscar makes itsdebut atGeneralMotorsMotoramaautoshowinNewYorkCity.Thecarfeaturedanall-fiberglassbody,awhiteexteriorandredinterior,a150-horsepoweren-gineandastartingpricetagofaround$3,500.AnAMradioandheaterwereextra.

    OnJan.20,1961,87-year-oldRobertFrostrecitedhispoemTheGiftOutrightatthein-augurationofPresidentJohnF.Kennedy.Al-thoughFrosthadwrittenanewpoemfortheoccasion, titled Dedication, faintink in histypewritermadethewordsdifficulttoread,soherecitedTheGiftOutrightfrommemory.

    OnJan.21,1977,PresidentJimmyCartergrantsanunconditionalpardontohundredsofthousandsofmenwhoevadedthedraftduringtheVietnamWar.Intotal,some100,000youngAmericanswentabroadinthelate1960sandearly70stoavoidservinginthewar.

    OnJan.22,1981,RollingStonemagazinesJohn Lennon tribute issue hits newsstands,featuringacoverphotographofanakedJohn

    LennoncurledupinafetalembraceofafullyclothedYokoOno.Thephotographhadbeentakenjust12hoursbeforeLennonsdeath.

  • 8/8/2019 The Lynchburg Times 1/6/2011

    9/16

    January 6 - 1, 011 The Lynchburg Times Page Read every issue online at www.lynchburgtimes.com

    By Emily WilliamsTe Lynchburg imes

    Ah to be a college student again! Teres thelibraries, lectures, dorm rooms, and o coursethe land o culinary plenty that is the mealplan. For students at Liberty University, thisland has just gotten a little bigger. Earlier this

    year, the school began to expand its FlamesCard program to include vendors o campus,and participating businesses are reaping thebenets.

    Te students are real excited about it. Itsnew, it gives them the opportunity to dine ocampus and, you know, just get away, said PatFaulkinberry, director o card services at LU.

    Already a slew o businesses, all toting aFlames Cash accepted here sticker in theirwindows, have signed up and more are on theway. Ranging rom Bualo Wild Wings and

    Sheetz on Wards Road to Robin Alexanderon Main Street, students now have an array onew locations to use their meal plan.

    Te company paving the way or these newood options is O-Campus Solutions oPennsylvania. OCS acts as a go-between orthe University and businesses, providing ma-chines and technical support. OCS currentlyserves a number o schools, including RutgersUniversity and Endicott College.

    At the beginning o each semester, a studentselects a meal plan, depending on where theylive and their class schedule. With the newFlames Cash program, students will choosea plan based on how much they preer to eaton campus in dining halls or school ownedranchises, and how much they would liketo spend o campus at outside vendors. Forstudents that preer to stick to the traditionaldining hall experience, there is a plan that

    does not include any Flames Cash and onlyswipes to be used or meals on campus.

    For students the change means more diningoptions all under the umbrella o their educa-tional loans. Flames Cash has been integrated

    into existing meal plans, and so will be in-cluded in a students bill or the semester. Tisqualies the points or coverage under ederaland state loans, which tend to have lower in-terest rates than private ones.

    For the university, the expansion meanshappy students and less pressure to expand itsacilities. Te schools enrollment was cappedbased on a lack o space, and now has a waitinglist o several hundred qualied applicants.

    It really comes down to the act that wecant build ast enough, said Lee Beaumont,director o auxiliary services at LU.

    For the city, the expansion means tax mon-ey. Since LU is a non-prot institution, allpurchases made o campus are tax-ree. Bybringing Flames Cash to outside vendors,LU students are contributing tax dollars thatwerent there beore. Not to mention by opt-ing into the Flames Cash program, businessesare essentially putting themselves on the shortlist o places students will turn to rst whendining o campus.

    It brings a lot o goodwill to the communi-ty. Teres some people who dont like us, butI guarantee you with a small business owner,

    you wont nd one that doesnt like us be-cause o the dollars, said Beaumont.

    Jason Geppert, General Manager at the Bu-alo Wild Wings in Lynchburg, was excitedwhen he rst heard about the Flames Cashexpansion, and continued to be excited by theamount o purchases students made with thecards.

    We have a lot o Liberty students who areloyal customers and ans, and I immediatelywanted to jump onboard, said Geppert.

    Geppert said the restaurant has always seenbig numbers o customers rom the nearbyuniversity, particularly on uesdays and

    Tursdays when there are specials. Since im-plementing the program this summer, how-

    ever, Wild Wings has seen an increase in largeLU parties using the card.

    Where as beore theyd come in in groupso 2 or 3, now we see a lot more 16 to 24 toptables, said Geppert.

    Tere are some restrictions in place as tohow students can spend their Flames Cash.Businesses opting into the program must signan agreement with LU stating that they willnot allow students to purchase alcohol, to-bacco, git cards, lottery tickets, birth control,or magazines with their Flames Card. LU usessecret shoppers to test locations along theseguidelines. Businesses in violation o thisagreement are issued a citation rom OCS.

    Te problem with these restrictions, said Ge-ppert, is that currently the sotware providedby OCS has no ail-saes to prevent restricted

    transactions rom being completed. Tismeans the responsibility alls on the shoulderso the businesses to ensure that their employ-ees pay strict attention to the guidelines.

    We would like to see as many ail saes in-stalled as we can without driving away cus-tomers, said Geppert.

    Geppert has also experienced some dif-culty integrating the OCS machines with therestaurants current system. He was quick topoint out, however, that technical supportat the company continues to work with himon these issues. Geppert had some advice tobusinesses considering the Flames Cash pro-gram.

    Absolutely work with the O Campus Solu-tions advisor as much as possible, and ask tonso questions, said Geppert.

    As the program continues to catch on, LUhopes to increase the number o participat-ing businesses beyond its already growingnumbers. Te Flames Cash program is cur-rently concentrated on ood, but in the uturethe school has considered expanding to othermerchants such as hairdressers and other ne-cessities.

    Its all interconnected like a big web. Food is

    obviously a big part o making people happy,said Beaumont.

