Download - User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

Transcript
Page 1: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

User ManualTeraStation

HS-DTGL/R5

www.buffalotech.com v2.4

Page 2: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

Introduction

CongratulationsonyournewTeraStation!Thisusermanualisintendedtoassistyouinconfiguringit. If you run intodifficulties orneedadditionalhelp, feel free to contact our24/7TechnicalSupportat(866) 75�-6�10(USA&Canadaonly).TechnicalSupportinEuropeisavailablebetweenthehoursof9am-6pm(GMT)MondaythroughThursdayand9am-4:30pm(GMT)Fridayforthisproduct. Customers inEurope canobtainTechnicalSupportusing the following information:Email:[email protected]|Web:www.buffalo-technology.com

ThisusermanualusesimagesrepresentativeofTeraStationuserinterfacesandsoftware.Becausewe’reconstantlyupdatingourproduct,theimagesandtextinthismanualmayvaryslightlyfromtheimagesandtextdisplayedbyyourTeraStation.Thesechangesareminorandshouldnotaffecttheeaseofsetupadversely.Astimepasses,futureuserinterfaces,updatedsoftware,andlaterversionsofthismanualmaybeavailablefordownloadatourwebsite:http://www.buffalotech.com.

Page 3: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

Table of Contents

InitialSetup.......................................................................4Install.Software..................................................................8Accessing.TeraStation.Data.from.a.PC..............................14AccessingTeraStationDatafromaMac...........................17TeraStation.Layout..........................................................21Advanced.Settings............................................................24BasicSettings..................................................................25Network.Settings..............................................................26DiskManagement............................................................28AddingExtraHardDrives................................................34SharedFolders.................................................................39Groups............................................................................42Users...............................................................................43Printers............................................................................47Backups.........................................................................51PCast.and.DLNA..............................................................55Maintenance....................................................................58UPS.................................................................................59Client.Utility....................................................................69Troubleshooting...............................................................71ChangingaFailedHardDrive..........................................72TechnicalSpecifications...................................................80TechnicalSupport............................................................81

Page 4: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

BeginsettingupyourTeraStationbypluggingyourpower cable and.Ethernet cable into the back ofthe.TeraStation.as.shown.

TeraStation Quick Setup

Page 5: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

5

Plug.the.power cord.into.a.wall.socket...

Plug.the.other.end.of.the.Ethernet cable.intoahub,router,orswitchinyournetwork..

TeraStation Quick Setup

Connect your cables

Page 6: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

6

Make sure that the powerswitch. on. the. rear. of. the.TeraStation. is. in. the. ON.position,withthe“I”symbolpresseddown.

TeraStation Quick Setup

Press. the. power button. on. the.frontpanel.TheLED’swillswirlasyourTeraStationbootsup.

After your TeraStation has completed booting up and the LED’s haveceasedtoswirl,checktheLINK/ACT LED.on.the.front.of.the.TeraStation...Ifit’slit,thenyourTeraStationisconnectedproperly,andyoucangoontopage8.Ifit’snotlit,turntopage7fortroubleshooting.

Page 7: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

7

TheTeraStation’sEthernetportwillautomaticallyadjusttouseeitheraCrossoverorPatchcable,soyoumayconnecttheTeraStationtoyournetworkwitheithertypeofEthernetcable.BuffaloTechnology.doesn’t.recommend.connecting.the.TeraStation.directly.to.a.PC.Verify.that.the.LINK/ACT LEDonthefrontofTeraStationislit(seepage6’spicture).Ifit’slit,gotopage8tocontinuesettingupTeraStation.IftheLINK/ACT LEDisstillnotlit,trythesuggestionsbelowtoverifythatyou’renotsufferingfromcommonsetupproblems.

Havingproblems?Makesurethat:

•.theTeraStationandtherouter,huborswitcharebothpoweredon,•.theEthernetcableissecurelypluggedinatbothends,and•.theEthernetcableisnotdamaged.VerifythisbytryingadifferentEthernetcable..

Ifproblemspersist,contactour24/7technicalsupportat(866) 75�-6�10.(USA.&.Canada.only)...TechnicalSupportinEuropeisavailablebetweenthehoursof9am-6pm(GMT)MondaythroughThursday and 9am-4:30 pm (GMT) Friday for this product. Customers in Europe can obtainTechnicalSupportusingthefollowinginformation:Email:[email protected]|Web:www.buffalo-technology.com

TeraStation Quick Setup

Page 8: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

8

InserttheTeraNavigatorCDintoyourPC’sCD-ROMdrive.Setupshouldautomaticallylaunch.Ifitdoesnot,manuallylaunchsetup.exebypressingtheStart.menu.and.selecting.the.Run... option.When.the.Run dialogopens,typed:\setup.exe(wheredisthedriveletterofyourCD-ROMdrive).Press.OK to.continue.

TeraNavigator Setup

Page 9: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

TeraNavigatorisnowrunning.PleasepresstheInstall Client Utility icon,andthenStart...When.installationisfinished,pressLaunch..

TeraNavigator Setup

Page 10: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

10

The.TeraStation Client UtilityallowsyoutoeasilyconfigureTeraStation’snetworksettings.ThetabsshowthenamesofavailableTeraStations.IfyouhavemorethanoneTeraStationonthenetwork,clickthetaboftheoneyouwanttoselectit.WhileaTeraStation’stabisselected,itsIP AddressisvisibleandtheView Sharesbuttonwilltakeyoudirectlytoitsnetworksharesandfolders.Seepage69formoreinformationonTeraStation Client Utility.Fornow,makesurethattheproperTeraStation’stabisselected,clickSetup,andchoose Browser Management..

TeraNavigator Setup

Page 11: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

11

Thisloginpromptwillappear.Enter admin fortheusername.Untilyouchangeit,thepasswordfortheadminaccountwillbe password....Press.the.OKbuttonwhenfinished.

TeraNavigator Setup

Username:adminPassword:password

Seepage44tochangeyourpassword.Ifyou’veforgottenyourpassword,seepage64.

