Post on 20-Dec-2014
description
WWW.NAILSMAG.COM OCTOBER 2011AMY BECKER TAKES THE TOP SPOT AFTER 15 YEARS ON NAILS TOP 25 LIST Buy It in Pinkto Help End Breast CancerNail Techs Dont Let Nail Techscure(preview the fall gel color collections)fallFORTHERetailing TIPS for the Timidna1011Cover.indd 2 8/24/11 12:19:33 PMIn Salon: May 1, 2011ORLY Nail Lacquers are Free of DBP, Formaldehyde & Toluenesweet peacocknite owl sea gurllucky duckfowl playpeachy parrotAvAlLABLE AT PROFESSlONAL BEAUTY SUPPLY STORES, SALONS AND SALLY BEAUTY.NAlLPRO.COM/FREElNFOUSE FREElNFO #1na1011ads.indd C2 8/24/11 10:51:24 AM800.275.1111 orlybeauty.comGiselle is wearing SWEET PEACOCK na1011ads.indd 1 8/24/11 10:51:29 AM 2011 DisneyUNFROGETTABLECOLORS!ONLY IN THEATERSna1011ads.indd 2 8/24/11 10:06:37 AMGLITTERS12-PIECE DISPLAYREDS & NEUTRALS12-PIECE DISPLAY36-PIECE DISPLAYGL I TTERS*REDS&NEUTRAL SCONTAINS NO DBP, TOLUENE, OR FORMALDEHYDENail Lacquers feature OPIs exclusive ProWide Brush (Patent pending).Call 800.341.9999 2011 OPI Products Inc.*All Glitters also available in Axxium Soak-Off Gel Lacquers for a limited time.Find us on:ANIMAL - ISTIC MEEP - MEEP - MEEP WOCKA WOCKA!PEPES PURPLEPASSIONDESIGNER...DE BETTER!WARM ANDFOZZIERAINBOW CONNECTIONEXCUSEMOI!GONEGONZO!FRESH FROGOF BEL AIRDIVINESWINEGETTINMISS PIGGYWITH IT!na1011ads.indd 3 8/24/11 10:06:43 AM
cnd.com2011 Creative Nail Design, Inc.na1011ads.indd 4 8/24/11 10:06:46 AMAutumns bounty of lively pear and dandeliona little cozy, a little sultry. Indulge in a festival of Fall Fragrance.Pear & Dandelion Scentsations.From CND.FALL HARVEST.na1011ads.indd 5 8/24/11 10:06:49 AMFASTJUST GOT na1011ads.indd 6 8/24/11 10:06:51 AMWWW.|a||larror].corT|e]'re 0orra 0o||a 0e| *HOLVKedA| ]our |oca| d||r|ou|or lor eru|re *HOLVK |oda] Vade |r ||e uSADiminishing Power & Performance of U.V. BulbsU.V. LightBulb & Gel PerformanceMonths 1st2 nd 3rd 4th5 th 6thReplace BulbsNewConsistent Power & Performance of LED LightL.E.D. 18GLight & Gel PerformanceYears 1st2 nd 3rd 4th5 th 6thNo Bulb Replacement Necessary - EVER!www.nailsmag.com/fifi/21285na1011ads.indd 7 8/24/11 10:06:55 AMschool of hard rockssize mattersbobbing for baubleswinter2011cocktailbling.I like to arm myself with bangle janglebrooch the subjectUSAs nail salon expert.Since 1981. essie.comcocktail blingFor more information,call 1.866.313.7845DBP, Toluene and Formaldehyde freena1011ads.indd 8 8/24/11 10:06:58 AMWinter 2011moda_winter_insert.indd 1 9/1/11 10:17:11 AMmoda_winter_insert.indd 2 9/1/11 10:17:19 AMbrooch the subjectDiscreet, smooth, pretty.This creamy cashmere cameo is a sleeper hit,playing a starring role in the most renedwardrobes this season.cocktail blingMilky, mysterious, majestic.A pale blue chalcedony cabochon is the dreamy, creamy center to the archetypal cocktail ring and the color of the season.size mattersRarest of the gems, more valuable than diamond, blazing hot ruby red makes your pulse race and your heart pound. Red carpet diem!school of hard rocksA rock-hard look is easy to achieve when you paint on this masterful midnight malachite. Youll be sitting pretty tough while others go green with envy.bobbing for baublesTry as you might to pin this color down, it is ever elusive slipping through your ngers like the deepest darkest blue sapphire. Hard to get but denitely heart-stopping.bangle jangleLovely limpid pools of light.Float away on a pretty cloud of lavender amethyst that lifts your spirits to airy heights. Pledge allegiance to the bling. A well-placed piece of jewelry makes any outt and ensures all that glitters will be you!These festive, luminous colors evoke the beguiling beauty of the world of gems, and are sure to cause a sensation.Its your destiny to light up the night. In gorgeous we trust.theres nothing like festive, jewel-tone color. bling it on!moda_winter_insert.indd 3 9/1/11 10:17:22 AMcocktail bling6 pc Color CubeHolds one bottle each of 6 colorsSalon Cost: $24.00Sugg. Retail Price: $48.00Item # P0532200UPC Code: 8844860650254 pc Mega Mini Color CubeHolds 4 mega mini colors: Cocktail Bling, Bobbing For Baubles, Bangle Jangle, and Size MattersSalon Cost: $8.50Sugg. Retail Price: $17.00Item # P0532100UPC Code: 88448606501812 Bottle Designer DisplayHolds 2 bottles each of 6 colorsSalon Cost: $48.00Sugg. Retail Price: $96.00Item # P0532300UPC Code: 88448606503236 Bottle Designer Display Holds 6 bottles each of 6 colorsSalon Cost: $144.00Sugg. Retail Price: $288.00Item # P0532400UPC Code: 884486065049winter 2011Available October 1, 2011Individual Bottle Salon Cost: $4.00 Per Bottle Sugg. Retail Price: $8.00DBP, Toluene and Formaldehyde-freeP0523600 For more information, call 1.866.313.7845 or visit www.essie.combobbingfor baubles769size matters771cocktail bling768school ofhard rocks772bangle jangle770broochthe subject773cocktailbling.I like to arm myself with moda_winter_insert.indd 4 9/1/11 10:17:23 AMDBP, Toluene and Formaldehyde freeto nd a cure.raise awarenessraiseawareness. Im speakingout to USAs nail salon expert.Since 1981. essie.comFor more information,call 1.866.313.7845Essie supports Living Beyond Breast Cancer in recognition of Breast Cancer Awareness Month. A portion of the sales will be donated to Living Beyond Breast Cancer,whose mission is to empower all women affected by breast cancer to live as long as possible with the best quality of life.na1011ads.indd 9 8/24/11 10:07:02 AMna1011ads.indd 10 8/24/11 10:07:17 AMwww.nailsmag.com/fifi/21260na1011ads.indd 11 8/24/11 10:07:21 AMthe ultimate in nail fashionna1011ads.indd 12 8/24/11 10:07:24 AM2011 Dashing Diva Professional. 866.665.3482. www.dashingdivapro.comJoin Our CommunityNot all appliqus are created equal. Introducing the rst nail appliqu engineered with: EMBEDDED BEJEWELED DESIGNS SUPERIOR NO-HEAT ADHESION TECHNOLOGYNATURAL NAIL OPTION FOR NO-LIFT WEEK-LONG WEAR GELIFE SOAK-OFF UV GEL OPTION FOR HIGH-GLOSS TWO-WEEK WEAR CUSTOM-CUTTING OPTIONS TO CREATE YOUR OWN NAIL INSPIRATIONSAvailable in 36 stunning designs for ngers and toes.Available November 1 at your local CosmoProf store.WEAR NO NAIL HASGONE BEFOREBEJEWELED 3D DESIGNS9 sizes / 36 appliqusFASHION PRINT DESIGNS14 sizes / 42 appliquswww.nailsmag.com/fifi/21231na1011ads.indd 13 8/24/11 10:07:41 AMModel is wearing NSI Polish Pro Accessory Pink Peep Toes over Ebony (black).na1011ads.indd 14 8/24/11 10:07:44 AMAccessory VintageBurgundyThe Accessory Collection. Instantly multiply your Polish Pro color range.Blue Satin Clutchbefore & afterScan for more information.Polish Pro Accessories. For something striking and totally new, layer anyone of our six Accessories over one of our 42 Polish Pro colors and presto!Chip-free for two weeks or longer. Buy four and get two FREE to own theentire Accessory Collection. Also sold separately. For more information,visit us at nsinails.com. Or, call 1-800-354-6741.Because youre more than Just a Nail Girl.Youre a Pro who knows how to deliver the perfect nishing touch. Help NSI ght breast cancer. For every online order you submit in October, NSI will contribute $5 to the Linda Creed organization. Visit nsinails.com/lindacreed for more details.www.nailsmag.com/fifi/21135na1011ads.indd 15 8/24/11 10:07:55 AMEXPERIENCE THEWOW-FACTOR.Dashing Diva French Wrap Manicurena1011ads.indd 16 8/24/11 10:08:01 AMAPPLY French Wrap PlusCLIP Application tab to release French colorAPPLY Dashing Diva Base Sealand Top SealPatented innovation provides: No-chip, no-smudge French manis Up to 2 weeks of awless wear Perfect smile lines, every time1.2.3.RESULTS A perfect Frenchmanicure that lastson natural nails4.Its All About the WOWwww.nailsmag.com/fifi/21231na1011ads.indd 17 8/24/11 10:08:08 AMna1011ads.indd 18 8/24/11 10:08:15 AMwww.nailsmag.com/fifi/21265na1011ads.indd 19 8/24/11 10:08:29 AMAVANTE-GARDE 03001CONTEMPO 03002DIVA CHIC 03004ECCENTRIC 03006METRO 03007CHEEKY 03008FOXY 03009FAB03010FLASHING 03011DASHING 03012TRENDY 03013TRIST 03014POSH03015SWANKY 03016UPTOWN 03017ALL THE RAGE 03018VOGUE03019FASHIONISTA 03003SOOO IN 03020FIERCE 03021ANGELS03023PRECIOUS03024LUCSIOUS 03025SEDUCTIVE 03026LOVELY 03027PASSION 03028KARMA03029HALO 03030DAZZLED 03031BLING BLING 03032GLISTENING 03033TWINKLES03034PRINCESS 03035HOTNESS 03036PURITY 03037SWAG03038INNOCENCE 03022PROFESSIONAL FORMULASPROFESSIONAL RESULTS38 Artistic Colors Now Available in 60 Amazing Colors www.ArtisticNailDesign.comBeverly Hills CA, 90210USATel: 714. 635. 5110GLAM03005na1011ads.indd 20 8/24/11 10:08:36 AMCelebrity Manicurist Tom Bachik Announces Artistic Nail Designs Colour Gloss Soak-Off Color Gel Salon Manicures 21-Days of Lasting ColorJUICED 03059HOTZY 03058CRAZED 03057WHAM 03055FRENZY03054TEASE 03052DeBLU 03051MISSTEP 03050MUSE 03049SASSY03049LA-TI-DA03047 GLOWING03060FLY 03056WITH-IT 03053CAFFEINE 03040MOCHA-CHINO 03041JAVA JAVA03042CAF' LATE' 03043NAKED 03044GLISTEN 03045PEACH WHIP 03046ILLUSION03039NEW22 Artistic Colors COLOUR GLOSS SOAK-OFF COLOR GELwww.nailsmag.com/fifi/21296na1011ads.indd 21 8/24/11 10:08:44 AMWWW.NAILSMAG.COM OCTOBER 2011AMYBECKER TAKES THE TOP SPOT AFTER15YEARS ONNAILS TOP25LIST Buy It in Pinkto Help End Breast CancerNail Techs Dont Let Nail Techscure(preview the fall gel color collections)fallFORTHERetailing TIPS for the Timid} {in this issueOctober 2011 Volume 29, No. 9Features138The Cure for FallAs the bright shine of summer fades into the earthy tones of fall, perk up your customers with these new color gel collections from your favorite manufacturers.142Retailing for the TimidRetail can be intimidating if you think it makes you look like a salesperson. Rather than thinking of retail as making the sale, consider it a way of ofering your professional opinion.148Victory at Last: Becker Tops the Top 25 Competitors RankingTalk about bragging rights. Amy Becker has earned a spot on NAILS Top 25 Competitors list more times than anyone else in its history. And nally, for our 2010-2011 competition year, shes snagged the top spot.154Buy It in Pink to Help End Breast CancerEvery October businesses join in solidarity to ght breast cancer. By purchasing these passionately pink items, you too are joining in this solidarity as each company donates to organizations that work every day to end breast cancer and the struggles it can bring to women and families around the world.166Nip It in the CuticleA good, sturdy pair of cuticle nippers is a standard piece of equipment for every nail tech. They are a necessary tool to help keep the cuticle and nail plate clean and well maintained. page 142page 138page 114Cover LookNails: Shelena Robinson, Crooked River, Ore.Polish Shown: CND Shellac Black Pool and ZillionairePhotographer: Vu OngModel: Jenna Chong, Body Parts Modelspage 15452top14815414222| NAILS MAGAZINE| OCTOBER 2011138page 148166na1011toc.indd 22 8/25/11 12:21:25 PMHOLLYWOOD, CA Welcome to the entertainment capital of the world and the place the talented and beautiful ock to get discovered! Striking a pose under the iconic Hollywood sign is a must when Touring America, and be sure to pack your most glamorous attireyou never know who you could run into.MODEL IS WEARING MY ADDRESS IS HOLLYWOODFor more information, contact your local OPI distributor.Call 800.341.9999 2011 OPI Products Inc.CONTAINS