    Flames Cash blazes a trail between LU students and local businesses

    A new innovation to Liberty Universitys meal plan is giving stu-dents more dining options, helping local businesses increase salesand adding to Lynchburgs tax revenue.

    HOURS:

    Managers Special!!

    2001 Ford Explorer Sport

    Locally owned and operatedCar and Van Rental and Sales

    Bert & Bonnie Limbrick

    434-528-4111259 Old Town Connector

    Madison Heights, VA

    (434) 239-844619950 LEESVILLE RD.

    LYNCHBURG, VA 24502

    GUTTERING

    VINYL SIDING

    CUSTOM TRIMHARDIE PLANK

    ROCK VENEER

    CUSTOM COPPER

    WINDOWSROOFING

    CUSTOM SIDING

    & WINDOWS

    REMPFERCONSTRUCTION, INC.

  • 8/8/2019 The Lynchburg Times 1/6/2011

    10/16

    Page 10 The Lynchburg Times January 6 - 1, 011 Read every issue online at www.lynchburgtimes.com

    The Rule of Sebelius ThetextofObamaCareisdryandlegalistic,exceptwhenitsummonsthemajestyoftheKingJames Bible tointoneimperiously,the secre-taryshall... Thesecretaryinquestionisthesecretaryofhealthandhumanservices(HHS),KathleenSe-belius,whoshallandmaydoallmannerofthingstocompletethegreatunfinishedcanvasthatisObamaCare.AsGeorgeW.Bushmightsay,Sebeliusisthedecider.InthediscretionshesgrantedtoremakeAmericanhealthcare,she rivals Nancy Pelosi, Hillary Clinton andOprahWinfreyasthemostpowerfulwomaninAmerica. TheNewYorkTimesreportedtheotherweekthatHHShascreatedaversionofthedeathpanels,inSarahPalinsfamouscoinage,thatwerestrippedoutofthelawafteranuproarin2009.Whydidwebotherhavingthatfight,withallitsfieryaccusations,ifKathleenSebeliusandherunderlingscouldsimplyactattheirdiscre-tion? Ourcivicstextbookstelluswehaveasystemof representativegovernment, accountable tothe people, to adjudicate just such intenselycontestedquestions.Thetextbooksarewrong

    --theyfailtoaccountfortheRuleofSebelius.HerHHSdecidedMedicarewillcoverend-of-lifeconsultationsas partof ObamaCares annualwellnessvisits. Sebeliusnotonlygetstomakethiscall,she

    getstodontheDickCheneyShroudofSecrecytodoit.AsTheNewYorkTimesnotes:Con-gressionalsupportersofthenewpolicy,though

    pleased,havekeptquiet.Theyfearprovokinganotherfuror. Ah, yes, the danger of public information:Itmightcrimpthe work ofKathleenSebelius.PhilipKleinofTheAmericanSpectatorcounted700referencesinObamaCaretothesecretaryshall,200tothesecretarymayand139tothesecretarydetermines. Last month, HHS announced that premiumincreasesover10percentnextyearareunrea-sonable.Itearlierhadwarnedinsurersitwouldhavezerotolerancefor unjustified rates in-creases.Why?BecauseSebeliussaysso.TheObama administration has issued more than100waiversfromprovisionsofObamaCare,asweepingroundofexceptions.Why?BecauseSebeliussaysso. Theregulatorystateisnt anythingnew,butthe Obama administration is broadening anddeepeningitasamatterofphilosophyandexi-gency. The administrationhas progressivismstasteforrulebyself-appointedexperts,andnowithaslittlechoicebuttoworkaroundaRepubli-can-heldHouseofRepresentativestopursueitsgoals. TheEnvironmentalProtectionAgencyplanstomovetolimitgreenhouseemissionsfrompowerplantsandoilrefineriesinresponsetoCongressresistanceto passinga cap-and-tradelaw.AsPresidentBarackObama putit, theres morethanone wayof skinningthe cat. Hemighthaveelaborated:Theresthedemocraticway,andtheadministrativeway.TheEPAsmoveismoreaudacious thananything yet attemptedbySebelius; its asif Congresshad declinedto pass ObamaCare, and Sebeliushad goneaheadandbegunimplementingitanyway.

    Allofthisisdeeplycorrosiveofself-govern-ment.Fromwethepeople...tothesecretarymay...isatriumphofbureaucracyoverrepub-licanism.

    Copyright2011KingFeaturesSyndicate,Inc.

    1.Namethe female singerwho releasedTheWayWeWere.2. Which one-hit-wonder group recordedNobodyButMein1968?3.WhatwastheoriginalnameofthegroupB.T.Express?Nameits1974hit.

    4.WhichgroupwasPeterCeterainbeforegoingoutonhisown?5.NamethesingerwhoreleasedUnder-coverAngel.6.Who was the originaldrummerfor theEagles?Whatyeardidhestart?

    Answers1.BarbraStreisand.Thesongwasonthesoundtrack ofthe 1973 film bythe samenameandwonmultipleawards.

    2.TheHumanBeinz.3. Brooklyn Trucking Express. Do It (TilYoureSatisfied)rosetoNo.2ontheBill-boardchartsandNo.1onR&B.4.Chicago.Hisfirstsolo,GloryofLove,wasthethemesongtothefilmKarateKidPart2in1986.5.AlanODay,in1977.Whilehesnotespe-ciallywell-knownforhissinging,heswrittenawealthofmaterialforotherartists,aswellasNationalGeographicandJimHensonsMuppetBabies.

    6.DonHenleystartedwhenthebandformedin 1971 and stayed until 1980,whenthebandbrokeup.Hecamebackwhentheyregroupedin1994.

    Copyright2011KingFeaturesSyndicate,Inc.

    Roasted Chicken Pieces with SweetPotatoes and Ginger-Soy Glaze

    Sweet potatoestastesuperbwithAsianflavorslikefreshgingerandsoysauce.Wealsoaddedabitofhoneyandonionstokeeptheflavorsbalanced.