Ifthisloginpromptdoesnotappear,yourDHCPservermaynotbefunctioningcorrectly.IfDHCPisdisabled,youmayre-enableit,orverifythattheTeraStation’sIPaddress(page10)isinthesamerangeasthatofyourPC.Seepage69andpage70tomanuallyconfigureyourTeraStation’sIP.address.if.necessary.

Page 12: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

1�

You.are.now.logged.in.totheTeraStationManagementUtility...Bookmarkthispageinyourbrowserso it canbeeasilyaccessed for futureconfigurationchanges. Youcanalsogethereby typinghttp://TERASTATION_NAMEintoaWebbrowser,whereTERASTATION_NAMEisthenameofyourTeraStationthatyousetonpage13.Fordetailedexplanationsofeachmenuandsetting,pleaserefer.to.the Advanced Settings section(startingonpage24)ofthismanual.Tocontinuesetup,clickon.the.Basic.link.on.the.left.side..

TeraNavigator Setup

Page 13: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

1�

HereontheBasicpage,beginbychangingthename.of.your.TeraStation.in.the.TeraStation Hostnamefield.Afriendly,easy-to-remembername.is.recommended...The.name.cannot.containanyspacesorspecialcharacters.Alphanumericcharacters,hyphens,andunderscores.are.allowed.

AshortdescriptionoftheTeraStationcanbeentered.into.the TeraStation Description field.You’llthenseethisdescriptioninNetworkNeighborhoodonWindowsmachines.

Makesurethatthedateandtimearecorrectin.Date and Time Setup...To.synchronize.clock.settingswithyourcomputer,pressUse Local Time.

Oncedesiredfieldshavebeencompleted,pressthe.Apply buttonatthebottomofthepage.

FormoreinformationontheConfiguration Utility,turntoAdvanced Settings,beginningonpage24.

TeraNavigator Setup

Page 14: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

1�

Congratulations!You’vecompletedbasicsetup.FormoredetailontheothersettingsavailableinyourTeraStation,turntoAdvanced Settings,beginningonpage24..

To access TeraStation data:Press.the.Startmenu,selecttheRun...option.WhentheRundialogopens,type\\TeraStation_Name (where ‘TeraStation_Name” is the TeraStationHostname set on page 13). Press theOK.buttontocontinue.

TeraNavigator Setup

Page 15: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

15

TeraStation’srootdirectorywillappear.Youwillseealloftheconfiguredshares,includingshare,thepreconfigureddatafolder.Alluserscanreadandwritetoallfoldersunlessotherwiseconfigured.Tosetupsecurityandpasswordprotection,oraddothersharestoyourTeraStation,pleaserefertopages38-40ofthismanual.TochangeyourRAIDconfiguration,seepages29-32.TosetupaprinterseethePrinterssectionbeginningonpage45.DriveletterscanalsobemappedtosharesonyourTeraStation;seepage16formoreinformation.

Note: If this pagedoesnot appear, or if youreceive a popup window from your firewallsayingthataNetBiosSessionhasbeenblockedfrom your TeraStation’s IP address, you willneed. to. add. your. TeraStation’s. IP. address. to.yourfirewall’strustedzone.YoucangetyourTeraStation’s. IP. address. from. the. TeraStation Client Utility (see page 10). Consult. your.firewalldocumentationformoreinformationonallowingnetworkaccesstoandfromaspecificIP.address...

Accessing TeraStation Data from a PC

Page 16: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

16

FromtheTeraStation’sRoot Directoryscreen(seepage15),clicktheTools pulldownmenuandselect.Map Network Drive;MapNetworkDrivewillrun.Selectthedriveletteryouwouldliketomapfrom.the.Drive:pulldownmenu.Enterthe\\TeraStation_Name\share_name.in.the.Folder:field,where TeraStation_Name.is.the.TeraStation Namesetonpage13and share_name is.share.(if.you’re.mappingtothispreconfiguredfolder)orthenameofanothersharedfolderthatyousetuponpage25.YoumaybrowseforasharedfolderbypressingtheBrowse buttonandsearchingthroughtheEntire Network.and.then.the.Microsoft Windows Network...Check.the.Reconnect at logoncheckboxtohaveWindowsconnecttothismappeddriveeverytimeitstarts.Whenfinished,presstheFinish button.TeraStationisnowmappedtoadriveletter.

Accessing TeraStation Data from a PC

Page 17: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

17

IfyourMacdoesnotautomaticallydetectyourTeraStation’sSharefolderandputitonyourdesktop,youwillneedtoaddtheTeraStationtotheMac’sserverlist.BeginbyclickingGo,and.then.choose.Connect to Server.

Accessing TeraStation Data from a Mac

In.the.Server Addressfield,enteryourTeraStation’s.IP.address.in.the.form.smb://ipaddress(where“ipaddress”isyourTeraStation’sIPaddress),andclickConnect...

If.you.don’t.know.your.TeraStation’s.IP.address,seepage19.

Page 18: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

18

Select.Guest.and.click.on.Connect.

Accessing TeraStation Data from a Mac

Selectthevolumethatyouwanttomount,suchasshare.or.share-mac,from.the.list.of.folders.on.the.TeraStation.

Thesharewillopen.Alinktothesharedfolderwillappearonyourdesktop.

Page 19: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

1�

Ifyoudon’tknowyourTeraStation’sIPaddress,thereareseveral.ways.to.get.it.

OnesimplemethodistousetheTeraStationclientutility(includedonyourCD)tofindyourTeraStation(s).JustclickonthetabforyourTeraStationandyou’llbeabletoreaditsIP.address...You.must.have.a.Windows.PC.running.on.the.networktousetheTeraStationclient.Seepage69formoreon.the.TeraStation.client.utility.

Ifyouhaveanall-MacnetworkwithnoWindowsPCsavailable,youcangettheTeraStation’sIPaddressfromyourrouter’sconfigurationutility.ManyBuffalorouterslistthisinformation.on.the.Client Monitorpage,asshowntotheright.Consult.your.router’s.documentation.for.instructions.on.identifying.client.IP.addresses.