NO DBP, TOLUENE, OR FORMALDEHYDE COLORS FROM LEFT TO RIGHT:Are We There Yet?, I Eat Mainely Lobster, My Address is Hollywood, Color to Diner For, Honk If You Love OPI, Road House Blues, Suzi Takes the Wheel, French Quarter for Your Thoughts, Uh-Oh Roll Down the Window, A-taupe the Space Needle, Get in the Expresso Lane, I Brake for Manicuresna1011toc.indd 23 8/24/11 2:35:58 PM24| NAILS MAGAZINE| OCTOBER 2011} {in this issueTechnique 7376Demos Step-by-steps from LCN and Angel Love80Signature ServicesStep-by-steps for a Pumpkin Pedicure and a Strawberries & Cream Spa Pedicure84Behind the ScenesFind out how to do the nails that are on this months cover.86A Vibrating Nail?Learn how to use simple, small, and inexpensive electronics to make a fun nail art design that really shakes.Style 8994Nail Art StudioStep-by-steps on new nail art designs96The Jewelry Nailist: Fumic SueyoshiThis New York City-based nail tech combines jewelry, nail art, and creative energy to produce stunning nail masterpieces.100Monster MashInspired by this ghoulish time of year, ve nail artists show of their fun designs and devilish skills as a treat for you.102Boutique: Hair FeathersRemovable and easy to apply, feather hair extensions give highlighted texture and per-sonality to clients locks.84Business 105108 Reader to ReaderOther than money, what would motivate you to work harder at your current salon?110The Big PitchWhen you meet someone who is a potential client, what do you say in a minute or less to introduce yourself as a nail tech?114Nail Techs Dont Let Nail TechsSee what your colleagues think you shouldnt let other nail techs do.118 Salon ProleGloss Nail Spa was the rst business to open in a newly developed Milwaukee neighborhood.Health 127130Under the Microscope: Brittle NailsSometimes called onychorrhexis or onychoschizia, brittle nails peel, split, and break easily.132Its a Sore SubjectSometimes aches and pain seem like an unavoidable byproduct of doing nails. One nail tech disagrees.134Caring for Your Diabetic ClientMake your salon a safe haven for clients with diabetes by learning a few simple steps of added protection.136Secret Ingredient: Base and Top CoatsA closer look at what makes base coats and top coats work.28On My Mind30On Your Mind34Nails File68Freebies & Giveaways70On The RoadIn Every Issue118&ULLHEALTHBENEFITSINCLUDEDNOW HIRINGNAIL TECHS!10896118100156Ad Index 170Reader Nail Art 174Product Spotlight184Deal Sheet 198My Other Lifena1011toc.indd 24 8/25/11 11:14:02 AMYOUVE MET YOUR MATCHGEL INNOVATIONS FROM ORLY COLOR EXPERTSAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES AND SALONS.www.nailsmag.com//21168800.275.1111 orlybeauty.comFor a manicure that lasts as long asyour pedicure, match ngers to toeswith one of ORLYs 32 Gel FX shades. Matchy matchy.na1011toc.indd 25 8/24/11 2:36:24 PMBrowse Halloween Nail Art Ideas. Nail techs all over the globe are uploading photos of their Halloween-themed nail art. Get free inspiration on our Nail Art Gallery.http://nailartgallery.nailsmag.com/tags [Click on Halloween]Aspire to be in the Top 25.Amy Becker has earned a spot on NAILS Top 25 Competitors listmoretimesthananyoneelse.Forour2010-2011 competition year, shes snagged the top spot. Congratulations to her and to the industrys entire top 25 nail competitors.www.nailsmag.com/top25byyear26| NAILS MAGAZINE| OCTOBER 2011View Show Snapshots.For the second year in a row brush-on gel polish lines were the talk of the nail world at beauty trade show Cosmoprof North America. We have a gallery of snapshots from the show including these gels and much more.www.nailsmag.com/2011cosmoprofmag.com.comFind everything youre looking for on www.nailsmag.com. Whether youre researching, shopping, or designing, youll nd inspiration and answers at our website.log on every day toHelp Fight Breast Cancer. October is breast cancer awareness month. Find out what nail products are donating part of their proceeds to this cause and get ideas for nail art designs so you can raise awareness among your clientele. www.nailsmag.com/2011beatbreastcancerand much more.Watch a Tutorial of NAILS Cover Look. NAILStv features a step-by-step video of this months cover nails, with our cover tech showing exactly how she created this months stylish Shellac look.www.nailsmag.com/Oct2011CoverVideoNails by Nail Art Gallery member Oli12352topNAILCOMPETITORSna1011webTOC.indd 26 8/24/11 3:34:11 PMwww.nailsmag.com/fifi/21110na1011webTOC.indd 27 8/25/11 12:29:29 PM28| NAILS MAGAZINE| OCTOBER 2011} {Imgettingkindoftiredofalltheseconsumerbloggers online who are just infatuated with nail polish and post endlessly about polish and doing their own nails. I mean, sure,theyprobablyhelpincreasetheawarenessofnailcareand new products (mostly polish), but I think its time for those of us on theprofessionalsideofthenailworldtotakebackourplaceinthe pecking order. Theyre even starting to inltrate my side of the nail world as well I see as many bloggers taking meetings with manufacturers and hanging out in the press room at trade shows as I do actual journalists.Asnailtechnicians,YOUhavetheinuenceoveryourclientsto sharethelatestcolortrendsandnailstyles.Whoknowsbetterthan YOU about the differences in hybrid gels and what the right treatment for peeling nails is. Dont cede your powerful professional inuence to a bunch of polish junkies who are looking for free handouts of the latest collections from manufacturers. OK, thats a little harsh. But seriously, the professional side of our industry needs to stay at the forefront and the DIY-ers need to take a small step back. The bloggers are the new kids on the block and everyone is fascinated with them. So how do you get your voice heard, you ask? As an educated and licensed nail technician you can speak to clients onalevelthatthepolishenthusiastscant.Youknowwhatservices torecommend.Youknowwhatnailshapeandlengthlooksbeston each of your clients. You know how the products work and why. You know the latest colors, the coolest appliques, and the interesting new techniques (because you read and go to shows and follow professional bloggers). Ive got a couple ideas to help you reclaim your position as the nail expert. >Start your own blog.>Use your web page and Facebook page as a place where you can talk to your clients about whats hot.>Ifyoureanailartist,createaproleonNailArtGallery (nailartgallery.nailsmag.com) and share it with your clients. > Get in touch with the consumer press and offer your expertise for nail style stories. >PutyourownHotOffthePressesbooktogetherwithcolor swatches, nail styles, and trends youre seeing from your fellow nail techs or in your trade magazines. Heck, put stuff you nd on blogs andinconsumermagazinesintheretoo,butpresentittoyour clients as you being their go-to source for all things nail-related. If your clients are getting the information from you, they wont have a reason to get it elsewhere. I dont think consumer bloggers are bad, and I certainly dont think theyre bad for our industry. Ive just been thinkingthattheyretakingthenailcarespotlightfromthosewho rightly deserve it YOU. Move Over, Bloggers!on my mindOctober is Breast Cancer Awareness month, and you can find a number of products supporting the cause on page 154. Give back while supporting your industry. Hannah.Lee@bobit.com na1011omm.indd 28 8/24/11 3:33:39 PMwww.nailsmag.com/fifi/xxxxxwww.nailsmag.com/fifi/21285na1011omm.indd 29 8/24/11 3:33:43 PM30| NAILS MAGAZINE| OCTOBER 2011 Publisher Cyndy DrummeyCyndy.Drummey@bobit.comAssociate Publisher Michelle MullenMichelle.Mullen@bobit.comAssociate Publisher/Editor Hannah LeeHannah.Lee@bobit.comManaging Editor Sree RoySree.Roy@bobit.comFeatures Editor Judy LessinJudy.Lessin@bobit.comSenior Editor Tim CrowleyTim.Crowley@bobit.comEditorial Assistant Joanne TuckerJoanne.Tucker@bobit.comContributing Writers Michelle Pratt, Erin Snyder DixonArt Director Danielle ParisiDanielle.Parisi@bobit.comAssociate Art Director Ajay PeckhamAjay.Peckham@bobit.comGraphic Artist Kimberly PhamKim.Pham@bobit.comProduction Manager Carla BenavidezCarla.Benavidez@bobit.comWestern Sales ManagerMichelle Mullen, (310) 533-2465Michelle.Mullen@bobit.comEastern Sales ManagerMary Baughman, (562) 377-0465Mary.Baughman@bobit.comMarketing/eMedia Coordinator Myla DiazMyla.Diaz@bobit.comAudience Marketing Manager Katie Fillingame For subscription inquiries: (888) NAILS-44, bobitpubs@halldata.comSend business and editorial correspondence to:3520 Challenger St., Torrance, CA 90503(310) 533-2400(310) 533-2507 Faxwww.nailsmag.comChairman Edward J. BobitCEO/President Ty F. BobitChief Financial Ofcer Richard E. Johnson A BOBIT BUSINESS MEDIA PUBLICATIONLogontowww.nailsmag.comtoanswer this months question and check back here to see what other nail techs have to say.} {on your mindEditors Note: You can nd complete industrystatisticsatwww.nailsmag.com/market-research.Wehavethe last six years worth in ipbook format orPDFifyoudliketodownloadthe information.Youllndeverything fromsizeoftheindustrytonailtech demographics to stats on income and buying habits of nail techs. >>>LOOKINGFORSTATS Ijustlove NAILSMagazine.Thankyouforagreat publication. I am in the process of writing abusinessplanforanewcompanyIam foundingandIwaswonderingifyou areawareofanyfabulousnailindustry statistics that I could include in my plan? Heather HillFrenchies Nail Salon, Littleton, Colo.WHAT DO YOU BARTER?Editors Note: Our very own FingerNailFixer bloggerHollySchipperspostedablogabout barteringservicesafterbarteringasetof Shellactoenailswithahairdresserforahair treatment. And we asked our 60,000 Facebook fans(www.facebook.com/nailsmag)what kindofthingstheyveeverbartered.Heres what they had to say:Kandice Astamendi:I have a personal trainer who I barter with.Tera Uphaus:I barter mani/pedis for facials once a month! Soooo worth it!Hilary Knight OKonski:Barter is my middle name. Im getting a logo done now for barter! Michele Ann Galbo:I have bartered for personal training, laser hair removal, massage, and hair services. I just love to barter!Sandi Tomlinson:One time I bought a car and traded manis and pedis to pay it of. It took one year but it was so worth it. And the customer loved it. She didnt pay for any salon services for a whole year.Bri McCloud:I trade services with my friends for various things. Ive bought videos, makeup, gifts for showers, all through barter. Why trade cash when that person is just going to give it back to you for her service?Patricia Knox Mullins:Yes, I love to barter! I have bartered for clothes, tax preps, and many other things! Its a great way to work!Melissa Messmer-Golia:I trade nails for my funky colored hair and cuts! I also traded nails for dog-sitting this summer.na1011oym.indd 30 8/24/11 3:36:00 PMSCAN. WATCH. LEARN. cnd.comSAYGOOD-BYE2011 Creative Nail Design, Inc.na1011oym.indd 31 8/24/11 10:39:23 AM32| NAILS MAGAZINE| OCTOBER 2011EditorsNote:Ifyouarentalready signeduponourNailArtGallery (nailartgallery.nailsmag.com), what are you waiting for? With more than 7,000 artistprolesandmorethan40,000 How can I get ahold of T4 Spa? I would love to order some of their stretched canvas murals.Nancy CarrollVia e-mailEditors Note: You can reach T4 Spa Concepts