    2tablespoonsoliveoil1tablespoonhoney4teaspoonsgrated,peeledfreshginger

    3tablespoonsreduced-sodiumsoysauce1 (4-pound)chicken, cutup into8 pieces,skinre-movedfromallbutwings11/2poundssweetpotatoes,peeledandcutinto11/2-inchchunks1mediumonion,cutinto8wedges

    1.Preheatovento450F.Spray151/2-inchby101/2-

    inchjellyrollpanwithnonstickcookingspray.2.Inlargebowl,stirtogetheroil,honey,gingerand1tablespoonsoysauce.Addchicken,sweetpotatoesandonion,andtossuntilcoated.3.Arrangechickenmixtureinpreparedpan.Roast30to35minutesoruntiljuicesrunclearwhenthickestpartofchickenispiercedwithtipofknife.Transfer

    chickenmixturetowarmplatter.Drizzlewithremain-ing2tablespoonssoysauce.Servewithpanjuices.Makes4main-dishservings.

    TIP:Ifchickenpiecesaredonebeforepotatoesarecookedthrough,removechickentoplatter;coverwithfoiltokeepwarm,thencontinuecookingpotatoesuntiltender.

    Eachserving:About470calories,13gtotalfat(3gsaturated), 139mg cholesterol,575mg sodium,40gtotalcarbs,5gdietaryfiber,46gprotein.

    Forthousandsoftriple-testedrecipes,visitourweb-siteatwww.goodhousekeeping.com/recipefinder/

    ItwasAmericanradioandTVwriterandcommentatorAndy Rooney whomade thefollowing sage observation: Computersmakeiteasiertodoalotofthings,butmostofthethingstheymakeiteasiertododontneedtobedone.

    Theiconic 1980s video games Pac-ManandMs.Pac-Manhad256levels,thoughitsbeenreportedthatonbothofthem,the256thlevelhasbugsthatmakeitunplayable.

    Theearliestknownexamples ofdrinkingstrawswerecreatedoutofgoldandlapisla-zulibytheancientSumerians.Itseemstheywereusedby royaltytodrinkbeer,therebyavoidingtheyeastresidueleftoverfromthefermentationprocess. Ittakes 450 skilled workers tocreate aSteinwaygrand piano-- and the pianoismadeupofabout12,000individualparts.Ifyouarelike83percentofadultAmeri-cans,youreceivedagiftyoudidntwantdur-ingtherecentholidayseason.Ifyoureaheavycoffeedrinker,youmightwanttoconsiderthefollowing:Astudycon-ducted in the United Kingdom found thatthosewhoreportedthehighestconsumptionof caffeine alsowere more likely to reporthallucinationsandotherextrasensoryexperi-ences.TheCampbellsSoupportraitscreatedbyAndyWarholhavebecomeiconsofthePopArtmovement, andtodaytheysell atauc-tionforupwardof$10million.Theywerentalwayssowell-regarded,however;in1962,actorDennisHopper(avisionaryartcollec-tor,itseems)purchasedoneofthefirstex-amplesforamere$75.

    Thought for the Day: I have known a vast

    quantity of nonsense talked about bad men

    not looking you in the face. Dont trust thatconventional idea. Dishonesty will stare

    honesty out of countenance, any day in the

    week, if there is anything to be got by it.

    -- Charles Dickens

    Copyright2011KingFeaturesSyndicate,Inc.

    Copyright2011KingFeaturesSyndicate,Inc.

  • 8/8/2019 The Lynchburg Times 1/6/2011

    11/16

    January 6 - 1, 011 The Lynchburg Times Page 11Read every issue online at www.lynchburgtimes.com

    Copyright2011KingFeaturesSyndicate,Inc.Copyright2011KingFeaturesSyndicate,Inc.Copyright2011KingFeaturesSyndicate,Inc.

    Tebow: False Prophetor Mile-High Messiah? AndsoitwasthatonthefirstSundayafterChrist-mas,astarappearedtothefaithfulinDenver. Hehadbeenheraldedforseeminglyages--blessedwithastrongarm,fleetoffootandpossessingastrongfaithinGod.ThismanisnamedTimTebow,buthehas beencalled TimTremendous,the Mile-High

    MessiahandTouchdownJesus--anicknametheseriouslyevangelicalTebowmustsurelyfrownupon. TheBroncoshavealwaysinspiredacertainkindofreligiousfervoramongtheirfollowers.ButithasbeenalongwhilesincetheyhavebeentothePromisedLand,anddespiteafewpromisingstartsfromquar-terbackKyleOrton,theBroncoslosttheirwayin2010.Withtheexceptionofanepicbeatdownoftheirdivi-sion-rivalChiefs,theBroncoshaveseeminglyplayedwithoutsoulorconviction(atleastnotthegoodkind). Anddespiterelativelygoodnumbers,itwasOrtonbanishedto thesidelinesandTebowmovedout ofclipboardpurgatoryonDec.19.Anddespitea39-23roadlosstotheRaidersofOakland,manyfanssawa

    revelationonthefield. Inthatcontest,Tebowhitoneightofhis16passes,goodfor138 yards, includinga 33-yardtouchdownpass.Healsobrokeoffa40-yardtouchdownrun--thelongesttouchdownrunforaquarterbackinBroncoshistoryandthelongesttouchdowninNFLhistoryforaquarterbackinhisfirststart.Butwait,TebowbecamejustthethirdquarterbackinNFLhistorytothrowforatouchdownof30ormoreyardsandrunforatouch-downof40ormoreyardsinthesamegame.WhenyouconsiderthatthisisthehousethatJohnElwaybuilt,thenumbersbecomeevenmorestaggering. Thencamehisfirstwin--a commandingperfor-manceinDenverwhereheralliedtheBroncosfrom

    a17-0deficitathalftime,finishingwith308passingyards,onetouchdownpassandafourthquarterrush-ingtouchdown,whichcappedthecomeback.Itwasonlytwogames,butfanssawenoughinhisarmandpoisetogetplentyexcitedabout.Hisrecord-settingcollegecareer(includinghismind-bending,HeismanAward-winning sophomore campaign) had alreadygivenhimafaithfulflock--hisjerseyisthebestsellingintheNFLandthemosteverforarookie--andtheybelievethereismoretocome. Tebow,thoughenthusiastic,displayedhisChristianhumility. IntheNFL,everythingyoudoisaninterview,anditisanaudition,hesaidafterthegame.Youalwayshavetoputyourbestfootforward....Iwilltrytodonothingless,personally. TheDenverfaithfulwanttobemadebelievers.