Accessing TeraStation Data from a Mac

Page 20: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�0

TeraStation Expansion

TeraStationhasfourUSB2.0ports,twoonthefrontpanelandtwoontherear.TheseportscanbeusedforaddingexternalUSBHardDrivesoraUSBPrinter.TeraStationwillthensharetheUSBdevices,allowingeveryoneonthenetworktousethem.UptofourexternalUSBharddrives,oroneprinterandthreeharddrives,maybeaddedtoTeraStation.ToconnectaUSBprinterorharddrivetoTeraStation,simplyplugitintooneofthefourUSBPorts.

USB Hard Drive Information:

YoumaypluginadditionalUSBharddrivestoanyofthefourUSBportsonyourTeraStation.Seepage34forsettingupyourUSBharddriveunderTeraStation.Seepage38forinformationonsettingupsharedfoldersonaUSBHardDrive.Page37willshowyouhowtoreformattheUSBHardDrive.Page49showsyouhowtosetupTeraStationtobackuptoaUSBHardDrive.

USB Printer Information:

Seepage45tosetupaUSBPrinterasanetworkprinteronTeraStation.

Page 21: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�1

1. Power Button.–.Press.and.release.the.Power.Button to turn the TeraStation on. Hold itdown for 3 seconds to turn the TeraStationoff...

2. USB Ports –USBportsonbothfrontandrear panels of the TeraStationmay be usedtoconnectUSBharddrives,aprinter,oranadditional. TeraStation. to. your. TeraStation...See TeraStation Expansion on page 20 formoreinformationonusingTeraStation’sUSBports.

TeraStation Diagram

3. Hard Drive Status(also5,8,and10)–ThisLEDwillglowgreenwhenthecorrespondingharddriveisdetectedatboot,andwillblinkgreenwhenadiskcheckorformatisinprocess.Itwillglowredwhentheharddriveis90%fullormore,andblinkredifthereisaproblemwiththedrive.

4. Hard Drive Access(also6,7,and9)–ThisLEDwillblinkgreenwhentheassociatedharddriveisaccessed.Duringstartup,it’snormalforallthelightsonthefrontpaneltolightupinorder,producingapinwheeleffect.

Page 22: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

11. Diagnostic LED–TheDiagnosticLEDmayflashwhentheTeraStationencountersanerror.Inthisevent,pleasecontactour24/7technicalsupport at (866) 75�-6�10. (USA. &. Canada.only; see page 71 for European tech supportinformation).

12. Power – This LED glows a steady greenwhiletheTeraStationisoperatingnormally.Itblinks quickly during bootup and shutdown,and slowly while the TeraStation is in sleepmode.

13. Link/Act –ThisLEDwill glowwhen theTeraStationisconnectedtoanetwork,andblinkduring.normal.network.activity...It.changes.color.to indicate the speed of the connection: bluefora1000Mbpsconnection,greenfor100Mbps,andredfora10Mbpsconnection.

14. Power Socket–Plugthepowercordintothis.socket.

15. Power Switch.–.This. is. the.TeraStation’s.masterpowerswitch.Whileitison,thepowerbuttononthefrontpaneloftheTeraStationmaybeusedtostartandshutdowntheunit.Whenthisswitchisoff,nopowergoestotheunit.Ifthisswitchis leftoff foranextendedperiodoftime, the TeraStation’s internal system clockmayneedtobereset.

16. Internal Fan–TheinternalfanwilladjustitsspeedaccordingtothetemperatureinsidetheTeraStation. To prevent possible overheating,keep the fan clear and clean of obstacles ordust.

17. INIT Button – The INIT button restoresyour.TeraStation.to.factory.default.settings...See.page54formoreinformationonusingtheINITbutton.

TeraStation Diagram

Page 23: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

18. UPS interface–AnUninterruptablePowerSupply can use this interface to safely shutdownyourTeraStationintheeventofapowerfailure.Thisinterfaceisnon-LPS.DP-1,DP-1P,DP-2,orDP-2Pcablesmaybeusedtoconnectto.the.UPS...

19. 10/100/100 Mbps Ethernet Port. –. Use.this port to connect your TeraStation to aswitch, a router, or another computer. Theport is autosensing, so either a conventionalEthernet cable or a crossover Ethernet cablemaybeused.

TeraStation Diagram

20. USB Ports –TeraStationoffers fourUSB2.0/1.1ports foraddingexternaldrivesorUSBprinters. Please see the TeraStation Expansion section on page 20 to learnmore about usingTeraStation’sUSBPorts.

Page 24: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

Advanced Settings

Welcome.to Advanced Settings!..We’ll.discuss.themanyadjustmentsyoucanmaketoyourTeraStation.Beginbybringingupthe.Browser Management.screen.that.you.bookmarkedonpage12.YouarenowatHome...Notice.that.Homeislitupinyellowin.the.screenshot.to.the.left...You.can.return.tothispageatanytimebyclickingonHome.from.the.menu.at.the.left.of.your.Browser Managementscreen.Here,youcanseebasicinformationaboutyourTeraStation’ssetup.Now,clickthe Basic.link.from.the.menu.on.the.left.side.of.your.screen.

Browser Management Tool - Home

Page 25: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�5

You.may.modify.your.TeraStation’s.hostname.anddescriptionunderHostname Setup.

Makesurethatthedateandtimearecorrectin.Date and Time Setup...To.synchronize.time.settingswiththoseinyourcomputer,pressUse Local Time..To.have.your.system.time.automaticallysetbyanNTPserver,enableNTP Server.and.enter.an.IP.address.for.the.NTP.server....

EnsurethatboththeDisplay Language.and.the.Windows Client Language.are.set.to.languages.thatyou’recomfortablewith.

If.you.need.to.access.your.TeraStation.with.FTPorAppleTalk,enabletheseprotocolsunderNetwork.Sharing.Services.

Oncedesiredfieldshavebeencompleted,pressthe.Apply button.

Advanced Settings

Basic

Page 26: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�6

Advanced Settings

Network (IP Address Properties)Inmostnetworks,TeraStationwillgetitsIPaddressautomaticallyfromaDHCPserver.YoumaydisableDHCPhere.IfDHCPisdisabledandanIPaddressisnotsetmanually,it.will.default.to.address.of.the.form.192.168.xxx.xxx,whereeachxxxisanumberfrom1-254,withsubnetmask255.255.0.0.