and Designs at(866)556-2372orwww.t4spa.com.Werecommend usingtheDealerLocatoron the site to nd a dealer in your area.YoucanalsotryAlfalfa NailSupply,whichoffersthe samecanvasmurals,atwww.buynailsdirect.com. Im a busy Albany Technical College student, but I have a passion, studying in the daytime and doing nails by night! Every chance I get, I take the opportunity to read NAILS Magazine. It always helps me to increase my skills and knowledge. Whether I am on the public transit or at school Im reading NAILS, loving every minute of it!Sharmegan KearsonTru Expressions Salon & BoutiqueAlbany, Ga.Do you have a picture of yourself reading NAILS? Send a pic to Hannah.Lee@bobit.com and make sure to include your name, salon name, city, state, and a brief synopsis. Online-based printing service (like vistaprint.com)A local professional printer My own at-home or at-work printer Other I dont have business cards 56.5%17.7%10.9%2.7%12.2%Where do you get your business cards printed?Where in the worldis NAILS Magazine?ICadWisWEB POLLIN SEARCH OF CAREER HANDBOOKI absolutely adore NAILS Magazine and lookforwardtoiteverymonth.Iwant to order the 2011 Career Handbook. Is there a fee for this?Brittany Noel HendersonRock Hill, S.C.Editors Note: Thanks Brittany. The NAILSCareerHandbookisagreat toolforgraduatingstudentsandnew nailtechs.Youcannditonlineat www.nailsmag.com/career-handbook oryoucanorderthemagazinefrom Myla.Diaz@bobit.com.NAIL ART LOVE I love Nail Art Gallery! I couldnt live without it. I check for new photos every day. Thanks for providing such a nice space to share.Kjersta LundeVia e-mailPsssstSend your comments to Hannah.Lee@bobit.com or send us a letter via snail-mail to Hannah Lee, 3520 Challenger St., Torrance, CA 90503. (NAILS Magazine reserves the right to edit letters for space and clarity. Please include your name, address, phone number, and e-mail address.)Log on to www.nailsmag.com to answer this months question and check back here to see what other nail techs have to say.} {on your mindWhere can I purchase Dashing Diva French Wraps? Im in the United Kingdom.Elizabeth SteenVia e-mailEditorsNote:TheU.K.dis-tributorofDashingDivaprod-uctsisBeauMonde/Dashing DivaU.K.Youcanreachthem atwww.dashingdivauk.comor 44 (0) 1332 541299.WHERE CAN I FIND?nailartphotos,itsanynailtechsbest friendforinspirationandsharing.You cansetupyourownproleforfree, createaprole,andstartsharingyour nail art right away. Enjoy!na1011oym.indd 32 8/24/11 3:36:15 PMSAY HELLOTO CND SHELLAC. Now in 30 gorgeous shades. Layer them to create dozens more!SCAN. WATCH. LEARN. cnd.com2011 Creative Nail Design, Inc. On Like Polish Wears Like GelOff In Minutes (Really!)UV3 Technologypatent pendingna1011oym.indd 33 8/24/11 10:39:36 AM34| NAILS MAGAZINE| OCTOBER 2011When she painted this years winning self-portrait, Tulsa, Okla.-based Jing Wilson was still a student at Jenks Beauty College. Now a new tech at Ihlof Salon and Day Spa, Wilson took three hours to paint her entry to NAILS 2011 Self-Portrait Contest. Although shes new to nails, she boasts a ne arts degree from Chengdu School of Culture and Arts in her native China. This type of miniature work takes a lot of concentration and pushing yourself, she says. My parents always pushed me to rene my art. They always expected the best from me.Congratulations to Wilson and thanks to everyone who entered.Praise for the Self-Portrait Contest Winner} {nails fle1st place2nd place3rd place4th placeIts artwork like this that earned this years Self-Portrait winner, Jing Wilson, a degree in ne arts.Salon Iris Picks a PartnerSalon Iris salon software is partnering directly with Dell to offer customized hardware and computer packages. Salon Iris has worked closely with Dell to test and offer hardware packages that are designed especially for all of the various sizes of salons.We want to make it easy for you to get your salon up and running or to convert to a new automated solution, says Christianna Jackson, vice president of DaySmart Software Inc., makers of Salon Iris software.For more information, visit www.saloniris.com/dell.aspx.DuriCosmeticshasafree nailcolorandtreatment appforAndroidandiPhone mobiledevices.Fanscan convenientlybrowseontheir mobile devices and try on any Duri nail shade virtually.>>> JING WILSONTulsa, Okla.KAMBER GRAHAMCaddo Kiowa Technology Center, Fort Cobb, Okla.JESSICA AUBINInternational Beauty School, Martinsburg, W.Va.TANYA ROSSUC Nails & Tanning, Fayetteville, N.C. na1011genNF.indd 34 8/24/11 10:43:04 AMFind us on:CONTAINS NO DBP, TOLUENE, OR FORMALDEHYDE Call 800.341.9999 2011 OPI Products Inc.LETS SHATTERBREAST CANCER!In support ofBreast Cancer Awareness Month, OPI has made a donation to Susan G. Komen for the Curein the U.S. and to Rethink Breast Cancer in Canada.PINK OF HEARTS2011 EDITION shatterOPIS NEW shatter SHADE FOR BREAST CANCER AWARENESS MONTHA warm shade of pink that creates a bold, inspiring two-texture effect when applied over two coats of completely dry nail lacquer. Finish with Top Coat for high-gloss shine!na1011genNF.indd 35 8/24/11 10:43:11 AM36| NAILS MAGAZINE| OCTOBER 2011Before she was a nail tech, Ena Rodriguez was a tarot-reading gypsy at Universal Studios Orlando. Thats where she rst came across the art of henna tattooing. I was curious so I decided to nd out more about it, says Rodriguez. In the process I absolutely fell in love with henna (or mehndi as its also known), its meaning, beauty, and art. All her work is freehand, which means she doesnt use stencils.Now a new nail tech working at Orlandos Kokopellis Salon and Spa, shes nding out that nails and henna are remarkably complementary services. Henna is used for celebrations and positive things landmarks in peoples lives, like birthdays and weddings, she says. I absolutely love the one-on-one relationship with my customer and the opportunity to create a unique piece of art on someones skin knowing that person is going to wear it. Through henna I have encountered wonderful and amazing people as well as their cultures.Now that Im a nail tech, I am able to ofer a complete package to my brides that includes hand and foot services along with henna. Its also a natural t during the summer when sandals beg to be worn. My goal, as my tag line reads, is Beauty at your hands and feet. Nails and Henna Go Hand in HandBeUnhesamfthe oppor} {nails fle>>> A Postcard from the Smokies Virtuallydoublinginsizefromthepreviousyear,thefourthannual Nail Tech Networking Event of the Smokies, held on June 26-27 at the River Terrace Resort in Gatlinburg, Tenn., saw 150 attendees enjoy the 23 nail boothsand50+educatorswhodemonstratedcuttingedgetechniques,with manydebutingnewnailproducts.Makinganappearanceforthersttime wereLightElegancesJimMcConnell,aswellasHakenProfessionalsScott Haken and Atwood Industries Bruce Atwood. AttendeesalsowelcomedcompetitionjudgeCarlaCollierandcoverartist RachelMouritsenofINM,whileMasterworksAmyBeckerjoinedinforthe fourth time. She amazed the crowd with her elaborate booth set up, complete with chandelier and intricate colored gel designs, while Carla and Rachel did incredible, cover-worthy nails on some lucky people, says event organizer Jill Wright. Nail techs were thrilled by the surprise visit from OPIs John Hauk, who ventured down to the Smoky Mountains to see what the event was all about, plus get a little R&R. GuestspeakerJanetMcCormickgaveatalkaboutmedicalpedicuresandtheir place in the salon and held a class on that subject the following day.Next year, the event will be held in the downtown Gatlinburg Convention Center on June 24-25. Watch for details on Facebook at Nail Tech Networking Event of the Smokies and at www.nailtechevent.com. 13421. Amy Becker (left) and Kira Frazier set up the Masterworks by Amy Becker booth. 2. Smokies event organizer Jill Wright (right) poses with Sangeeta, who came all the way from India to attend. 3. This years turnout led to plans to make the event even bigger nextyear.4.TheYoungNailsboothwasmannedbyAdrienne Schodtler, Regan Brodt-Richardson, and Teresa Carter.na1011genNF.indd 36 8/24/11 10:43:14 AMForalimitedtimeonly,CuccioNaturalsbest-sellingnon-oily8oz. Butter Blends are now available in a try me travel-friendly 1.5 oz. size. If you havent tried it, now is the time to experience what has made Cuccio Natural Butter Blends the beauty professionals top choice for ultimate skin hydration.cuccio.comfacebook.com/cucciospaPomegranate & Fig#719448 Try the 1.5 oz. Butter BabiesLimited Time OnlyOnly each$299Available through BSG sales consultants or CosmoProf stores. Not all products available in all areas. US pricing only. Visit cosmoprofbeauty.com or call 1-800-362-3186 (BSG East) or 1-800-544-9227 (BSG West).1ry t/e t., o:. Batter Baby u/t/ B/g Batter Beneft!,QWHQVH+\GUDWLQJ1RQ2LO\%XWWHU%OHQGV(QULFKHGZLWK9LWDPLQVDQG1XWULHQWVIRU6LON\6PRRWK6NLQIeea 1oarDry S//n!Fits easily into your purse foron-the-go instant hydration!www.nailsmag.com/fifi/21102na1011genNF.indd 37 8/25/11 5:36:59 PM38| NAILS MAGAZINE| OCTOBER 2011No Lift Nails Cuticle Oil brings together three of natures richest ingredients: Avocado,Oil, Almond Oil and Vitamin E. The result is a superb natural oil that conditions nails and softens skin with a single drop.Our unique formula wont promote lifting. After all, its from No Lift Nails, the industry leader for three decades.Available in 1/8 oz, 1 oz and 4 oz size, No Lift is a naturally rich cuticle oil for your customers and a rich source of profits for you.www.nailsmag.com/fifi/21249LefttorightareSarahFlood,VirginClubhouse supervisor (Heathrow); Larry Byrne, Virgin Clubhouse host;KellyClarke,Clubhousesupervisor(Gatwick), and Kay Pennington, Sweet Squared sales emissary.VirginAtlanticnamedCNDsShellacshadeWildretheofcialnail colorforitsightattendants.Siren-redWildreShellaccoordinates perfectly with their uniforms and promises two-week, round-trip wear with no chipping, smudging, or dulling. And Shellac is not just for the ight crew Virgin also now offers free manicures in its Clubhouse loungestorst-andbusiness-classpassengers.Ithasadded Shellac to its service menu as an upgrade option in its Clubhouse at Heathrow and Gatwick. The service includes a take-away pack with Solar Oil, one package of Shellac remover wraps, and a bottle of acetone, along with consumer marketing materials.Shellacwasthenumber-onerequestedpaidserviceinthe LondonVirginAtlanticBusinessloungelessthantwomonths afterbeinglaunchedonMay1.Asabonus,theightattendantsallsaythat they have had amazing compliments on their nails and are all really happy to be wearing Shellac.Shellac Is Flying HighStarry, Starry NightNAILS received several versions of Van Goghs iconic painting when we called for entries to our annual Mini Masterpiece contest. Do you have a favorite?for entries to our annual Mini MYou can see past mini-masterpieces at www.nailsmag.com/minimaster.Samantha HartBarbourville, Ky.Stephanie SchoolcraftMontgomery, W.Va.Angela PirowskiPrattsburgh, N.Y.Jamie Valentine-HessGreencastle, Pa..comna1011genNF.indd 38 8/24/11 10:43:28 AMwww.nailsmag.com/fifi/21285na1011genNF.indd 39 8/24/11 10:43:35 AM40| NAILS MAGAZINE| OCTOBER 2011www.nailsmag.com/fifi/21232InJune,celebritynailstylistZoe VokisMinxedMileyCyrusforthe