    Mark Vasto is a veteran sportswriter and publisherof The Kansas City Luminary.

    Answers

    1.Johnhad288victories;Blyleventallied287.2.JohnDenny(1983)andSteveBedrosian(1987).3.HawaiisColtBrennan(2007)andTexasTechsGra-hamHowell(2008).4.HoustonsCalvinMurphyhit95.8percentofhisfree

    throwsin1980-81.5.ScottNiedermayer.6.WilliamDeHartHubbard,inthelongjumpin1924.7.CristieKerr,in2010.

    1.Whohadmorecareervictoriesasa major-leaguepitcher:BertBlylevenorTommyJohn?2.Threedifferent Phillies pitcherswon theN.L.CyYoungAwardatleastonceduringthe1980s.OnewasSteveCarlton(1980,82).Nametheothertwo.3.WhenCentralMichigansDanLeFevoursetamajorcollegefootballcareerrecordin2009fortotaltouch-downs(150),whosemarkdidhebreak?4.TorontosJoseCalderonsettheNBArecordforfree-throwpercentagein2008-09at98.1percent.Whohadheldthemark?5.WhoistheonlyplayerinhockeyhistorytowinaStanleyCup,anOlympicgoldmedal,a worldcham-pionship,aWorldCup,aMemorialCupanda worldjuniortitle?6.NamethefirstblackU.S.athletetowinanOlympicgoldmedalinanindividualevent.

    7.WhowasthefirstU.S.golfertoclaimtheNo.1spotintheLPGAsworldrankings,whichbeganin2006?

    Earnhardt Jr. Still aWinner With Fans Atthemoment,thereisnodirectcorrelationbetweenpopularityandperformanceatNAS-CARslevel. DaleEarnhardtJr.,whowonafanvote tobecometheSprintCupSeries Most PopularDriverfortheeighthyearinarow,finishedamere21stinthepointstandings.Theseasonwasntwithoutitshighpoints:Earnhardthadapole,threetop-fivefinishesandeighttop10s.Hefailed,however,tomaketheChaseforthesecondtimeinasmanyyearsandafourthtimeinthepastsix. Thethird-generationdriver--fatherDalewonseven championships andgrandfather Ralphwasalegendaryshort-trackchampion--haswon justoneCupracein the lastfoursea-sons. Myfanbasehasstayedstrong,saidEarn-hardtJr.Itsbecomeanimportanthonoreachyearforme,andImgladthatfansstillfeeltheir

    supportfor me.I appreciate their dedicationandloyalty. Believeitornot,Earnhardtisnttheall-timeleaderinMostPopularDriverawards.BillEl-liott,stillactiveatage55,wontheaward10

    years ina row and 16times overall beforewithdrawingfromconsiderationafterclaimingtheawardforthe16thtimein2002.

    ThelatestattempttogetEarnhardtbackuptospeedisachangeofcrewchiefs.ThreeofthefourdriversatHendrickMotorsportswillbematchedwithdifferentcrewchiefs.SteveLe-tarte,formerlywithJeffGordon,willnowdirectEarnhardtsefforts. Lance McGrewmovestoMark Martinsteam,andAlan Gustafson willnowworkwithGordon. Forobviousreasons,thepairingoffive-timechampionJimmie Johnsonwith Chad Knauswillremainintact. Earnhardts star has dimmed sincehe fin-

    ishedthirdinthe2003standingsandwonaca-

    reer-bestsixracesthefollowingyear.Hehasntwonmore than a single race inany seasonsince.Hiscareervictorytotal,18,rankshiminatiefor38thplaceall-time. SincemovingfromwhatwasthenDaleEarn-hardt Inc. to Hendrick Motorsports in 2008,Earnhardthaswononlyonce,atMichiganIn-ternationalSpeedwayon June 15,2008.Hiswinlessstreakisnow93races.

    Monte Dutton covers motorsports for The

    Gaston (N.C.) Gazette. E-mail Monte at nas-

    carthisweek@yahoo.com.

    Dale Earnhardt Jr. is NASCARs mostpopular driver -- again. (Photo: GettyImages)

    This could be your ad

    for just $25AdvertiseinThe Lynchburg Times

    and reach 20,000 readers!WereineveryMcDonalds,Kroger,

    FoodLion&lotsofotherplaces

    sales@AdvertiseLynchburg.com540-683-9197

  • 8/8/2019 The Lynchburg Times 1/6/2011

    12/16

    Page 1 The Lynchburg Times January 6 - 1, 011 Read every issue online at www.lynchburgtimes.com

    [We are pleased to welcome columnist

    Kelly Harman to Te Lynchburg imes]

    By Kelly HarmanTe Lynchburg imes

    Im going to cry like a baby, I told thenurse. I just want you to be prepared.Dont worry, youre only going to eel a

    slight pinch, she replied.Ten she pulled out a needle about eight

    eet long and smiled.I started crying.I wish I could say this was a bad dream.

    But this was my day yesterday. Since JulyIve had a small tiny itsy bitsy little placeon the side o my nose that has beenbleeding, scabbing over, and then bleed-

    ing again. Since that is obviously NONORMAL, I nally went to visit my doc-tor in September. It may be some ormo skin cancer, he said calmly. Lets try toget you into a dermatologist right away.I think it takes practice to be able to saystu like that calmly. So I practiced say-ing, I may have a orm o skin cancer,several times beore I called my mother.

    Let me tell you about dermatologists.First o all, it takes orever to get an ap-pointment with a dermatologist. Tey

    are all booked up at least three to ourmonths in advance. My sister the nursesaid its because dermatology is one o theleast protable careers or a doctor. Andyet they still have to go through as many

    years o training as any other practice andtake on just as much medical school debt.So not a lot o people pick this line owork, hence the long wait and why Im al-ready questioning the wisdom o anyonewho selects this line o work.