The.TeraStation’s.IP Address,Subnet Mask,Default Gateway Address,andDNS Server addressmayallbeenteredmanuallyunderIP Address Properties..

Ethernet Frame Sizemayalsobesetmanuallyonthispage.

Click.Apply.after.making.any.changes..

Page 27: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�7

Advanced Settings

Network (Workgroup/Domain)

TomakeyourTeraStationamemberofaworkgroupordomain,entertheappropriateinformationintothefieldsonthispageandclickApply.IftheTeraStationistobepartofaWindowsDomain,theTeraStationshouldbeaddedbeforehandtotheDomainControllerwithacomputeraccountinServerManager.

Page 28: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�8

Advanced Settings

Disk Management (Drive Properties)

ThispageshowsthecurrentpropertiesofyourharddrivesandRAIDArrays.Tochangethesesettings,clickon.RAID Configuration.at.left.

Page 29: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

TeraStation.uses.RAID (“RedundantArrayofIndependentDisks”)technologytocontrolthefourharddrivesinyourTeraStation.RAIDmaybeconfiguredseveralways:

RAID Spanning-Allfourdrivesarestripedintoonelargedrive,givingthemaximumcapacityforyourTeraStation.ThissizeistheonelistedonyourTeraStation’sboxandshowsthetotalcapacityoftheTeraStationwithnodatausedforredundancy.RAIDSpanningisfastandefficient,butwithnoredundancy,ifoneharddrivefails,alldataontheTeraStationislost.

RAID 1(mirroring)-Harddrives(orspannedpairsofharddrives)arearrangedinmirroredpairs.Eachhalfofthepairreadsandwritesexactlythesamedata.ThiscostsyouhalfthetotalcapacityofyourTeraStation,butprovidesexcellentredundancy.Ifaharddrivefails,themirrorcontinuestosupplydata,soyoumayworkonnormally.Youmayreplacethedamagedordefectivedriveatanytime,andnormalRAID1mirroringwillthenbeautomaticallyrestored.

RAID 5(parity)-AlldrivesinaRAID5arrayreservepartoftheirdataspaceforparityinformation,allowingalldatatoberecoveredifasingledrivefails.Theparityinformationtakesupaboutoneharddrive’sworthofspace,soifyousetupallfourdrivesintheTeraStationasaRAID5array,yourusable capacitywill beabout3/4of the total capacity of theTeraStation. RAID5 is anexcellentcompromisebetweenefficiencyandsecurity.Ifasingledrivefails,nodataislost.Afterthedamagedordefectivedriveisreplaced,yourTeraStationwillautomaticallyrestorealldatatothenewdriveandresumenormalRAID5operation.ThisishowyourTeraStationissetupoutofthebox.

BuffaloTechnologyrecommendsRAID 5foritsexcellentbalanceofefficiencyandsecurity.

Note on RAID Arrays

Page 30: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�0

Advanced Settings

Disk Management (RAID Configuration)

This page shows your current RAID arrays.You.may.delete.old.arrays.or.create.new.ones.by clicking on the underlined RAID Array #.under.RAID Array Configuration...

YoumayalsodisableRAID Array Error Detection Responsefromthispage.Normally,thisissetto. automatically. shut. down. the. RAID. array.when.an. error. is. detected.. . Though. it. is.not.recommended,youmaydisablethatbehaviorbyclickingDisable.and.then.Apply.under.RAID Array Error Detection Response...

NotethatyourTeraStationhasfourinternalharddrives.BeforecreatinganewRAIDarray,youmayhavetodeleteoneormorepre-existingRAIDArraystoclearuptheharddrivesforyournewone.Thiswilldestroyalldatacurrentlyonthedisks,sobackupanyimportantdatabeforedeletingRAIDarrays.Whetheryouwanttoclearoutanoldarrayorcreateanewone,beginbyclickingonthe.array’s.underlined.RAID Array #,underName.

Page 31: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�1

Advanced Settings

Disk Management (RAID Configuration)AconfiguredRAIDarraymaybedeletedbypushingthe.Delete RAID Arraybutton.Thiswillfreeupallhard.drives.listed.under.Disk.Structure..

. Toconfigureanunconfiguredarray,putchecksnexttotheharddisksyouwantincludedinthe.array.(under.Disk Structure).and.choose.your.RAID mode...Click.Setup RAID Array.when.ready.ItmaytakeseveralminutestocompletesettinguptheRAIDarray.Whenit’sfinished,aDisk Check.will.run.

Page 32: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

Advanced Settings

Disk Management (Disk Check)

. When.RAID Configurationisdone,you’llseethisscreen.Toconfigureanewarray,clickon.RAID Array #andgobacktothebottomofpage31.Tosetupsharesturntopage38.

Page 33: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

Advanced Settings

Disk Management (RAID Configuration)

. You’ll.see.this.screen.when.your.new.RAID.Arrayiscompletelyconfigured.ClickonShared Foldersandturntopage38tobeginsettingupsharesonyourTeraStation.

Page 34: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

Advanced Settings

Disk Management (USB Settings)

Ifyou’vepluggedanexternalUSBharddriveintooneoftheUSBportsonyourTeraStation,youmaysetitupfromthispage.ClickonitsnameunderUSB Disk Setuptobegin.

Page 35: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�5

Advanced Settings

Disk Management (USB hard drive setup) FromhereyoucanseeyourUSBharddrive’ssetupinformation.Iftheharddrive’sinformationisn’tdisplayedproperly,tryrestartingyourUSBharddriveandthenrestartingyourTeraStation.SomeUSBharddrivesmustbereformattedfromwithinTeraStationbeforetheycanbeassignedshares...Press Format USB Disk,orchooseDisk Formatfromtheleft-sidemenu,tobeginreformattingyourUSBharddisk.Turntopage37formoreinformationonreformattingdisks.Turntopage38tosetupsharesonyourUSBharddrives.

Page 36: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�6

Disk Management (Disk Check)

Toinitiateacomprehensivediskcheckonaharddriveorarrayofdrives,selecttheharddriveorarray.that.you.want.to.check.from.the.Target DiskdropboxandclicktheSelect Targetbutton.

