dna (1)
Sequence motifs, information content, logos, and HMMs Morten Nielsen, CBS, BioCentrum, DTU.
Artificial Neural Networks 1 Morten Nielsen Department of Systems Biology, DTU IIB-INTECH, UNSAM, Argentina.
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU T cell Epitope predictions using bioinformatics (Hidden Markov models) Morten.
Sequence Alignment and Phylogeny Dr Peter Smooker, [email protected] B I O I N F O R M A T I C S | | | | | | | B I O L O G Y - M A T H - S.
Psi-Blast Morten Nielsen, CBS, BioCentrum, DTU. Objectives Understand why BLAST often fails for low sequence similarity See the beauty of sequence profiles.
Advanced Database Searching June 24, 2008 Jonathan Pevsner, Ph.D. Introduction to Bioinformatics Johns Hopkins University.
Intro to Alignment Algorithms: Global and Local Intro to Alignment Algorithms: Global and Local Algorithmic Functions of Computational Biology Professor.
A Grid implementation of the sliding window algorithm for protein similarity searches facilitates whole proteome analysis on continuously updated databases.
Sequence Analysis Methods for comparative Genomics Comparative Genomics SIB PhD program Lausanne Feb 12-16 2007 Philipp Bucher.
NCBI Minicourses BLAST Quick Start [email protected].
Biological Sequence Analysis Chapter 3. Protein Families Organism 1 Organism 2 Enzym e 1 Enzym e 2 Closely relatedSame Function MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS.