    I nally got in to see Dr. Caballero inNovember. My little hot spot on the sideo my nose was still bleeding. Its just alittle thing, I said. Im sure its nothingand Im over reacting. I was eeling veryprotective o my nose.

    Did I mention it was a very small spot?But according to Dr. Caballero it did

    look suspicious and he wanted to conduct

    a BIOPSY, which is a very scary word thatrequires practice when using it in a sen-tence that reers to yoursel.

    It will be a small scraping o the side oyour nose, he explained. Well send it tothe lab and know in less than 10 days i itis Basel Cell Carcinoma. And that is howI ound mysel staring at an 8 oot longneedle crying like a baby.

    o be honest, while the needle did sting

    at the beginning, ater about 45 secondsthe numbing agent went to work and itwas much less painul. And there is a pos-sibility that the needle was only about 2eet long and I was exaggerating just alittle bit. Also, I will admit there was apart o my brain that kept telling me thiswas good practice to prepare me or Re-stylane shots, which my girlriends assureme hurt like hell but are totally worth it.

    When everyone was sure my nose wascompletely numb by poking it extensivelywith yet another very sharp needle, thedoctor went to work. For all the dramathe actual biopsy took about 4 seconds.

    He just scraped a little divot in the side omy nose. Te nurse, who by this time hadrealized I wasnt joking about the babything, held my hand through the entireprocedure. Ive been told that the resultswill come back in about 10 days and Illknow or sure i the cells are cancerous.And even i the test is positive, this is agood type o cancer, although that is acompletely moronic way o reerring to

    any type o cancer.As the nurse was cleaning up my nose

    and applying a bandage she assured methat shed seen much worse behavior inthe past. I didnt bother asking i the oth-er badly behaved patients were over theage o six. When I got up to leave she pat-ted my shoulder and said, It was nice tomeet you.

    It was nice to meet you too, I quavered.NO!!! Kelly Harman is a serial entrepreneur

    and marketing expert. She loves technol-ogy, entrepreneurship, reading, writing, going to spas with her girlfriends, spend-

    ing time with her grandchildren and own-ing lots of gadgets. She works at a $250million technology company where she isresponsible for marketing and public rela-tions.

    In her late 40s, Kelly is married to thelove of her life, Bob Harman (often re- ferred to as Saint Bob in her writings.)She can be contacted at kellyh99@gmail.com.

    Cry like a baby: My skin cancer saga part 1

    Copyright2011KingFeaturesSyndicate,Inc.

    Tax-Prep Software Even if youve always done your taxeswithpencil,paperandacalculator,therearebenefitstousingatax-preparationsoftwareprogram.Thebiggestoneisaccuracy.Theneaterandmoreaccurateyourtaxreturnis,thelessreasontheInternalRevenueServicewillhavetostudyyourreturnmoreclosely. Someofthemorewell-knownprogramsare

    TaxCut,TurboTax,H&RBlockandTaxACT. Beforeyoubuy,readtheboxcarefully.Willtheprogramrunonyourcomputer?Willtheincludedformscoveryourtaxsituation?Forexample,ifyouhaveasmallpart-timebusi-

    nesswithScheduleCexpensesandincome,abasicprogramlikelywontincludetherightforms. Generally, all tax-software programs arethesame. --Theprogramwillstartby askinga lotofquestions.Onceyouenterthepersonaldata,suchasyourname,addressandSocialSe-curitynumber,youwonthavetodoitagain.Thereasonformanyofthequestionsisthattheprogramwilldecidewhatformsyouneed.

    Havepatiencewiththeonesthatdontapplytoyou. --Theprogramholdsyourinformationfromoneyeartothenext,andmanyentrieswillbeautomaticallytransferredovertothenewforms. --Theprogramwillfillinnumbersautomati-callyfromoneformto the next,lesseningyourchancesoftransposingdigitsorleavingsomethingout. --Attheend,theprogramwilldoareview

    andshowyouwhereyoumighthaveleftoutinformation,placeswhereyoufalloutsidetheexpected average response, and mostim-portantlywhichplacesonyourformarelikelytobeflaggedbytheIRS.

    --Youcaninstallyourstatesprogram,andthenumberswilltransfertoitfromtheFed-eralportionofthesoftware. Beforeyoubeginenteringnumbersinthetax program,check the mathon yourW-2FormoranyForm1099youreceivedfromself-employmentwork.Ifitswrong,notifythecompanyandhaveacorrectedformsenttoyouandtheIRS. While working in the software program,dontoverrideanynumbers.Instead,ifthey

    dont look right, backtrack and investigatenumbersyouvetypedinandseewherethediscrepancystarted. If you made more than $600 in miscel-laneousor self-employedwork,you shouldhaveaForm1099forthat.RememberthatacopyofeachonegoestotheIRS,sodontleaveanyout.

    David Ufngton regrets that he cannotpersonally answer reader questions, but will

    incorporate them into his column whenever

    possible. Write to him in care of King Fea-

    tures Weekly Service, P.O. Box 536475,

    Orlando, FL 32853-6475, or send e-mail to

    columnreply@gmail.com.

  • 8/8/2019 The Lynchburg Times 1/6/2011

    13/16

    January 6 - 1, 011 The Lynchburg Times Page 1Read every issue online at www.lynchburgtimes.com

    Salahis civil litigation dance back in court FridayUnpaid $5k fee for Feb. 2010 photographs, at issue in district court

    Exclusive:By Dan McDermott and Roger BianchiniTe Lynchburg imes

    On Friday, Jan 7, one hal o Warren Coun-tys most amous alleged White House gate-crasher and Reality V couple is due back in aWarren County Courtroom on an appeal o a$5,000 civil claim he won against an executiveat a national celebrity gossip website.