Advanced Settings

Page 37: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�7

Disk Management (Disk Format) Toformataharddriveorarray,selectitfrom

the.Target Diskdropbox.Choosethefilesystem.desired.from.the.File Systemdropbox(internaldrivescanonlybeformattedwithXFS).NotethatFAT32hasa4gigabytefilesizelimit.IfyouchooseFAT32foryourfilesystem,youwillnotbeabletostorefileslargerthan4gigabytesonthedrive.BuffaloTechnology.recommends.the.XFSfilesystem.Press.Select Target Disk.when.done...

Dependingonthesizeofthetargetharddiskorarray,aDiskFormatmaytakeseveralhourstocomplete.

Advanced Settings

Page 38: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�8

Advanced Settings

Shared Folders

TobeginsettingupsharesonyourTeraStation,selectShared Foldersfromtheleftsidemenu,and.then.click.the.AddbuttonunderShared Folders Setup.

Page 39: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

Advanced Settings

Add a new Shared FolderToaddanewsharedfolder,enteranameforit.in.the.Shared Folder Nameboxandchoosewhich.Disk Space.it.will.reside.in...You.may.alsochoosewhichoperatingsystemsthesharewillsupportbyputtingtheappropriatechecksnexttoShared Folder OS Support,andwhetherthesharesupportstheRecycleBinbyputtingadotnexttoEnable.or.Disable.EnteraShared Folder Description.and.a.Remote Backup Password.if.you.desire...Click.the.Applybuttontobuildthenewsharedfolder.

Page 40: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�0

Advanced Settings

Shared Folders (Access restrictions)To.use.Access Restrictionsforashare,putadotnexttoEnable...

HighlightgroupsorusersintheAll Groups/Userscolumnandusetheleft-pointingarrowbuttons(locatedjusttotheleftofeachbox)tomoveindividualgroupsorusersfromtheAll Groups/Users.column.to.the.Read Onlybox(ifyou.want.to.give.them.read.access.only).or.all.the.way.to.the.Writablebox,ifyouwanttogivethemfullaccesstotheshare.Right-pointingarrowswillmovehighlightedusersorgroupsbacktotheright.

Click.Applywhenyouhaveyourgroupsandusersintheappropriateboxes.

Tosetupnewgroupsandusers,seepages42and43.

Page 41: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�1

Advanced Settings

Shared Folders (Anonymous FTP Setup)

ToallowAnonymousFTP,chooseEnable.for.Anonymous FTP Server...Select.a.folder.to.share.from.the.Anonymous User Public Shared Folder (onlyonefoldermaybesharedbyanonymousFTP)andchoosewhetheryouwantthesharetobeWritable,orRead Only...Click.the.ApplybuttontosetupanonymousFTP.

If.FTP ServerisdisabledintheBasicwindow,thispagewillnotbeaccessible.

AnonymousFTPmodeusesport8021(i.e.ftp://IP Address:80�1).

Page 42: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

Advanced Settings

Group ManagementTo.Deleteagroup,putachecknexttoitsnameandclick.Delete.ToaddagrouptoyourTeraStation,click.Add.

Add a name and a description to the Add New Groupfields.PutchecksnexttoeachMember User.thatyouwanttobepartofthegroup.ClickApply.whenyourgroupissetupthewayyouwantit.

Page 43: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

Advanced Settings

User ManagementTeraStation is preconfigured with two users,admin. and. guest, out of the box. The guest.account. allows. network. users. login. access. so.that they can clear the print que. It has nopassword.Theadmin.and.guest user.accounts.cannotbedeleted.Todeleteanyotheruser,putachecknexttotheirnameandclickDelete...To.addanewuser,clickAdd.

The. Add New User dialog will appear. Entera. User Name, Password, andUser Description.for.the.new.user.and.click.the.Applybutton.Ifa user will be accessing the TeraStation froma Windows 95/98 computer, their passwordshould be 15 characters or less. Macusers’spasswordsshouldbe9charactersorless.

Page 44: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

Advanced Settings

User Management (changing passwords)

To change an account’s password, click on thename.of.the.account.under.User Settings.Note:if.a.user name.and password.are.used..to.log.into.user’s windows computer or domain, the sameuser name and password shouldbeusedwhencreatingtheuser’saccountontheTeraStation,orproblemsaccessingsharedfoldersmayoccur.

Enterthedesirednewpasswordinbothboxesand.click.Apply.

Page 45: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�5

Advanced Settings

Troubleshooting Multiple Shares

Whenaddingmultipleshares,youmayseethiserror.message...

Thisiscausedbyhavingmultiplesharestothesame.resource.using.different.credentials...The.

error occurswhen connecting to at least one secure, restricted share. Due to a constraint inMicrosoftWindows,onlyonesetofcredentialscanmapdrivelettersforanetworkresurcesuchastheTeraStation.Assuch,onlyoneusernameandpasswordcanbeusedwhilemappingadrive.Ifunsecure,unrestrictedsharesaremappedandthenanattempttomapasecure,restrictedshareoccurs,thenthiserrorwilloccur.Topreventthis,youmustcreateallmappedsharesusingthesame loginandpassword information. Please followthestepsonthenextpagetoremedythisproblem.

Page 46: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�6

Advanced Settings

Mapping Multiple Shares

Whenmappinganyshare,selecttheConnect using a different user nameoption.Aloginandpasswordpromptwillappear.Use the username and password required by any secure,restricted.shares.for.allshares.Allmappedsharesmustusethesameusernameandpassword!

If only unrestricted shares are being mapped, then it’s not necessary to set a username andpasswordforshares.Multiplemappeddrivestounrestrictedsharescanexistwithoutausernameorpasswordaslongasnorestricted,securesharesaremapped.

Page 47: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�7

Print Server (Settings)

AUSBprinter,pluggedintoaUSBportoneitherthefrontortherearofyourTeraStation,maybeused.as.a.Windows Print Serverand/oranApple Print ServeronyournetworkbychoosingEnable.on this page as appropriate and then clickingApply...TeraStationsupportsmostPostScriptprinters.Itdoesn’tsupportbi-directionalprinters.Non-PostScript printers are not supportedby Buffalo. You may be able to get enoughinformation froma printer’s documentation togetittowork,butourtechnicalsupportcannothelpyouwiththis.Multi-function(all-in-one)printersarealsonotsupported,andtechsupportcannothelpyouconfigurethem.Whenmulti-function(all-in-one)printersareattachedtotheTeraStation,usuallyonlytheprintingandfaxfunctionscanbemadetowork.Otherfeatures,suchasscanning,probablywillnotfunction.