AustralianlegofherGypsyHeart tour. Miley wanted something really specialanduniqueforherngers andtoesandhadalreadyaskedifI couldprovideMinx,saysSydney-basedVokis.Mileychoseavariety ofpatterns,includingSkulland Crossbones,MinxLusionFishnet, andtheMetallicUnionJack,but Ialsousedalayeringtechnique combining Yellow Chrome with Minx SnakeSkintocreateacompletely unique accent. The end result was a wild and funky look that Miley loved, saying it totally rocked!Life After Hannah Includes MinxNetwork in the Northwest Education in the Northwest can be hard to come by and to solve this problem ve years ago a group of nail techs got together to sponsor an educational networking event. Since then the event has grown into the four-day, one-of-a-kind Northwest Nailtechs Networking Retreat. Set for October 14-17, this years event is jam-packed with education, seminars, and lots of fun at a beautiful waterfront retreat center outside Seattle.The fee of $439 includes:> Lodging and all meals >Transportation from the airport to the retreat center> Tradeshow >Demo classes and four- to six-hour hands-on workshops >Seminars including marketing and busi-ness improvement>Entry to all competitions, which result in cash prizes> Raf e tickets for prizes valued up to $350> Goodie bag of free products and information For more information, go to www.nwnailtechs.com or e-mail info@nwnailtechs.com. ent-a-kindna1011genNF.indd 40 8/24/11 10:46:06 AMVS_sept_octinsert.indd 1 8/26/11 2:34:37 PMwww.chinaglaze.comwww.chinaglaze.comChina Glaze wishes you a holiday season lled with glittering, shimmering,ravishing colour.VS_sept_octinsert.indd 2 8/25/11 3:59:33 PM1c - crmeg - glitters - shimmerRing inthe Red (g)80519Winter Berry (c)80518Velvet Bow (c)80517GlitteringGarland (g)80516Holly-Day (c)80515ChampagneBubbles (g)80514TwinkleLights (g)80513Snow Globe (g)80435Icicle (s)80523Tinsel Town (g)80522BlueYears Eve (s)80521Poinsettia (c)80520VS_sept_octinsert.indd 3 8/25/11 3:59:34 PMwww.chinaglaze.com 2Includes:Twinkle Lights, Champagne Bubbles, Holly-Day, Glittering Garland, Velvet Bow, Winter Berry,Ring in the Red, Poinsettia, Blue Years Eve, Tinsel Town, Icicle and Snow Globe Item# 81047Let it Snow12 Piece Counter DisplayVS_sept_octinsert.indd 4 8/25/11 3:59:36 PMwww.chinaglaze.com ww www.chin 3Includes 3 of each: Row 1 (left to right) Twinkle Lights, Champagne Bubbles, Holly-Day, Glittering GarlandRow 2 (left to right) Velvet Bow, Winter Berry, Ring in the Red, PoinsettiaRow 3 (left to right) Blue Years Eve, Tinsel Town, Icicle, Snow Globe Item# 81048Let it Snow36 Piece RackVS_sept_octinsert.indd 5 8/25/11 3:59:36 PMwww.chinaglaze.com 4BELLE OF THE BALLGift set includes:Champagne Bubbles, Tinsel Town and a Festive OrnamentItem# 81035Dazzle with a decorative touchFestive OrnamentVS_sept_octinsert.indd 6 8/25/11 3:59:37 PMwww.chinaglaze.com 5SEASONAL SPARKLESGift set includes:Poinsettia, Holly-Day and a NEW Limited Edition Holiday Glitter PolishItem# 81038Holiday shine!Limited Edition:Twinkle LightsVS_sept_octinsert.indd 7 8/25/11 3:59:37 PMwww.chinaglaze.com 6MEET ME UNDER THE MISTLETOEGift set includes:Ring in the Red, Velvet Bow,Glittering Garland and Lip LacquerItem# 81042Kiss of colour!Lip Lacquer10 mL .34 ozVS_sept_octinsert.indd 8 8/25/11 3:59:38 PMwww.chinaglaze.com 7Everyone loves adorable minisSANTAS LITTLE HELPERSGift set includes:9.6 mL .325 oz minisRing in the Red, Holly-Day, Twinkle Lights, Velvet BowItem# 81045VS_sept_octinsert.indd 9 8/25/11 3:59:38 PMwww.chinaglaze.com 8LET IT SNOWGift set includes:Blue Years Eve, Snow Globe and a Mini Snow GlobeItem# 81039All a urry!Mini Snow GlobeVS_sept_octinsert.indd 10 8/25/11 3:59:39 PMwww.chinaglaze.com 9HOLIDAY SPIRITSGift set includes:Icicle, Champagne Bubbles, Glittering Garland and a Pewter Bottle StopperItem# 81040Dont stop the funPewter Bottle StopperVS_sept_octinsert.indd 11 8/25/11 3:59:39 PMwww.chinaglaze.com 10BERRY SWEETGift set includes:Velvet Bow, Ring in the Red and a Holiday Berry Moisturizing LotionItem# 81037Delightfully festive!Limited Edition:Holiday Berry Moisturizing LotionVS_sept_octinsert.indd 12 8/25/11 3:59:40 PMwww.chinaglaze.com 11BABY ITS COLD OUTSIDEGift set includes:Icicle, Blue Years Eve, Poinsettia and Fingerless GlovesItem# 81041Keep cozy...while aunting a fabulous maniFingerless GlovesVS_sept_octinsert.indd 13 8/25/11 3:59:40 PMwww.chinaglaze.com 12DECK THE HALLSGift set includes:Glittering Garland, Champagne Bubbles and a Limited Edition Cuticle OilItem# 28931Fa la la la la....La la la la!Limited Edition:Holiday Berry Cuticle OilVS_sept_octinsert.indd 14 8/25/11 3:59:41 PMwww.chinaglaze.com 13WINTER ICEGift set includes:Blue Years Eve, Tinsel Town, Icicle, Snow Globe and a Snowake Charm NecklaceItem# 81043Winter Ice and everything nice!SnowakeCharm NecklaceVS_sept_octinsert.indd 15 8/25/11 3:59:42 PMwww.chinaglaze.com 14HOLLY BEAR-YGift set includes:Holly-Day, Winter Berry and your very own Holly BearItem# 81036Your new B.F.F.(Bear Friend Forever)!Holly BearVS_sept_octinsert.indd 16 8/25/11 3:59:42 PMwww.chinaglaze.com 15CARRY ME AWAY FOR THE HOLIDAYSGift set includes:Tinsel Town, Poinsettia, Velvet Bow, Icicle and a Manicure Carrying Case with Nail FileItem# 28930Arrive in styleManicure Carrying Caseand Nail FileVS_sept_octinsert.indd 17 8/25/11 3:59:43 PMwww.chinaglaze.comSalon Gift Giving Complimentary gift bags make it the perfect client holiday favor.24 gift bags included with each displaywww.chinaglaze.com 16LIL STUFFERSMini Holiday Berry Cuticle OilItem# 81046Perfect for everyone on your list!24 Piece DisplayVS_sept_octinsert.indd 18 8/25/11 3:59:44 PMwww.chinaglaze.comVS_sept_octinsert.indd 19 8/25/11 3:59:44 PMwww.chinaglaze.comAmerican International Industries, Los Angeles, CA 90040.China Glaze Nail Care Cosmetics and the CG logo are RegisteredTrademarks of AII Printed in USA 14-7137 2011International$2.00VS_sept_octinsert.indd 20 8/25/11 3:59:45 PMwww.nailsmag.com/fifi/21119na1011genNF.indd 61 8/25/11 5:05:09 PM62| NAILS MAGAZINE| OCTOBER 2011SHOWcoverageFor the second year in a row brush-on gel polish lines were the talk of the nail world at Cosmoprof North America. The game-changing nail category has steadily helped to reinvigorate the nail industry over the last year since its initial introduction. In addition, we saw some cool new nail art applications and advances in the pedicure chair world. Cosmoprof North America, held July 31-August 2 at the Mandalay Bay in Las Vegas, brought more than 760 exhibitors to almost 25,000 attendees that included importers, distributors, manufacturers, and global beauty leaders. The show, which is a diferent format than your usual cash-and-carry beauty show, ofers a unique opportunity for distributors and manufacturers to connect, see new product lines, and conduct meaningful business meetings. This year, a new aspect to help everyone stay connected during the show was added by using Foursquare. Prior to and during the event, attendees and exhibitors shared where they were on the show oor and took advantage of show specials that were only available to users by checking in on their phones or hand-held devices. Next years show will be held July 22-24 at Mandalay Bay Convention Center in Las Vegas. NAILS associate publisher Michelle Mullen got a chance to try out Orlys new GelFX gel polish from Sarah Andersen.New and Old Friends Come Together at Cosmoprof in Las Vegasors shared where they wereStar Nail received a Partners in Progress award from Sally Beauty at the distributors annual breakfast. From left to right are Sue Davidson, Sally Beauty group vice president of merchandising; Tony Cuccio, CEO of Star Nail; Elaine Watson, Star Nail vice president of marketing and sales and director of education; Christina Jahn, Star Nail director of marketing; and Linda Voracek, Sally Beauty senior director of nail products.In addition to all of his regular products, Noubar Abrahamian showcasedKatie Cazorlas The Painted Nail line of polish and hand treatments.>>>COSMOPROF LAS VEGAS} {nails fleRocio Jimenez at Republic Nail showed NAILS sales manager Mary Baughman the companys line of glow-in-the-dark polish and acrylic, which were a big hit at the show. NAILS senior editor Tim Crowley got a chance to discuss polish trends and music with Zoyas own Zoya Reyzis.In a special partnership, Super Relax Zero-Gravity chairs are now available with Gulfstreams pedicure spas. Gulfstream is also ofering these unique room dividers and backdrops for salon purchase.NSIs Staci Noble and Rick Slack have a few new products up their sleeves. Keep your eyes open for new things from the enhancement company.Dashing Divas Nancy Waspi, Pattie Yankee, and Anna Lee showed us the companys new DesignFX nail application.Yvette Holt (right) demonstrates LeChats Perfect Match gel polish. na1011show.indd 62 8/24/11 10:25:30 AMNEW NEWDS TEMPTATION & DS BOLDNEWCONTAINS NO DBP, TOLUENE, OR FORMALDEHYDE Nail Lacquers feature OPIs exclusive ProWide Brush (Patent pending). Call 800.341.9999 2011 OPI Products Inc.CONFIDENT ELEGANCE. SEDUCTIVE GLAMOUR.Style for Fall 2011 is all about dazzling color.New DS temptation and DS bold from Designer Series by OPI complement this falls fashion season brilliantly with the seductive glamour of the Designer Series diamond-dust formulation.DS extravagance DS glow DS reserve DS opulence DS reection DS classic DS mystery top coat DS temptationSHOWNDS magic DS radiance DS boldSHOWNna1011show.indd 63 8/24/11 10:25:50 AM64| NAILS MAGAZINE| OCTOBER 2011SHOWcoverageCOSMOPROF LAS VEGAS} {nails fleContinuums Joe Galati holds a slab of high-grade terreon, an extra strong material that the basins of the Maestro spa are made of. Grahams Dan Hnilicka shows us the companys new HandsDown Nail Wraps that can be used to efortlessly remove gel polish.Vicki Heller, Ellen Ambrecht, and Dee Nguyen are excited about Entity One Color Couture.Kupas uPower has new plastic slipcovers available to help keep dust from getting into the machine.Barbicides Alan Murphy, Leslie Roste, and Kevin Schuele are dedicated to salon sanitation and cleanliness.Emmett and Beth Hickey look on as a Marilyn Monroe lookalike sings Happy Birthday to Hand & Nail Harmonys Danny Haile.Jessicas own Jessica Vartoughian is happy to showcase her gel polish line, Geleration.Orly founder Jef Pink was on hand to meet with distributors about Orly and SpaRituals ever-expanding lines of natural nail care.Lisa and Greg Minuto discussed the benets of using Prolanas natural nail treatments and nail color.Luan Nguyen, Andy Nguyen, Kathy Phan, Dat Ton, and Hien Ton were busy at the Alfalfa booth showcasing the companys GelArt line.EOH Industries Emmett and Beth Hickey host the annual Hickey Poker Showdown, a charity poker tournament.caThiswastherstyearYoungNails hadaboothatCosmoprof.Ramon Hernandez,TomHuynh,GregSalo, and Tracey Reierson were quite happy with the outcome of their meetings.>>>na1011show.indd 64 8/24/11 10:27:06 AMBrush.Wear.Soak.Repeat.2011 Entity Beauty Inc. entitybeauty.comModel is wearingWalk The Runway.