    On September 3rd in Warren County Gen-eral District Court areq Salahi received a de-ault judgment o $5,000 against Dylan How-ard. Salahi claims Howard never paid him anagreed upon $5,000 ee or photographs takeno Salahi and his wie Michaele the weekendo February 20th at the Salahis private resi-

    dence in Warren County.Howard is Senior Executive Editor or Rad-arOnline.com. Radar Online was bought byAmerican Media several years ago. AmericanMedia owns national tabloids Te Star, TeGlobe and National Enquirer. According to

    Wikipedia Howard has appeared on a widerange o television and radio programs asa news expert. Included on that list are En-tertainment onight, Te Insider, CNN, FoxNews, HLN, CBS News, ABCs Nightline,Good Morning America, MSNBC, Inside Edi-tion, the BBC, Britains Sky News and HLNsprime-time program Issues With Jane Valez

    MitchellHoward, whose address in court docu-ments is listed as 55 Wall Street in New YorkCity, is seeking to have the judgment againsthim voided and money taken as a result o asubsequent garnishment issued Sept. 27th re-turned. Court records indicate Howard claimsareq Salahi knew his apartment number butwithheld it rom the afdavit so that he couldnot be successully served. Te result was thatHoward says he was unaware o the claim orcourt date and did not appear or have repre-sentation in Warren County General District

    Court in September to tell his side o thestory. Te deendants New York City addressis described in his appeal o the judgment asa huge apartment complex with hundreds ounits.

    A $5,000 invoice rom areq Salahi or Ce-

    lebrity Photography or 3 hours in the casele contains the notation Originally sent:April 30, 2010 and Resent: May 20, June 21& June 29, 2010. Tat invoice is addressed to:Dylan Howard, 55 Wall Street, Apt. 824, NewYork, NY 10005-2826.

    At stake in the Jan. 7 hearing scheduled be-ore Judge W. Dale Hou is a total o $5,451in allegedly unpaid ees, interest and courtcosts. areq Salahi is represented in the mat-ter by Manassas-based, local attorney DavidSilek.

    Te case le includes an alleged e-mail ex-change between Salahi and Howard datedFeb. 16-18-19 indicating the Salahis agree-ment to do the photo shoot the coming week-end.

    Michaele and areq, How is everythinglooking or the photo shoot I want to do? Myoer o $5,000.00 is rm and hope we can domore ater this. How is your schedule the nexttwo weeks? Howard e-mailed the Salahis onFeb. 16 according to court records.

    Dylan, my wie & I have agreed. Pleaseconrm. We are ree this weekend, areqSalahi replied on Feb. 18.

    On Friday, Feb. 19, again according to courtrecords, Howard e-mailed the couple to con-

    rm, stating he would take photos o thecouple together and separately, adding, I willpay you $5,000 or the photos. In addition, iyou allow me to take video o you two, RadarOnline may also be interested in purchasingthat or an additional $5,000 or $10,000

    Howard allegedly concludes this nal pre-shoot e-mail by alerting areq that he willalso need to ask some questions o you aboutplaying polo with Prince Charles & PrinceHarry. You had some interesting anecdotes,rom memory, about Harry. Te reerencesare to Charles, Queen Elizabeths son and heir

    to the British throne and his and the late Prin-cess Dianas youngest son Harry.

    Reached late Wed., a spokesperson or WideEye Communications provided Te Lynch-burg imes with the ollowing statement:

    In a publicity stunt aimed solely at garner-ing media attention, the Salahis, whose noto-rious history speaks or itsel, recently namedWIDE EYE and its principal Dylan Howard asdeendants in a rivolous lawsuit.

    Tere is absolutely no merit to the Salahisclaims.

    We look orward to vigorously deendingourselves in a court o law and speaking withthe Commonwealth o Virginia and law en-orcement to expose yet another raudulentact perpetrated by these individuals, in thisinstance, the creation o ctitious e-mails.

    Responding just prior to press run, Salahiattorney David Silek said the ollowing:

    Te Salahis are once again the subject oa baseless attack. First, Wide Eyes assertionthat it is a deendant in this matter is simplyalse. So inquiry must begin with that alse as-sertion. Second, i service did not get to Mr.Howard, ne. So be it. His attorney ailed toenter a special appearance and rather enteredwhat is known as a general appearance in thismatter and has given our Court jurisdictionover Mr. Howard. Now that Mr. Salahi has

    counsel in this matter, any procedural dif-culties will be corrected. We look orward tosetting this case down or hearing and a trialon the merits. We are certainly glad that Mr.Howard elected to make a general appearanceand give our court in personum jurisdictionover him, which was lacking as he was servedby the secretary o the Commonwealth.

    Tird, Mr. Howard came to VA to take pic-tures o the Salahis and then I assume soldthe pictures to someone. It is a shame that henow reuses to honor his obligations.

    dan@lynchburgtimes.comrogerb@warrencountyreport.com

    Tareq and Michaele Salahi leave the Warren County, Va. Court-house Dec. 4, 2009. Giving chase were the Washington Posts

    James Hohmann, now national political reporter for Politico andformer Fox 5 DC reporter Claudia Coffey, now anchoring at WHAS11 in Louisville. Mr. Salahi returns Friday in a $5,000 case againsta celebrity gossip website editor. (Roger Bianchini/Landov)

    CONVERSATIONAL LANGUAGE CLASSESComplete the course and earn 1.0 CEU

    (Continuing Education Unit)

    Arabic IArabic IIChinese IChinese II

    German IHebrew IHindi IHindi IIRussian IRussian II

    Feb. 8Apr. 19 (Tuesdays)Feb. 10Apr. 21 (Thursdays)

    Feb. 15Apr. 26 (Tuesdays)

    Feb. 15Apr. 26 (Tuesdays)

    Feb. 15

    Apr. 26 (Tuesdays)Feb. 1Apr. 12 (Tuesdays)

    Feb. 1Apr. 12 (Tuesdays)Feb. 1Apr. 12 (Tuesdays)

    Jan. 25Mar. 8 (Tuesdays)

    Mar. 22May 3 (Tuesdays)