Page 48: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

�8

USB Settings

Print Server - Printer Share Installation

IfTeraStationissetuptoshareyourprinter(page45),youcaneasilyaddtheprintertoanyWindowsPConyournetwork.FollowthesestepsforeachPCthatyouwanttobeabletoaccesstheprinter.

. Access theTeraStationbypressingStart, selecting theRun....option,andentering\\TeraStation_Name (whereTeraStation_Nameisthenameyousetonpage21). PresstheOK buttonwhenfinished.

Right.click.on.the.lp.icon.and.select.Connect...You’ll.receive.a.warning.that.the.server.doesn’t.have.the.properdrivers.Pressthe OK buttontocontinue.

Page 49: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

��

USB Settings

Print Server - Printer Share Installation (continued)

The.Add Printer Wizardwilllaunch.Selecttheproperdriverforyourprinter.Ifyourprinterisnotinthelist,you’llhaveto insert theCDthatcamewithyourprinter intoyourPC’sCD-ROMdriveandpresstheHave Diskbutton.Refertoyourprinter documentation for further information on installingyourprinterifnecessary.PressOKtofinish.

If.lpistheonlyprinterinstalledonthePC,thenitwillautomaticallybesetasthedefaultprinter.Ifit’snottheonlyprinter,youmaymakeitthedefaultprinterbyclickingPrinters and FaxesinControlPanel,rightclickingonthelp printericonandselectingtheSet as Default PrinteroptionfromtheFiledrop-down.menu.

Page 50: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

50

Advanced Settings

Print Server (Delete Print Queue)

Ifacorruptprintjobissenttoaprinter,printingmaysuddenlyfail.Ifyourprintjobsseemtobelockedup,clearingtheprintqueuemay.resolve.the.issue.ToexecutetheDeletePrintQueueprogram,presstheDeletebutton.Thiswillclearallcurrentprintjobs.Userswillhavetore-sendanyincompleteprintjobstotheprinter.Iftherearestillproblemsprintingtotheprinter,thenchecktheprintermanufacturer’sdocumentationfortroubleshootinginformation.Also,verifythattheUSBcableissecurelyfastenedtoboththeprinterandthe

TeraStation.Finally,youmaytryturningtheTeraStationoff,turningtheprinteroff,turningtheprinterbackon,andthenturningtheTeraStationbackonagain.

Page 51: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

51

Advanced Settings

Disk BackupTocreateabackupjob,clickonanunderlinedJob Number.. . The. Edit Backup Job. dialog. will.appear.

If.the Disk Sleepfunctionisenabled,disableit(page61)beforecreatingabackupjob.

Page 52: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

5�

Advanced Settings

Disk Backup (Edit Backup Job)A.Backup Job. can. run. regularly.on.a.daily.or.weeklyschedule,orimmediatelybyappropriatechoices.in.the.Backup Job Schedulefield.Date.and. Time for the backup may be entered,and. Encryption. and. Compression enabled ordisabled. Enable Overwrite Backup. to. have.eachscheduledbackupwriteoverthepreviousbackup,orDifferential Backupstobackuponlyfileschangedsincethepreviousbackup.Select the folder to be backed up from theSource Backup Shared Folder dropbox, andthe destination for the backup files from theDestination Backup Shared Folder dropbox.The destination folder may be on a USBdrive attached to the TeraStation, or anotherTeraStation.on.the.network...Click.on.Select.Click.the.Applybuttonwhenyourbackupjobissetupthewayyouwantit,orClear Jobtostopajobfromrunningagain.

Page 53: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

5�

Advanced Settings

Disk Backup (TeraStation List)

Press.Refresh.to.get.a.list.of.TeraStations.on.your.network.

Note:DiskBackupsbetweentwoTeraStationsuseport8873forencryptedbackupsandport873forbackupswithnoencryption.

Page 54: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

5�

Advanced Settings

Disk Backup (Add TeraStation)

ToaddaTeraStationtoyournetwork,enteritsnumericalIPaddressintheRemote TeraStation IP AddressfieldandclicktheAdd to Listbutton.

Page 55: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

55

ToaccessPCastandDLNAsettings,clickPCast.in.the.left-side.menu..

PCastandDLNAarespecialservicesthatcanrunwithinTeraStation,allowingittobeamedia.server.for.LinkTheater.or.other.digital.multimediaplayers.TheLinkTheaterproductisamediaplayerthatconnectstoyourtelevision.and.streams.multimedia.content...The.PCast.service.allows.you.to.stream.any.multimedia.content.directly.from.TeraStation.HomeServertotheLinkTheater.DLNAisan

PCast and DLNA Settings

industrystandardsupportedbymanydigitalmultimediaplayers.

Ifyoudonotownamultimediaplayer,PCastandDLNAsettingscanbecompletelyignored.

FormoreinformationonLinkTheater,pleasevisitBuffaloTechnology’swebsiteat.http://www.buffalotech.comandlookunderMultimediaProducts.

Page 56: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

56

PCast and DLNA Settings

Media Servers: The.Media Server Function will.need.tobeenabledforthisfunctiontowork.IfyoudonotownaLinkTheaterorDLNAmediaplayerthandisablingthisfeatureisrecommended.

Media Folder: The.Media Folder specifieswhichsharedfoldertosharewiththemediaplayer(s).Allofthemultimediafilesinsidethissharedfolderwillbeavailabletothemediaplayer(s).NOTE: Atthistime,onlyonesharedfoldercanbeaccessed.Pleasemakesurethatallofthemultimediafilesyouwishtosharewiththemediaplayer(s)areinthissharedfolder.

Media Server Password: Restrict.access.to.your.TeraStationmediaserverbyspecifyingapassword.

Limit DLNA Client Access: Choose.what.devices.can.access.your.TeraStation.media.server...See.page57formoreinformationonconfiguration.