Entity OneColor Couture. Forget everything you know aboutmanicures andtake your artto the next level.Weve combined the long-lasting, high-gloss durability of gel with the ease and versatility of enamel.No smudging,no chipping,and no dry time.Its everything you love about color. Only better.www.nailsmag.com/fifi/21131na1011show.indd 65 8/24/11 10:27:22 AM66| NAILS MAGAZINE| OCTOBER 2011NAILS Hannah Lee, Dashing Divas Pattie Yankee, salon owners Maisie Dunbar and Katie CazorlaNAILS Hannah Lee mans the bar.NAILS Mary Baughman with Nubars Noubar Abrahamian, and Khatchig ArakelyanStar Nails Arica Carpenter and NAILS Tim CrowleyVicki Peters and Medicools Steve WallaceSHOWcoverageCOSMOPROF LAS VEGAS} {nails fleNAILS hosted a happy hour during Cosmoprof on Monday, August 1, attended by a number of professional nail care manufacturers, educators, and other noted guests in the industry. It was a great time to relax after the show, enjoy some cocktails and snacks, and mingle with others who normally dont have a chance to get together. Happy Hour, Happy Manufacturers, Happy NAILSStar Na r Naand NA nd NAWallaceEuropean Touchs Sheila Newkirk and Dawn Holz with NAILS Mary Baughman (center)Prolanas Lisa Minuto and Donna Louis with LeChats Patti DiMarbieuxStar Nails Tony Cuccio, NAILS Cyndy Drummey, Sweet Squareds Samantha Sweet, and Backscratchers Michael Megnana1011show.indd 66 8/24/11 10:30:51 AMOCTOBER 2011 | NAILS MAGAZINE | 67 Kupas Sarah Smith and Robert Authur Spilos Sally Ferguson and Susan LewisBelavas Vladimir and Natalie Zolotnik with Famous Names Linda NordstromThe Painted Nails Katie Cazorla, Young Nails Greg Salo, and Dashing Divas Pattie YankeeNSIs Rick Slack and NAILS Cyndy DrummeyKupas Richard HurterNSIs Christel De Cock, Staci Noble, and Isabel FisheriNails Robert Powell and guest with NAILS Michelle Mullen SNCRED PRs Julia Labaton, NAILS Cyndy Drummey, and CNDs Herman PaezSweet Squareds Samantha Sweet and Sam Sweet with salon owner Masie Dunbar (center)na1011show.indd 67 8/24/11 10:31:21 AM68| NAILS MAGAZINE| OCTOBER 2011Get the Top Deals of the WeekNAILS Top Deals e-newsletter arrives in your inbox every Friday with terric ofers on a whole variety of products. Be on the alert for special pricing, exclusive discounts, and free bonuses. If youre not already receiving Top Deals, go to www.nailsmag.com/enews/signup.Go to www.nailsmag.com/freebies to nd web-exclusive giveaways.freebiesgiveaways!{and}.comReceive a Free DVD from Cuccio NaturalDouble your spa service business with an informative, educational DVD from Cuccio Natural. The Spa Techniques & Treatments DVD helps nail techs keep up with the latest techniques and services, introduces the three levels of services of manicures and pedicures, and includes business-building tips from Tony Cuccio. To receive your DVD, e-mail info@cuccio.com with free DVD in the subject line.Dashing Diva Introduces Metallic Crackle NailsCrackle nails are the latest addition to the Dashing Diva Metallic Nails collection. Four readers can win a pack of Metallic Crackle Nails (in Purrrfectly Pink, Call of the Wild, Heavy Metal, or Animal Instincts) and a bottle of Tailor Bond, a thick, exible adhesive used for application. The four bold designs allow nail technicians to provide clients with an edgy alternative look and new fashion-forward manicure service option. Technicians will enjoy the fast application and simple soak-of removal, while clients will experience a light, comfortable wear with some ash that lasts for up to one week. Congratulations to Augusts WinnersSix readers received a Footlogix Pediceuticals Salon Starter Kit and 25 readers received a bottle of Crazed Expression Crackle Nail Polish.To enter to win, go to www.nailsmag.com/freebies by October 31.The Nail Superstores SuperSonic3 Professional Is Powerful, QuietBe the lucky recipient of a SuperSonic3 Electric Nail File Machine from The Nail Superstore. Designed for professional nail technicians, this high-speed electric nail le makes easy work of ling, shaping, and shortening nails. Features include a forward/reverse switch, a lightweight, vibration-free hand piece with an easy-to-use twist/lock chuck that allows nail technicians to change bit heads quickly, and variable speed control up to 25,000 RPMs. Speed can be controlled manually or with the included foot pedal.GDWeiFriday with terric oferna1011freebies.indd 68 8/24/11 10:48:19 AMExtraordinary style deserves extraordinary protection. CNDs award-winning Base Coats and Top Coats extend the life of Nail Colour so your clients get more mileage from their manis! SEALYOUR STYLE.cnd.com2011 Creative Nail Design, Inc.na1011freebies.indd 69 8/24/11 10:48:23 AM70| NAILS MAGAZINE| OCTOBER 2011} {Posh Nails BKon the roadFROMNUMBERSTONAILSDuringher10 yearsbuildingacareerinnance,TerriStreat had a passion for the beauty industry. In 2010, sheredirectedherpathtoopenasalonin Brooklyn.Armedwithherbusinessmanage-ment skills and a newly acquired license in nail technology, Posh BK opened its doors in March 2011.StreatrecruitedDebraPakeman,along-time friend and nail tech, who moved across the country to help manage the salon. Pakeman is apivotalpartofthebusiness,providingover 15yearsofindustryexperience.Pakeman performedmyultra-relaxingCNDTantalizing Citrus Spa Manicure, topped with OPI Shatter.ASALONGROWSINBROOKLYNWhen lookingforalocation,StreatfoundCrown Heights to have many signs of revitalization: a gentrifyingareawithamixofyoung,old,and new families; recent growth in small businesses; and residents with a desire to patronize locally. Streat answered that need with Poshs menu of naturalnailcareandwaxingservices.Clients are greeted by Poshs brick interior, which was preserved from the buildings original architec-ture.Thespacewasdesignedtobefamiliarto clients who live in the brownstones Brooklyn is known for.SANITATIONANDSWEETSInherresearch, Streatfoundthatforotherlocalnailsalons, sanitationseemedlowonthelistofpriorities. AtPosh,everyimplementisdoublesanitized, ordisposedof,andeachclientleaveswitha charminglywrappedcarepackageincluding le,pusher,andbuffer.Streatoptedforpipe-lesspedicurespasandthestaffexplainsthe benetstonewclients.Still,asimportantas sanitation is at Posh, there is no lack of fun: the dryingcounterhascandybowls,encouraging clients to leave with a little something sweet.> On the day I visited, Posh was the venue of a Pretty Little Princess Spa Day. Little ladies brought in by moms and family members weregivenacomplimentarymanicure orpedicureandtreatedtocupcakesand refreshments.TheprincessesofCrown Heightsleftwithsparklingtiarasand brightly colored ngers and toes.> Streat and Pakeman are keenly aware of the tandemrelationshipbetweenmarketing and networking. Streat believes in a grass-rootsapproachtoreachingclientswith community events and co-op promotions. Yettheyarealsoawareofthepartsocial networkingplaysinthesuccessofanew business.Clientscanfollowthesalonon TwitterandlikeitsFacebookpagefor informationonupcomingevents,new products, and service specials.>TheCrowHillCommunityAssocia-tionprovidedtheplanterthataccents thesalonsstorefront,oneofthemany waysthe25-year-oldorganizationshows support for up-and-coming businesses.MENU HIGHLIGHTS CND Tantalizing Citrus Spa Manicure: $25; CND Shellac or Hand & Nail Harmonys Gelish Gel Color Manicure: $35; Cool Mint Spa Pedicure: $40; Little Miss Manicure: $10; Little Miss Pedicure: $15 PRODUCT HIGHLIGHTSPolish: OPI, Essie, China Glaze, Zoya Gel Polish: CND Shellac, Hand & Nail Harmonys GelishMani/Pedi Products: CND, OPI www.poshnailsbk.comPosh staf members from left to right are Jacyna Murray, NikkeyaSpence,TifanyGeorge,KenyattaJoiOfutt, Debra Pakeman (manager), and Terri Streat (owner)..comFUN FACTS Open for less than a year, this urban chic salon has a cool vibe that meshes well in its up-and-coming Brooklyn neighborhood.BY CARLA BENAVIDEZna1011otr.indd 70 8/24/11 3:36:57 PMwww.nailsmag.com/fifi/21104na1011otr.indd 71 8/25/11 2:18:38 PMSOAK-OFF GEL LACQUER SYSTEMPolish on and UV cure for results that are nothing short of brilliant!Color lasts up to two weeks or more in a service that will keepclients coming back for more of the affordable luxury of OPI!Call 800.341.9999 or visit www.opi.com 2011 OPI Products Inc.Axxium Soak-Off Gel System is for professional use only.Average cost per set is $1.33AVAILABLEIN 50 FAVORITE OPI SHADESna1011techNF.indd 72 8/24/11 3:12:45 PMOCTOBER 2011 | NAILS MAGAZINE | 73 TECHNIQUE }These Zebras Are Wild Ifyourelookingtoletloosewithyour nailartskills,thinkabouttryingtotame DanalynnStockwoodsfunzebranail designs.TheFitchburg,Mass.-based nailtechusesaninnovativewidebrush methodformakingthebackgroundand then a striper brush to paint the stripes. 1. Choosethreeacrylicpaints,ranging from light to dark, and place them on a paper plate.2.Blendthecolorsontoafanbrushand apply to the nail.3.Use a striping brush to apply the zebra lines.4.Addglitterbetweenthestripesfora sparklyefect.Finishwithtwocoatsof top coat.>>>1324na1011techNF.indd 73 8/24/11 3:12:51 PM74| NAILS MAGAZINE| OCTOBER 2011If youre bored with just applying one coat of color gel and curing, try Entitys One Color Couture Gels and its custom-mix combinations. Educator Lorena Marquez shows how many diferent shades can be achieved by starting with one dark color base, and then applying other Entity color gels on top of it. The farthest right photo shows three coats of Little Black Bottle with no layering, then the other tips use that as a base while layering on one coat of the specied color.1. Three coats of Little Black Bottle with no color layering.2. Fashion French Pink.3. Posh n Pink.4. Ms. Fancy Pants.5. Holo-glam It Up.6. Under The Lights.7. Denim Diva.8. Posh Pixie.9. All Made Up.To properly layer the gels:Cure each layer of the darker colors for three minutes in a UV Lamp or 30 seconds in an LED Light. For light to medium colors, cure each layer for two minutes in a UV Lamp or 20 seconds in an LED Light. For more information, go to www.nailsmag.com//21412.Luxury Class Air FiltrationTheValentinoBeautyPureAir FiltrationunitistheLincolnTown Carofdustvacuums.Theunitis specically designed to remove nail dust, acrylicodors,andharmfulchemicalsand wasdesignedbyveteransalonownerand founderofValentinoBeautyPure,DavidDi Lorenzo, who came up with the design after he was bothered by the air quality in his salons. The Valentino Pure Air Filtration unit has a sleek design with built-in dappen dish holders and a brush to dust off the unit. It features an eco-friendly charcoal lter to capture odors and a powerful yet quite vacuum system to ensure that dust particles are swept quickly into the unit. For more information, go to www.nailsmag.com//21411.Layering Soak-Off Color Gelsin a UV Lamp or 20 seconds iore information, go to www.nailsmag.com//21412.123456789www.nailsmag.com/fifi/21198na1011techNF.indd 74 8/25/11 4:32:24 PMOCTOBER 2011 | NAILS MAGAZINE | 75 www.nailsmag.com/fifi/21289QQHave a technique question? (about product application, troubleshooting, etc.) E-mail it to Tim.Crowley@bobit.com and check back here for an expert answer.AQAND} {I need advice on how to get dried acrylic off my nail brush. I did my frst set of flls today but now I am wondering how to clean my brush. My friend saidsoakitinacetoneandthenwashitreallywell.Couldthisaffectmy brush or is it OK to clean it? The best way to