    Cost is $75 for a 10-week course

    For more information or to registerEmail: cpce@liberty.edu

    OrVisit www.liberty.edu/cpce

  • 8/8/2019 The Lynchburg Times 1/6/2011

    14/16

    Page 1 The Lynchburg Times January 6 - 1, 011 Read every issue online at www.lynchburgtimes.com

    Omega-3 for the Eyes

    One benefit ofstudiesis that researcherscangobacklatertothedataandlookatitinadifferentway.Inonerecentcase,theWilmerEyeInstitutearmofJohnsHopkinsSchoolofMedicinereviewedastudydoneinthe1990sandputtogethernewinformation. Scientiststookastudyaboutthecorrelationbetween Age-related Macular Degeneration

    (AMD)anddiet,andconsideredhowOmega-3infishandshellfishmightplayapart. Omega-3,acertainkindoffattyacid,wasntassociatedwithhealthbackwhentheoriginalstudywasdone.Now,knowingthatOmega-3ishelpfulinanumberofwaysinthebody,theyturnedtheirsightstohowthatoilworksintheretinaoftheeye. Morethan2,000seniorsbetweentheagesof65and84participatedinasurveyaboutwhat

    theyateforoneyear.Thenewanalysisofthatdata asked whether those whoroutinely atefishandshellfishwereofferedanyprotectionfromtheonsetofAMD.Answer:Yes,theywere.ThosewhohadadvancedcasesofAMDweremuchlesslikelytoeatseafoodwithOmega-3. Atthesametime,researchersaskedwhether

    participantswereprotectedfromAMDby thezincincrabsandoysters.Theanswer:No,theywerent. However,weshouldntjumpthegun.There-searcherswerequotedassayingthatthisisapotentialwaytoavoidAMD.Afterall,itwasasmallstudy,andtheparticipantsself-reportedwhattheyate.Theyrecallingthisagoodfirststepandsayingthatarandomizedstudyshouldbedone. Ifyoureconcernedaboutyoureyes,askyoudoctorif youcouldbenefitfromeatingfishor

    shellfishonceaweek.

    Matilda Charles regrets that she cannot per-

    sonally answer reader questions, but will

    incorporate them into her column whenever

    possible. Write to her in care of King Features

    Weekly Service, P.O. Box 536475, Orlando, FL32853-6475, or send e-mail to columnreply@

    gmail.com.Copyright2011KingFeaturesSyndicate,Inc.

    When Medicines Failto Quell HeartburnDEAR DR. DONOHUE: I am 25. I have a seriouscase of GERD. Ive been put on four differentmedicines. They arent working.

    I also have palpitations throughout the day.Ive been told by doctors and nurses that there i snothing dangerous about them. Id like to know ifthis true. -- J.C.

    ANSWER:GERD--gastroesophagealrefluxdisor-der--isheartburn.Itstheupwardspurtingofstom-achacidanddigestivejuicesintotheesophagus,theswallowingtube,aplacethatisnotabletocopewiththesecorrosivejuicesthewaythestomachis. EliminateorgoeasyonfoodsthatmakeGERDworse: citrus fruits; tomatoes; onions; carbonateddrinks;spicy,fattyorfriedfoods;chocolate;pepper-mint;andcaffeine.Ifyoureoverweight,weightlosslessensGERDsymptoms.Dontliedownaftereat-ing.Dontsmoke.Sleepwithyourhead,chestandstomachona slopebyputting6-inchblocksunderthebedpostsattheheadofyourbed.Thatpositionkeepsstomachacidinthestomach.Dontwearany-

    thingthatconstrictsyourstomach,liketightpantsortightbelts. Medicinescalled protonpump inhibitors nearlycompletely turnoff acidproduction. Nexium, Pre-vacid,Prilosec,Protonix,AciphexandDexilantare

    theirnames. If you still have heartburn while onthesemedicines,itsOKtouseanantacidalongwiththem. Ifmedicinesfail,othercausesofheartburnneed

    consideration,things likebilerefluxor eosinophilicesophagitis. If these conditions arent found, thensurgicaltreatmentofGERDisanoptionthatsopentoyou. Palpitations mean a thumping or racing heart.Theycanbefeltasathudinthechest.Thecauseisanextrabeat--ormorecorrectly,aprematurebeat--onethatcomesbeforeitshould.Thebeatafterapre-maturebeatisdelayed.Duringthedelay,theheartfillswithmorebloodthanusual,andthatcausesathumpinthechestwhentheheartempties.Prema-turebeatsarealmostalwaysinnocentandneednotreatment.Youcanbelieveyourdoctorsandnurses.

    The booklet on GERD explains this commonmalady andits treatment.Toorder a copy, write:Dr.Donohue--No.501W,Box536475,Orlando,FL32853-6475.Enclosea checkor money order(nocash)for$4.75U.S./$6Canadawiththerecipientsprintednameandaddress.Pleaseallowfourweeksfordelivery.

    DEAR DR. DONOHUE: Can you give me insightinto the Hamman-Rich syndrome? My fatherpassed away from it. -- L.R.

    ANSWER:Icantellyouonlyalittle,becauseonlyalittleisknownaboutit.Itsalunginjurythatcomesonsuddenly,withdamageto thelungairsacs(thealveoli)andthespacesbetweentheairsacs,thein-terstitium.Thecauseisunknown.Becauseofsuchdestruction,oxygencannot getintothe blood.Pa-tientsareseverelyshortofbreath,haveafeverandtheycough.Theonlymedicinesareonestokeepthepersongoingasbestaspossible.Thereisnocuremedicine.Evenwitha ventilator,deathhappenstomorethan60percentofthesepatients. Itsanillnessthatremindsdoctorsthattheydonthaveananswerforeverymalady.Youandyourfam-ilyhavemycondolences.

    Dr. Donohue regrets that he is unable to answerindividual letters, but he will incorporate them in his

    column whenever possible. Readers may write him

    or request an order form of available health newslet-

    ters at P.O. Box 536475, Orlando, FL 32853-6475.