Update Media List: Thisupdatesthelistofmultimediafoldersandfilesdisplayedbyyourmediaplayer.Somechangesmaynotbeshownuntilthelistisrefreshedorthemediaplayerrebooted.

Page 57: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

57

PCast Settings - Choose Devices

GettothispagebyclickingChoose Devices.on.the.previouspage.

Search for DLNA Client: This.will.show.a.list.of.all.clients.that.can.connect.to.the.TeraStation.mediaserver.Foranythatyouwanttohaveaccess,putacheckmarknexttotheirMACaddress.and.click Allow Access...You.can.deny.accesstoanyDLNAclientbycheckingitandclicking.Deny Access...

Page 58: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

58

Advanced Settings

Maintenance (Notification)IfyourTeraStationisremotelymanaged,youmaychoosetoreceivenightlystatusreportsandbenotifiedofanydiskeventsbyemail.Tosetthisup,enableMail Notification.and.entertheIPaddressofyourSMTPserver*in.the.SMTP Server Addressfield.SelectaSubjectlinefortheemails(i.e.“TeraStationreport”)andentertheemailaddressofeachpersonyouwanttoreceivenotificationemailsinto.a.Recipient Mail Addressfield.

*SMTPservermustbeofopentype.There’snoprovisionforenteringausernameorpassword.

Page 59: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

5�

Advanced Settings

Maintenance (UPS Settings)YoumayenableSynchronize with UPS.and.UPS Automatic Shutdownfromthispage.ConsultyourUninterruptablePowerSupply’sdocumentationforfurtherinformationaboutsettingupyourUPSsystem.

TeraStation’sUPSinterfaceisserial.USB-typeUPSinterfacesarenotcurrentlysupported.Seepages23and60formoreinformationonTeraStation’s.UPS.interface.

Page 60: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

60

UPS/Maintenance port

See below for connector pin assignment.

Pin Signal Description1 NC NC2 RXD APC_Line_Fail 3 TXD APC_UPS_Shutdown4 NC OMR_UPS_Shutdown 5 GND GND6 NC NC7 NC +12V8 NC OMR_Line_Fail 9 NC NC

Advanced Settings

Maintenance (UPS Details)ThisistheconnectorpinassignmentfortheUPSserialportontheTeraStation.

Page 61: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

61

Advanced Settings

Maintenance (Disk Sleep Function)

IfthereareregularperiodswhenyourTeraStationisnotinuse,youmaywanttoscheduledisksleeping.EnableDisk Sleep,selectthetimethatyouwanttoinitiatesleepmode,andselectthetimethatyouwanttheTeraStationto“wakeup”andresumenormaloperation.ClickApply...To.avoidconflicts,donotusetheDisk Sleep Function.concurrently.with.Disk Backup.

Page 62: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

6�

Advanced Settings

Maintenance (Shutdown)

FromtheShutdownpage,pressApply.to.shutdown.TeraStation...This.has.the.same.function.as.holdingdownthepowerbuttononthefrontofTeraStation,butmaybedoneremotely.

Page 63: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

6�

Advanced Settings

Maintenance (Initialization)

Pressing.Apply.for.Restore Defaults.from.Maintenance/Initialization.resets.Admin.Password,Hostname,TeraStationDescription,NTPSettings,WorkgroupSettings,AccessRestrictions,UserSettings,GroupSettings,MailNotifications,UPSSettings,DiskSleep,andDiskBackup.IfyouselecttheRemain.optionforAdmin Password.and.then.click.Apply,theadminpasswordwillnolongerberesetwhentheINITbuttonontheTeraStationis.held.down.

The.INITbuttonontherearofyourTeraStationnormallyreturnstheTeraStation.to.factory.settings.when.held.down.for.15.seconds...This.affects.AdminPassword,EthernetFrameSize,andIPAddress.IftheRemainoptionhasbeenselectedonthescreenbelow,thentheAdminPasswordwillnotberesetwhentheINITbuttonishelddown.

Page 64: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

6�

Advanced Settings

System Status (System Information)

ThispageshowsyoutheSystemInformationforyourTeraStation.

Page 65: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

65

Advanced Settings

System Status (USB Details)

ThispageshowsyoudetailsonUSBharddrivesandprinterspluggedintoyourTeraStation.

Page 66: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

66

Advanced Settings

System Status (Drive Properties)

ThispageshowsyouthepropertiesofallharddrivesandRAID.arrays.in.and.attached.to.your.TeraStation.

Page 67: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

67

Advanced Settings

System Status (Network Information)

ThispageshowsyoutheSystemInformationforyournetworkconnection.

Page 68: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

68

System Status

User Access Status

Thispageshowsyouthecurrentstatusofallusersonthesystem.

Page 69: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

6�

TeraStation Client Utility

This.is.the.TeraStation Client Utility...Installed.onyourPC,itallowsyoutoaccesseachoftheTeraStations. on. your.network.. .Click. Refresh List toget tabs foreachofyourTeraStations.EachtabshowstheHostName,Workgroup,IPAddress, andSubnetMaskof theassociatedTeraStation,aswellastheversionoffirmwareit’s.running.

WithaTeraStation’stabselected,youcanclickon.the.View Sharesbuttontogodirectlytoitsroot.share....Clicking.the.Setuppulldownmenuand.selecting.Browser Management. takes.you.tothebrowsermanagementtoolthatwebeganexploringonpage24.AndclickingSetup.and.choosing. Modify IP Address. takes. you. to. the.following.screen......

Page 70: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

70

TeraStation Client Utility

IP Address Setup

Here,youmayenteryourIP address.and.Subnet Maskmanually,orenableyourTeraStationtoacquirethemautomaticallyfromaDHCPserver.You’llneedtheadministratorpasswordtousethis.screen...Press.OK.when.you’re.done.

Page 71: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

71

. IfTeraStationencountersadiskerror,itwillbereportedinthe TeraStation statusonthetopofanyoftheWeb-Basedconfigurationscreens.Runa‘Normal’ Disk.Scan.in.the.event.of.this.error...If.thatdoesn’twork,tryrunninga ‘Thorough’DiskScan.Additionally,ifthatstilldoesnotresolvetheproblem,aformatisrecommended.Formattingthedrivewilldeleteallofthedataonitsobackupanydatayoucanbeforeformatting.Finally,ifnoneoftheabovesolutionshelp,thenpleasecontactTechnicalSupport(seepages81and82forTechnicalSupportcontactinformation).