clean an acrylic brush is using a brush cleaner speci-callymadeforit.Therearesomemanufacturerswhomakereallygood ones, and that is what I use. Acrylic brushes are made of sable so you need tomakesureyoudontcontaminatethebrush.Monomercanworkwell between services, but brush cleaner does the best job. Someacetonehassmalltracesofoilthatcancontaminatethebrush. Also make sure to use only one brush for a product line; dont use it for two differentacrylicproducts.Thisgoesforodorlessaswell.Pullingonthe bristles will also damage the brush and the shape, so make sure you dont pull them when cleaning. If there is already dried acrylic in the brush, it is best to purchase a new one. Norma Sproles is an educator and guest artist for OPI.TherearemanygelnailsalonsaroundwhereIlive,meaningthereare many people with gel nails. I do acrylic nails and Im wondering if there is a special removal method to follow for gels because I know they dont soakofflikeacrylic.Ihavealotofpeoplecomingtomewiththeirgel nailsstillon.DoIjustthinthemdownasgoodasIcanandapplythe acrylic as usual? Will the acrylic still adhere with that thin layer of gel on? Or do I need to completely get rid of the gel and get to the natural nail to be able to apply the acrylic?The only removal method for a non-soak-off gel is to le it off. Toansweryournextquestion,weknowthatmostgelswilladhereto acrylicwiththerightsurfacetexture.Ipersonallyhavedonethismany times. You le the gel as thinly as you can using a 150-grit le, being very careful not to break through to the nail beneath. The existing gel surface must be rough for the acrylic to adhere properly, if it is too smooth you take the chance of the acrylic popping or separating from the gel that is left. If you have broken through to the natural nail while ling and thinning down the existing gel, stop immediately. The 150-grit is way too harsh for the natural nail and will damage your clients nails. Make sure you do good prep work too. Improper prep is the biggest reason for lifting. Renee Doran is an educator for OPI.na1011techNF.indd 75 8/25/11 4:32:45 PM76| NAILS MAGAZINE| OCTOBER 2011BarefootbyLCNisalight-curingpedicure resindesignedtorestorethetoenailpartiallyor completely while providing an attractive result. The resin has high exibility to adjust to the movements of feet and toenails and is anti-mycotic to prevent fungal infections. Barefoot by LCN can be used to match any nail type and provide coverage on even the most unsightly nails. The resins are available in clear, pink, opaque, cool pink, natural beige, and pastel.1.Buff and prepare the nail and wipe with cleaner. Be sure you have removed the shine.2.Apply the bonding agent Connex Plus and let air dry for two minutes.3. Apply a thin layer of Barefoot Resin and cure in the light for two minutes. Apply the French smile line with FM Pearl White or any white (or color) you desire. Cure for two minutes.4.Apply a thin layer of Barefoot Clear and cure for two minutes.5.Remove the dispersion layer with a swab and cleaner. Shape thenailwithahandleoranelectricleifneeded.Brush away any dust from ling with a dry swab or dust brush before applying Pedi Seal.6. Apply a layer of Wilde-Pedi Seal (or any other LCN sealant) for a perfect shine. Cure for two minutes.7.Remove the dispersion layer with a swab and cleaner.Barefoot by LCN Pedicure 1 23 4567demosTECHNIQUE}For more information, go to www.nailsmag.com/ff/21311na1011demos.indd 76 8/24/11 10:58:43 AMOPI TITANIUM TOOLING Combining beauty, precision, and performance, high-quality OPI Titanium Tooling implements are engineered with superior 420 stainless steel and coated with ultra-hard, corrosion-resistant Titanium for sharper, longer-lasting tools.CUTICLES NEVER HAD IT SO GOOD!CHECK OUT OPIS ENTIRE COLLECTION OF NINE COOL TOOLS AND THE GO-ANYWHERE TITANIUM TOOLING WALLET AT www.opi.comFor more information, contact your local OPI distributor. Call 800.341.99992011 OPI Products Inc.na1011demos.indd 77 8/24/11 10:58:55 AM78| NAILS MAGAZINE| OCTOBER 2011AngelLoveNailsisanorganic,protein-basedgelformulathatcreateslovelylooking enhancements that are healthy for the natural nail. The Angel Love gel line has a primer that is 80% organic, a base gel that is 95% organic, and the gels are odorless and actuallypromotehealthynailgrowth,saysthecompany. Thelineusesaclearbuilder,whichcanhavepigmented powder added to it and mixed to create any type of custom color shade.1. Exfoliateandshapetheentirenail,thenuseacotton-tipped applicator to cleanse and prime the entire nail.2.Brush an even amount of Base Gel on the entire nail.3.Using a 6-watt UV lamp, ash cure the nail, putting it in thelampforonesecond,andthenremovingitforfour seconds, and then back in. Repeat this two to three times thenleavethengerinthelampforapproximately30 seconds.4. BrushanevenamountofBaseGelovertheentirenail. With the bottle of Clear Builder Finish, apply a thin line down the center of the nail, then apply a small amount on either side of the center line.5.Turn the nger upside down and use the brush to guide the gel into a nice and even almond shape. Then turn the ngernail right side up again and allow the product to self level.6.Repeat step three, remembering to ash the nail in the UV lamp. After ashing, leave the nail in the light for 45 to 60 seconds, then put the lamp in the down position and cure for four minutes.Clear Overlay Using Angel Love Organic Nail System1 23 45 6demosTECHNIQUE}For more information, go to www.nailsmag.com/ff/21312na1011demos.indd 78 8/24/11 10:59:11 AMAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES, SALONS AND SALLY BEAUTY.www.nailsmag.com//21168ORLY Nail Lacquers are Freeof DBP, Formaldehyde & Toluenerococo a-go-gorock the worldrock itemberstonerock solidstone cold800.275.1111 orlybeauty.comFX MINERALna1011demos.indd 79 8/24/11 10:59:16 AM80| NAILS MAGAZINE| OCTOBER 2011signature servicesKeldara Salon & Spa uses:KeyanoAromaticsPumpkinSpiceMineralBath,Pumpkin Spice Scrub, and Pumpkin Spice Butter Cream; Footlogix #13 FootSoakandCallusOf;PerfectSenseParaf nhandtreat-ment;GigiSpicedPumpkinParaf n;CNDStickeybasecoat, OPI Nail Lacquer, and Seche Vite top coat. 1. Soaktheclientsfeetforveminutesinwarmwaterwith Footlogix#13FootSoakandatablespoonofKeyano Aromatics Pumpkin Spice Mineral Bath. 2.Ofer the client the signature beverage of cold apple cider or hot chai tea.3. Spray Footlogix Callus Of on cuticles and calluses and prep the clients toenails.4. Useanickelfootletoreducecallusesandroughspots from the bottom and sides of the clients feet.5.ExfoliatetheclientsfeetandlowerlegswithKeyano Aromatics Pumpkin Spice Scrub.6. Apply PerfectSense Paraf n to the clients hands, then cover them in warm mitts.7.MassagetheclientsfeetandlowerlegswithKeyano Pumpkin Spice Butter Cream.8.Apply Gigi Spiced Pumpkin Paraf n to the clients feet, then cover with warm booties.9.After ve to seven minutes, remove paraf n from the hands and feet. 10. ApplyCNDStickeybasecoat,twocoatsofOPINail Lacquer, then Seche Vite fast-drying top coat. Pumpkin PedicureKeldara Salon & Spa, Dedham, Mass.7810TECHNIQUE}Alternate Names: Spiced Pumpkin Feet TreatFestive Fall PedicurePump Me Up Pediprice: $80na1011sigserv.indd 80 8/24/11 11:01:02 AMCall 800.341.9999 or visit www.opi.com 2011 OPI Products Inc.Traditional polish removers falling short?New OPI Expert Touch Lacquer Remover provides superior performance without the drying effects of harsh removers. It sweeps away even the darkest shades of nail lacquer, while leaving cuticles soft and smooth, instead of parched and dry looking!More effective than traditional polish removerRemovesdarknaillacquer shades fast!Non-drying;leavesskin& cuticles soft and supplePleasant, gentle aroma Formulated to meet even the strictest state regulationsUsewithOPIExpertTouchNail WipesandExpertTouchTable Towels for lint-free results.Nail WipesTableTowelsRecommendedProduct forAxxium Soak-OffGel LacquerRemovalna1011sigserv.indd 81 8/25/11 12:33:10 PMna1011sigserv.indd 82 8/24/11 11:01:17 AMwww.nailsmag.com/fifi/21285na1011sigserv.indd 83 8/24/11 11:01:22 AM84| NAILS MAGAZINE| OCTOBER 2011PHOTOGRAPHY BY VU ONG/KIMBERLY PHAMLiving the DreamShelenaRobinsonhasspent13of her14yearsasanailtechworking withCND.Ilovebeinganail professional, she says. Ive had opportunities thatmanycanonlydreamofandIfeelvery blessedtobeinthisindustry.Itsexciting, creative,artistic,anditsbeenawonderful career path. Asaneducator,Shelenahashadthe opportunitytotraveltheworld.Shesalso workedNewYorkFashionWeekforthelast seven years as part of the team responsible for creating nail styles for the designers. We make surethemodelswalkdowntherunwaywith the10mostbeautifulaccessoriesagirlcan have! And shes been able to provide celebrity services at both the Oscars and the Grammys. Inadditiontohermanyresponsibilitiesas an education ambassador for CND, the Crooked River,Ore.-basedtechalsostillworkswith clients in the salon when shes home. My core objectiveistohelpelevateourindustryon every level we have available to us from salon services, to education, to nail fashion and to helpmakethisasuccessfulcareerpathfor others, inspiring them to reach for the stars!For this months cover, we asked Shelena to create a fun variation of the rain drop technique shownatCNDsFashionFusioneventatthe PremiereShowinOrlando.Sheshowedusa bunch of cool designs, but we especially loved the contrast of this matte black nail with CNDs new Shellac Zillionaire.behind the scenesWatch our Behind the Scenes video on this technique at www.nailsmag.com/Oct2011CoverVideo.TECHNIQUE}CNDeducationambassadorShelenaRobinson(left)ewdown from Oregon to do these cool nails for our cover. Shes no stranger toworkingunderpressure.Youcanusuallyndherbackstageat Fashion Week in New York or at awards shows in Los Angeles. .comna1011bts.indd 84 8/26/11 9:46:30 AMOCTOBER 2011 | NAILS MAGAZINE | 85 15372648Heres how you can do these nails: 1. Preparethenailsforproduct applicationusingtheCNDP.R.E.P. procedure.(Youcanwatchthe P.R.E.P.videospotlightatwww.cnd.com. Just login as a pro to watch.) 