    Differences in Care WhatsamazedmefromDayOnearethebigdifferencesinlevelsofcarefromonepartofthecountrytoanother.Ivegotveteranswrit-ing(ortellingmeinperson)thattheirmedicalcareisoutstanding,thatappointmentsmadeinadvancearekept,thattheygetaheads-up call to make sure theyve rememberedtheappointment,andthattheyreextremelysatisfiedwiththecaretheyregettingfromtheDepartmentofVeteransAffairsonalllevels. Ontheflipsideofthecoinareveteranswho

    writemedescribinganightmarelistofprob-lemsingettingthecaretheyneed. Thelistofpossiblereasonsforthevariationsislong.Hereareafewthatcometomind: --Problemsat thetop: When departments

    arerunbypeoplewhoareslipshod,whotrytohidemistakes,andwhoareinsomewaytakingadvantageofthesystem,thepeopledowntheranksseeitandactaccordingly. --Other departments: If there is spilloverfromonedepartmenttothenextintermsofdutiesor chain of command, there canbeproblems if thefirstdepartment isnt doingwhatitssupposedto--likedominosfalling. --Regionaldifferencesinstaff:Ihatetosayit,butIthinkthisoneisabiggie.Therereallydoesseemtobe adifferenceinhowveter-ansaretreatedacrossthecountry,notonlyintermsofaccuracyanddiligenceinhandlingtheir medical affairs, but in plain everydaypoliteness.Itsasthoughsomeareasofthecountryforgetthatitstheveteranstheyretoserve,nottheotherwayaround. Its too bad that VA employees cant beshuffledaroundbythehundredstoseehowotherfacilities operate. Afterall, excellencebreedsexcellence,right?

    Write to Freddy Groves in care of King Fea-tures Weekly Service, P.O. Box 536475,

    Orlando, FL 32853-6475, or send e-mail to

    columnreply@gmail.com.

    Copyright2011KingFeaturesSyndicate,Inc.2011NorthAmericaSyndicate,Inc.AllRightsReserved

  • 8/8/2019 The Lynchburg Times 1/6/2011

    15/16

    January 6 - 1, 011 The Lynchburg Times Page 1Read every issue online at www.lynchburgtimes.com

  • 8/8/2019 The Lynchburg Times 1/6/2011

    16/16

    Page 16 The Lynchburg Times January 6 - 1, 011 Read every issue online at www.lynchburgtimes.com

    ACROSS1Home-(90film)6Faithful11Elated15Tightenthetent18Nigeriancapital19ActressVerdugo

    20Paddled22Multipurposevehicle23Photographyeventof190026Unforgettablename27Snickersound28MexicanMrs.29Haveamortgage30Attack32Snigglersquarry34BaseballsPiniella35TVsGreen-37Youngfollower?41Literaryeventof190048RobertsorTucker

    50Onlyjust51OlympicVIP52Med.test53Takein,perhaps54Bigbangletters55Distress56Terror57Exhibitioneventof190062Solidaritycity64WeldonorWray65Andothers66Utahcity68Waytogo69DonizettisLelisird-70QuelerorArden71Heavenlyhunter73Meirssuccessor75Knightswife

    77Clasp78Scalenotes81Easeasituation82Musicaleventof190086Huckscraft87Servicediv.89-Doll(64hit)90Uraniassister91SkaterMidori92Actcatty?94Anesthetictype97Object98Transportationeventof190010290Acrossinstrument103MosheofIsrael104Shadycharacter?105Highpeak107MultivoicedMel109CoachParseghian110Favorite113-terrier

    117Massage118Culinaryeventof1900124Everylastbit125Humpbackshome126Luncheonettelure127Gawk128Payable129Makeslace130ActorGary131Detectiondevice

    DOWN

    1TVET

    2Cafeau-3Fairy-talefiend4Snack5CosmeticianLauder6Papalname

    7Autopioneer8Centurysegment9LonelyBoysinger10Researchsite11Becomeanadult12RobofWaynesWorld13Barleybeard14Agnus-15WordinaDostoyevskytitle16Coupd-17See115Down21Rubble24Boatbottom25Commodious31GuitaristPaul33Tennisstroke34-Abner35Cainsvictim36ActorGulager37Rod

    38ActressShire39Threshold40Breadandbooze42Upset43Bondfoe44NewYorkteam45RaidonEntebbeweapon46Rubout47BogardeorBenedict49Apollossister55Veneration56Hawthorneswasmarble58Makeamends

    59Mideasternletters60Flyachopper61Tramstransportit62Barbecue63Drewwhiledistracted

    67Connecticutnative69Borderon70Aussiewalker72HugosLe-samuse73Lasso74Pricedright76Caninegrp.78Fulloffroth79PianistSchnabel80Alittlenightmusic?81Wetblanket83Junket84Fadeaway85SongwriterJacques87Englisharchitect88-deco9260Hitchcockclassic93ActressThurman94Likesomeenergy95Petitepooch96ThompsonorSalonga

    99RockerWhitcomb100Augustshows101554,toTiberius106Preserveapetunia107Nailtype108Bergopera109Blindas-110Callaoscountry111Desiredeified112Useastopwatch114Divisionword115With17Down,famedsaxophonist11651Acrossmissis119Pretend

    120Cry-River(55song)121Yak122Ayeopponent123Augsburgarticle

    The Lynchburg Times Crossword: CENTENNIAL

    Copyright2010KingFeatures

    Syndicate

    ,Inc

    .,Allrightsreserved

    .

    Puz

    zling Answers

    The Lynchburg Times

    Sudoku!by Linda Thistle

    Howtoplay:Placeanumberintheemptyboxesinsuchawaythateachrowacross,eachcolumndownandeachsmall9-boxsquarecontainsallofthenumbersfromonetonine.

    Copyright2010KingFeaturesSyndicate,Inc.

    Difculty this week: Challenging

    Copyright2010KingFeaturesSyndicate,Inc.

    The Lynchburg Times

    Hocus-Focusby Henry Boltinoff

    This could be your full-color ad for just $57

    AdvertiseinTheLynchburgTimesandreach20,000readers!

    WereineveryMcDonalds,Kroger,FoodLion&lotsofotherplaces

    sales@AdvertiseLynchburg.com

    540-683-9197