dna (1)
Sequence Analysis Methods for comparative Genomics Comparative Genomics SIB PhD program Lausanne Feb 12-16 2007 Philipp Bucher.
Biological Sequence Analysis Chapter 3. Protein Families Organism 1 Organism 2 Enzym e 1 Enzym e 2 Closely relatedSame Function MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS.
Biological Sequence Analysis Chapter 3 Claus Lundegaard.
Protein Sequence Alignment and Database Searching.
A Web-based Tool for Visual Identification of Novel Genes
Bioinformatics – NSF Summer School 2003 Z. Luthey-Schulten, UIUC.
Bioinformatics – NSF Summer School 2003 Z. Luthey-Schulten, UIUC
Sequence Analysis Methods for comparative Genomics