2.ApplyathincoatofShellacUVBase Coat to ve nails at a time and cure for 10 seconds using the CND UV Lamp. Repeat on other hand.3. Apply a thin layer of Shellac UV Color CoatinBlackPooltovenailsand curefortwominutesintheCNDUV Lamp. Repeat on other hand.4.ApplyasecondlayerofShellacUV Color Coat in Black Pool to ve ngers and cure for 2 minutes in the CND UV Lamp, repeat on other hand.5. ApplyathinlayerofShellacUVTop Coattovengersandcurefortwo minutes in the CND UV Lamp. Repeat on other hand.6. Removethetackylayerwith99% isopropylalcoholandremovethe shinefromthetopcoatusinga180-grit Boomerang Padded File to create a matte nish.7.Applythecenterhourglassdesignin Shellac UV Color Coat in Zillionaire to ve ngers. Use a #6 gel oval brush and isopropylalcoholtoperfectthelines. CurefortwominutesintheCNDUV Lamp. Repeat on other hand.8.Sealthedesignportionofthenail withathincoatofShellacUVTop Coat and cure for two minutes. (Dont applytopcoatoverthematte,or youll lose the nish.) Repeat on other hand.Removethetackylayerusing 99% isopropyl alcohol.na1011bts.indd 85 8/24/11 12:09:21 PM86| NAILS MAGAZINE| OCTOBER 20111.Stick decals onto the nail and apply a thin strip of adhesivetabnearthecuticleextendingtoabout halfway up the nail toward the free edge.2.Positionthevibratingmotoratthefrontofthe nail,offoftheadhesivetabsoitisfreetomove, and press the wires into the adhesive tab.3. Gluethelargerbluebutterytothetopofthe vibrating motor, and glue the small pink buttery to the red wire.4. Fastenthesmallbatteryontothecuticleareaof the nail, into the adhesive tab to secure it.5. Thepinkbutteryislightenoughthatthered wire supports it just above the battery. When it is pressed down from above, bringing the red wire in contact with the battery, the vibrating motor acti-vates and the blue buttery shakes.Cy Tymony has been creating homemade inven-tionssincechildhood,andwrotehisrstbook, SneakyUsesforEverydayThings,in2003.The bookwasasuccess,andledtoTymonybeing featuredonCNNHeadlineNews,ABCsChicago MorningShow,NPRsScienceFridaywithIra Flatow, and The Chicago Tribune. Hehaspublishedeightbooksin the Sneaky Uses series. The latest, whichincludesthisnaildemo,is SuperSneakyUsesforEveryday Things. For more information, go to www.sneakyuses.com.TECHNIQUE}You can see a video of Cy Tymony making this vibrating nail at www.nailsmag.com/video/vibratingnail. .comTymony12354Yep, you heard right. Though not a licensed nail tech, Cy Tymony, author of the new book Super Sneaky Uses for EverydayThings,hascreatedaninnovativewaytouse simple, small, and inexpensive electronics to make a fun and interactive nail art design that really shakes things up.Here is what youll need:Full-wellnailtip,1.5-Vwatchbattery,1.5-Vvibratingmotor,exible butterygure,adhesivetabs,butteryornament,butterydecals, and nail glue. (The watch battery and vibrating motor can be found at local electronic parts stores, and the buttery and adhesive tabs can be found at craft stores.)The Vibrating MotorThe vibrating motor has two wires, a blue and red. The red is applied to the battery with an adhesive tab, and the blue is glued to the small pink buttery. When the blue wire is pressed down on top of the battery, the vibrating motor will shake.A Vibrating Nail?na1011vibrating.indd 86 8/25/11 8:11:45 AMwww.nailsmag.com/fifi/21260na1011vibrating.indd 87 8/24/11 11:05:44 AMBecauseyouwantnothingtogetbetween youandyourwork,OPIArtistSeriesBrushes aredesignedwithsleek,shorthandlesand handcrafted using the nest materials to deliver perfection from the rst brush stroke to the last.61/251/241/231/221/211/21/27654321SHORTSLEEKSENSATIONALFor more information about OPI Artist Series Brushes, log on as a professional at www.opi.com or contact your Authorized OPI Distributor.2010 OPI Products Inc. Call 800.341.9999 or visit opi.comACTUAL SIZEIN INCHESArtist Series Oval Gel BrushArtist Series Flat Gel BrushArtist Series 2-Piece Kolinski Gel BrushArtist Series 2-Piece Acrylic Oval BrushArtist Series Kolinski Mini Gel BrushArtist Series Acrylic Oval BrushArtist Series 2-Piece Kolinski Gel BrushCompact 4 1/2 inches #4 brush head ideal for OPI gels. Great for travel.Artist Series Oval Gel BrushTapers to a sharp point, excellent for details and clean, crisp smile lines.Acrylic Oval BrushLightweight handle for a comfortable grip and effortless brush control.2-Piece Acrylic Oval BrushCompact 4 1/2 inches perfect for travel!Artist Series Flat Gel BrushPerfect for moving quantities of gel for fast nail coverage.Artist Series Kolinski Mini Gel Brush#2 brush head with a slim handle for precision and comfort.na1011styleNF.indd 88 8/24/11 11:22:29 AMOCTOBER 2011 | NAILS MAGAZINE | 89 STYLE}Nail Art Blogs Worth BookmarkingFOR YOUR NAILS ONLYforyournailsonly.netThis blog is all freehand nail art from a Cornell graduatewhostartedoutwithapolish swatchblog,thentaughtherselfhowtodo remarkablenailart.Wereamazedthatthere are no stamps or decals in any of her stunning designs.Theblogalsohostsfuncontests, like the Nail Polish Ambition Contest and the Palette Awards.HEY, NICE NAILS!heynicenails.comTwosisters,aprofessionalmanicuristanda graphicdesigner,sharetheirnailartdesigns. Theytakeinspirationfromeverywhere, including New York Fashion Week nail designs and seasonal trends.PAINTED LADY FINGERSpaintedladyngers.comMorethan2,000followerscantbewrong. ThisPhiladelphia-basedladyhasapenchant forglitterandKonadnailartstamps.Enlarge any of her photos with a click of the mouse. 365 DAYS OF NAIL ARTblogs.nailsmag.com/365nailartThisisashamelessplugforoneofourown blogs, but wed be remiss if we didnt mention 365 Days of Nail Art. Featuring a nail art design adaybyblogreaders,youcouldgetlostin these archives for days. Plus, use the lefthand menu bar to sort the designs by category, such as acrylic, bridal, or murals. >>>BURGERS AND NAILSnailburgerlar.tumblr.comThis quirky blog features almost-daily postshighlightingtwoofourfavorite things:burgersandnails.Thejuxta-positionofelegantOPIpolishagainst mustard-falling-out-of-the-burgeris nottobemissed.Plus,manyofthe submissions show the diners with cute nail art on their digits.51 2345na1011styleNF.indd 89 8/24/11 11:22:32 AM90| NAILS MAGAZINE| OCTOBER 2011STRONGNAILTRITIONHelps stimulate faster nail growth and strengthens peeling & splitting nailsorlybeauty.com 800.275.1111ORLY Nail Treatments are Free of DBP, Formaldehyde & TolueneAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES, SALONS AND SALLY BEAUTY.www.nailsmag.com//21214Hot ToddyAs an esthetically pleasing alternative to the boring paper towel, use new Toddy Cloths from Toddy Gear to do a quick clean-up of nail tables or salon reception desks in between clients. The cloths come inmorethan40vibrantprintsandfeaturedual-sidedcleaning: plushmicrobermaterialononesidetocleanandadistinctively patterned silk microber on the other side to buff and polish. The cloths also feature an antimicrobial coating, protecting them against microorganisms that contribute to bacteria, mold, and mildew. (Be sure to still follow your state boards guidelines for the disinfecting of your table.)If clients eye your Toddy Cloth, stock them in your retail area for sale: They are gentle enough to use on iPhones, glasses, TVs, and more. Plus, with the new Brand Your Toddy option, you can even imprint the smart cloths with your salons logo.For more information, go to www.nailsmag.com//21421.The 90-degree angle shows up creatively in fall designsRosa Vargas, Nails by Rosa, Palm Springs, Fla.Cathelia Cowles, Sculptures, Vicksburg, Mich.Yvette Pitt, The Lacquer Beauty Lounge, Watsonville, Calif.TRENDwatch:the right anglena1011styleNF.indd 90 8/24/11 11:22:39 AMOCTOBER 2011 | NAILS MAGAZINE | 91 CUTICLE OIL+. Moisturizes, heals and refreshes problem cuticles to promote nail growth.orlybeauty.com 800.275.1111ORLY Nail Treatments are Free of DBP, Formaldehyde & TolueneAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES, SALONS AND SALLY BEAUTY.www.nailsmag.com//21214CARING Clients who are known for nicking or smudging their polishwithinminutesof amanicuremaybenetfromNailsinMotionsTip Tops. These nail protectors are clipped to the ngers before the polish step of the manicure, then ipped over after the polish application to protect the polish while the client digs for her wallet, nds her car keys, orbucklesherseatbelt.ThecompanysMani-Pedi ProtectionKitincludes10TipTopspluspedicure sandals with toe separators and a carrying case.Formoreinformation,gotowww.nailsmag.com//21422.Mani Table with the WorksWhen G Elizondo couldnt nd a manicure table to meet all of her specications, she designed her own. Elizondo, who works at Radichi Salon & Spa in Las Vegas, drew out her blueprints then had a carpenter build it out. We love how she built up, not out, adding an extra horizontal tier to get the clean workspace she desired. This table isnt for sale, but Elizondos happy to share her blueprints with NAILS readers for those of you who want to get a similar table built locally. You can view her blueprints at www.nailsmag.com/GManiTable.CLIENTS SIDE> The extra tier houses two UV nail lamps (one on each side) for convenient gel curing.> A dropped-in piece of glass thats centered on the top tier allows clients to see salon iers that are placed on the lower tier, without the risk of the tech spilling something on the ier.> A shared footrest near the table base has room for both the clients and the techs feet.TECHS SIDE> Tools such as an e-le and safety glasses are stored on the lower tier, meaning the top work surface is unobstructed.> Deep drawers on the right side mean that a tall monomer bottle can stand up (in the top drawer) and an entire gallon of acetone can be stored (bottom drawer).> The entire left side is drawers, which provides tons of storage, especially for techs who dont have storage space elsewhere in the salon.>>>In the Nick of Timena1011styleNF.indd 91 8/24/11 11:22:44 AM92| NAILS MAGAZINE| OCTOBER 2011PROTECTIVEPOLISHIELD3-in-1 topcoat bullet proofs your nail lacquer for lasting shine with a protected nish.orlybeauty.com 800.275.1111ORLY Nail Treatments are Free of DBP, Formaldehyde & TolueneAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES, SALONS AND SALLY BEAUTY.www.nailsmag.com//21214QQQQAQAND} {Have a style question? (about nail art, fashion, salon decor, etc.) E-mail it to Sree.Roy@bobit.com and check back here for an expert answer.What brand of acrylic paint is used for One-Stroke painting?IloveusingFolkartEnamelPaints.Theyarestrongandwontchipoff easily. They have a uffy consistency like shaving cream. You can get frosts and metallics in these enamel paints, plus they work on glass, metal, ceramic, mirrors, and more. But nail techs tend to like the Folkart Acrylic Paints best. There are more metallics in the acrylic paint, plus the top coat to seal it is a little thinner. You can purchase most colors on my site (www.dewberrycrafts.com)ortryyourlocalcraftstore.Theseallcomein2-oz.bottlesandlasta long time. Donna Dewberry is the inventor of the One-Stroke painting technique.If my clients want their Minx to last longer, can I seal it with a gel top coat? And will this ruin the shiny chrome effect of the Minx?Minx does not advocate the use of gel on top of Minx, but in my experience it may be a wise choice in certain cases, such as if the client has very oily nails or works a lot in water. Applying gel on top will take the shine down a bit. Its important to have a good understanding of proper Minx application and the importance of heat before using anything on top. It must be sold as an add-on.Minxismarketedasneedingnobaseortopcoat.Sinceusinggelover Minx is not part of the Minx process you should charge more for the gel coat. A suggested way to use gel and Minx is to consider applying gel over a clients naturalnailplatebeforeapplyingMinx,incaseswherethereareridgesor natural nail damage, so that there is a smooth surface to apply the Minx. Naja Rickette is a Minx Master and lead trainer. IvenoticedthatnailridgescanshowthroughMinxnailcoatings.Arethere certainstylesofMinxthatIshoulduse(ornotuse)onclientswhohavevery ridged nails?IfsomeonehasdeepridgesinthenailsMinxmaynotcoverthemup.In particular,SilverandGoldLightningMinxislikespandexforthenailit willshowallimperfections.Forclientswhohaveridgednailsbutlikethe chrome look of Gold and Silver Lightning, then suggest patterns that are still inthemetallicrangebutthathaveadesignthatcancamouageridgesor an otherwise uneven nail plate. Some good options are the metallic shnets, skulls, and cheetah patterns. Naja RicketteDo most salons that have their employees purchase matching uniforms have each employee buy just one uniform, or do they buy multiple ones? Most of my techs work in the salon fve days in a row.Most salons purchase at least three sets of uniforms per full-time employee oriftheywearthemvedaysaweek.Thisrequireslesslaundering,which allows for longer wear and a crisper, more professional-looking uniform. Agnes Dalisay is founder and owner of Chi Couture Uniforms (www.mychi.ca).na1011styleNF.indd 92 8/24/11 11:22:50 AM81085Haunting81087Near Dark80754Ghoulish Glow81053Black Mesh81086Its Alive81088Crimson#80723 18pc Counter DisplayIncludes 3 each of .5oz lacquers:Haunting, Crimson, Near Dark, Its Alive, Ghoulish Glow & Black Mesh Crackle Glaze#80724Buy3 Get 1 Free Includes: Its Alive, Ghoulish Glow, Black Mesh Crackle Glaze & Fast Forward Top CoatDont miss the HAUNTING beauty of this years China Glaze Halloween selection which includes two daringly dark Crme lacquers & two Limited Edition Glitters.www.chinaglaze.comwww.nailsmag.com/fifi/21119na1011styleNF.indd 93 8/25/11 12:29:52 PM94| NAILS MAGAZINE| OCTOBER 2011Flutter and Flowers1. Useaatbrushandwhiteacrylic paint to paint half the nail diagonally. Useaatbrushandpinkpaintto paint the remainder.2. Double-loadaatbrushwithlight blue and white paints, then push and wiggle to create a buttery.3.Addgreenbladesofgrass.Accent them with black. Add pink and white owers with black centers above the grass. Add more colorful owers on top of the white paint. Candy Corn French1.SculptaFrenchusingglitter orange acrylic.2. Use white paint to create three triangles down the center of the nail, each pointing in a diferent direction.3. Fade yellow and orange paint in each triangle to nish the candy corn. Stripes and Sparkles1.Apply two coats of bronze polish diagonally in two corners.2.Useyellowpolishtollinthe center gap. Use an orange striper tooutlinewherethebronzeand yellow meet.3. Useblackacrylicpainttocreate zebrastripesovertheyellow polish.4.Highlightthestripeswiththe orangestriper.Applygoldglitter top coat.Jade Sewell, Just Nails, Great Falls, Mont.Brenda Rodrigues, Nails by Brenda at Anaphora Salon, Atascadero, Calif.Hanh Lisa Doan, Longs Nails Spa, Victorville, Calif.PHOTOGRAPHY BY KELLY BRACKENnail art studioSTYLE}na1011nas.indd 94 8/24/11 11:25:36 AMOCTOBER 2011 | NAILS MAGAZINE | 95 Playful Pumpkin1.Paintthefreeedgedarkgreento create a French.2. Useanorangestripertocreatea pumpkin.Addtwoovalsforhands. Use a green striper to add a pumpkin stem and curly accent lines.3.Use the green striper to create blades of grass. Add two white ovals for eyes. Use black to outline the pumpkin and to add a smile and other accents. Add white dots inside the eyes.Tanya Arcuri-Gout, Poland, N.Y.Go Cats!1. Use sparkly blue acrylic on the free edge to create a French.2. Add a gold glitter smile line. 3. FinishtheFrenchwiththepinkof yourclientschoice.Buf.Adda base coat.4. Usegoldacrylicpainttowrite Catsincursivediagonallyacross the nail. Add gold beads in opposite corners of the nail.Brandy Williams, Glendive, Mont.Trick or Treat1. Applysilverglitteracrylic diagonally on the free edge.2. Fillintherestofthefreeedge with orange acrylic.3.Applypalepinkglitteracrylic over the entire nail.4.Useastriperbrushandblack acrylic to highlight the smile line and to the lines where the silver and orange acrylic meet. Cassi Banning, Tips and Toes Nail Salon, Great Falls, Mont.For more nail art step-by-steps, visit www.nailsmag.com/style, then click on Nail Art.Want to see your nail art how-to here? Mail your tips (one for each step) and instructions to Sree Roy, NAILS Magazine, 3520 Challenger St., Torrance, CA 90503. Make sure to include your name, salon name (if applicable), city, state, and contact information.,.comna1011nas.indd 95 8/24/11 11:25:40 AM96| NAILS MAGAZINE| OCTOBER 2011We love it when we nd nail techs who truly put the art into nail art, and Fumic Sueyoshi is a true gem in this arena. She coined herself a jewelry nailist, andwethinkhernailcreationsrivalthoseofany jewelry-makeroutthere.Hernailartcombines color,texture,andmovementtocreateedgy yetelegantdesignsthatincorporateSwarovski crystals,feathers,charms,andtheoccasionalrealgemstone.She runs a private salon in New York City, and you can see more of her work at www.jewelrynailist.com.Q Where did you get the bulk of your nail art training? a Mostly in my native Japan. Nail art is extremely popular there, and clients always want extra fancy embellishments. Japanese and U.S. nail art are very diferent, so I created a fusion style.Q Can you tell us a little about your mentor, Yukako Tanimura? a Yukako Tanimura is a bonsai artist. She is the best Ive ever seen. I met her in New York City while we were both traveling, and later I visitedherinTokyo.Hertalentismanifold:Shemakesjewelryand nailarttoo.Atherplace,sheletmetrytocreatenailartwithher Swarovski crystal collection. I made some pieces and loved it.QCan you tell us about how developed your signature nail art style? a My designs are based on what I love: combining materials and being creative. Im always on the look-out for materials that can be used in my art. Even while traveling, I get pieces for my new creations. I love good quality pieces. Its very important to me how expensive my nails look. SueyoshiThis New York City-based nail tech combines jewelry, nail art, and creative energy to produce stunning nail masterpieces.The Jewelry Nailist: Fumic SueyoshiANDANDANDSTYLE}na1011fumic.indd 96 8/24/11 11:36:20 AMSuggested SalonPrice:$35.99eana1011fumic.indd 97 8/24/11 11:36:35 AMwww.nailsmag.com/fifi/21276na1011fumic.indd 98 8/24/11 11:36:39 AMwww.nailsmag.com/fifi/21197na1011fumic.indd 99 8/24/11 11:36:43 AM100| NAILS MAGAZINE| OCTOBER 2011Monster Mash Monster MashInspired by this ghoulish time of year, ve talented nail artists show of their fun designs and devilish skills as a treat for you.STYLE}Ryoko Garcia of Altus, Okla., has the fright of Halloween jump right out at you with her acrylic 3-D sculpting.Stretching nail skills to the limit, Amanda Lehner of Las Vegas covers all the Halloween nail art themes from the graveyard to the doorstep.nail artists show of their fun designs and devilish skills as a treat for you.Stretching nail skills to the limit,na1011monster.indd 100 8/24/11 11:44:52 AMOCTOBER 2011 | NAILS MAGAZINE | 101 Aracely Ruiz of San Antonio, Texas, weaves a web of sculpted acrylic designs over spooky glittered nail tips.Naomi Gonzalez of Sanford, Fla., aint afraid of no ghosts.Erica Plyter of Hinesville, Ga., is the Faust of nail techs with her precision nail art and creative designs.na1011monster.indd 101 8/24/11 11:44:57 AM102| NAILS MAGAZINE| OCTOBER 2011hair feathersboutique1.HairFeathergivesyouaccessto professional-grade,cruelty-free,rooster featherextensionsthatcanstandupto yourclientsdailyhairroutineforupto three months. Your clients can wash, curl, and at iron the feathers. Hair Feather also carriesfeathersforyourpetandcomes with a do-it-yourself kit. www.nailsmag.com//214312.OriginalFeatherlocks,FatFeather-locks,BraiderFeatherlocksandPuppy-locksfromConditionCulturearereal feathers that last up to eight weeks and canbereappliedforalifetime.Inanar-ray of colors, Featherlocks can be skinny, fat, or short. Braided Featherlocks can be cascaded down a thin braid of hair or at-tachedwithFeatherlockssiliconebead technology.Thelooptoolissoldsepa-ratelyandFeatherlocksareforlicensed salons only. www.nailsmag.com//214323. From Bling Strands, these Fancy Feathers are for professional use only and are not pre-bonded, allowing every customer to mix and matchfeatherstotheirliking.Thefeathers, which come long at 8 to 13 inches or short and ufy at 4 to 8 inches are available with apeacocksheen.Theyareappliedusing amicrobead,pliers,andathreadinghook. BlingStrandshasvariouspliersandtools available, which are sold separately. www.nailsmag.com//214334.BellaViasfeatherhairextensions comewithfourcontrastingfeathersto helpcreateauniquelytexturedlook.The feathers,whichlastaboutfourmonths, are washable and can be styled and curled intoyourclientsownhair.BellaViaalso has feather hair charms that are attached tobraided,humanhairextensions.The braid lasts about two months and can also be washed and styled. www.nailsmag.com//214345.Thesehand-selectedfeathersfrom FineFeatherheadscanbestyledany wayatupto450degrees,andtheylast aboutfourmonths.FineFeatherheads workswithasinglefarmtoensure ethicaltreatmentoftheroostersand usesmineral-baseddye.Thefeathers areattachedontothehairusingamicro linkthatcanbeclampedintoplaceand removed for later use.www.nailsmag.com//214356.DonnaBellaMilansfeathersarereal andcomefromfarm-raisedroosters. Theyareorganicallydyedtocreatefun colorsandtextures.Theextensionslast uptofourmonthsandareattached using micro beads. Clients can blow-dry, straighten, or curl their hair while wearing thefeathers.Eachpackagecomeswith four feathers. www.nailsmag.com//21436Forget the hair dye and get natural versatility for your clients hair with feathers. Removable and easy to apply, feather hair extensions give highlighted texture and personality to their locks. PHOTOGRAPHY BY KIMBERLY PHAM STYLE}na1011boutique.indd 102 8/24/11 11:52:20 AMwww.nailsmag.com/fifi/21136na1011boutique.indd 103 8/24/11 11:52:46 AMNAILS PERFECTED Only from Akzentzwww.akzentz.comCOPYRIGHT HAIGH INDUSTRIES INC.COLOUR NAILS THAT LASTVariety of luxurious colours No smudging, No chipping, No crackingLong lasting very high gloss shineProtects the natural nailEasily removed in 10 minutes100% pure gelwww.nailsmag.com/fifi/21305na1011busNF.indd 104 8/24/11 11:53:49 AMOCTOBER 2011 | NAILS MAGAZINE | 105 BUSINESS}Who Doesnt Want to Paint Their Puppy?Thedog-loversamongyourclientswillbe thrilledtondPuppyPaintonyourretail shelves. From the makers of Piggy Paint, Puppy Paint is a non-toxic, eco-friendly nail polish that is specially formulated from natural ingredients. Made in the U.S., Puppy Paints hypoallergenic, odorlessformulaisgentleenoughtouseon sensitive puppies, yet it dries to a hard, durable nish and even has an embittering agent in the polish to prevent licking.Formoreinformation,gotowww.nailsmag.com//21441.>>>PHOTOGRAPHY ISTOCKPHOTO.COM/STOCKCUBE.comFind other pet-focused beauty products for your salons boutique at www.nailsmag.com/petretail.na1011busNF.indd 105 8/24/11 11:53:52 AM106| NAILS MAGAZINE| OCTOBER 2011www.nailsmag.com/fifi/21249Jump Aboard the Welcome Wagon AdrienneSchodtlermaybetoobusy atthesalontoreachoutpersonallyto eachofhernewneighborsinthetown ofFuquay-Varina,N.C.,butSchodtler, ownerofNailsbyAdrienne,employsa servicecalledNewNeighbortodojust that. New Neighbor receives lists of new homeowners in the area and visits them with a complimentary basket full of gifts fromlocalbusinesses,shesays.The costis$3pervisitplusthecostofthe supplies put in the basket (card, service menu, samples, etc.). My ladies average 50 visits per month. At the end of the month I receive all of the contact info for those that have been visited so I can follow up wit