Troubleshooting

DIAG LED codes:

Oneblinkeverysecond:RAIDArrayConfigurationisrunningnormally

Oneblinkeveryfourseconds:RAIDError

Fourblinkseveryfourseconds:InternalFanError

Fiveblinkseveryfourseconds:FlashROMError

Sixblinkseveryfourseconds:HardDriveError

Sevenblinkseveryfourseconds:RAM,LAN,orHDDControllerError

Page 72: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

7�

Troubleshooting

Should a Hard Drive Fail:

When using RAID1 or RAID5 - The failed drivewill have a red light blinking in theSTATUS/FULLpositionofthefrontdisplay.Ifyouneedtodeterminewhichdrivehasfailed,restarttheTeraStationandwatchwhichdiskLEDilluminatesred.Afterreplacingthefaileddrive,RAIDwillrestoreyourarray.

When using Standard Mode - The faileddrivewill have a red lightblinking in theSTATUS/FULLpositionofthefrontdisplay.Todeterminewhichdrivehasfailed,restarttheTeraStationandwatchwhichdiskLEDilluminatesred.Afterreplacingthefaileddrive,alldataonthatdrivewillbelost.Dataonotherdivesshouldstillbenormallyaccessable.

When using Spanning Mode - AlldriveswillhavearedlightblinkingintheSTATUS/FULLpositionofthefrontdisplay.Furthertroubleshootingwillberequiredtodeterminewhichdrivehasfailedinthearray.Datarecoveryisnotpossiblebyreplacingadrive.Afterreplacingthefaileddrive,youwillhavetodeleteandrecreateyourRAIDarraytomaketheTeraStationusableagain.Alldataonthearraywillbelost.

If your TeraStation is still under warranty, contact tech support before replacing your hard drive.Replacingyourharddriveyourselfmayvoidyourwarranty.Ifyourwarrantyhasexpired,youmayreplacetheharddrivewithanexactreplacement(availablefromBuffaloTechnology),orwithanyIDEdriveofatleastthesamecapacityasthefailedharddrive.

Page 73: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

7�

Replacing a Hard Drive

IfaSTATUS/FULLLEDisblinking,notethedrivenumberbeforecontinuing.Useaclean,paddedworkareatodissassembleyourTeraStation.You’llneeda#2phillipsscrewdriver. Youwillberemovingandreplacingatotalof22screwstoreplaceaharddrive,sokeepeachscrewthatyouremovecarefullyinasafeplace.BecarefulnottodroptheTeraStation,orcutyourselfonsharpinteriormetalparts.BuffaloTechnologyisnotresponsibleforanydamagethatyoudotoyourselforyourTeraStationwhilechangingoutaharddrive!Becareful.

1 Removeallcablesandplacetheunitonitstop,exposingthefourrubberfeet.

2Removetherubberfeet.Eachfootisheldinplacebyonescrew.

M3Screw6mm

Page 74: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

7�

Replacing a Hard Drive

3 Removethe3screwsfromtherearpanelasshown.

M3Screw4mm

4RemovethecoverbyslidingittowardstherearoftheTeraStation.

5Removethefrontpanelbyremovingthe4screwsonthesidesoftheTeraStationthatholditinplace.

M2.5Screw2.5mm

Page 75: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

75

Replacing a Hard Drive

6 UnpluganddetachtheLEDcableatthepointindicated.

7Removethethreescrewsfromthesidepanel.

M3Screw4mm

8Removetheindicatedscrewfromthebasepanel.

M3Screw6mm

Page 76: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

76

Replacing a Hard Drive

9 ThesidepanelcanbeopenedtowardsthefrontoftheTeraStation.

10Unplugthepowerandharddrivecablesfromthemotherboard.

11.Remove.the.three.screws.as.indicated.from.the.hard.drive.chassis.

M3Screw4mm

Page 77: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

77

Replacing a Hard Drive

12 Place the TeraStation on its base and slide out the hard drivechassis...

13Removethepowerplugsfromallfourharddrives.

Page 78: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

78

Replacing a Hard Drive

14 Remove.the.4.screws.from.the.sides.of.the.failed.hard.drive...Note.that.theharddrivechassisismarkedwithnumberscorrespondingtothedrivenumbersonthefrontdisplay.

. . ... 4mmHDscrew(notethatthethreadsarecoarserthan theM3screws;pleasedonotgetthemmixedup!)

15..Remove.the.failed.hard.drive.from.the.chassis...

16Installthereplacementharddrive.

Page 79: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

7�

Replacing a Hard Drive

17 Reassemblyisthereverseofdissassembly.

.

18ReconnectcablesandpowertoyourTeraStation.

19LogintotheTeraStation’sWeb-basedconfigurationtool.

20Clicktheerrorlinkonthefirstpageofthemanagementinterface.

21FollowthestepsshowninthemanagertorebuildtheRAIDArray.

TheTeraStationshouldnowbebackinthestateitwaspriortotheharddrivefailure.IfyouwereusingRAID5orRAID1,yourdatashouldberestored.

Page 80: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

80

Technical Specifications

LANStandards: IEEE802.3u100BASE-TX;IEEE802.310BASE-T

TransmissionTypes: 1000Mbps/100Mbps/10Mbps;100BASE-TX

4B/5B,MLT-3;10BASE-TManchesterCoding

AccessMedia: CSMA/CD

MediaInterface: RJ-45

USBStandard: USB2.0 Hi-Speed(HS) Full-Speed(FS) Low-Speed(LS)

USBConnector: USBAConnector(4)

DataTransmissionSpeed: Max:480Mbps(HSMode) Max:12Mbps(FSMode)

UPS: UPSCompatible(Serialportconnection)

PowerConsumption: 17WMaximum

Dimensions: 6.6”x8.7”x9.5”(168x221x241mm.)

Weight: 15.8lb.(7.2kg.)

OperatingEnvironment: 32°-95°F;20-80%non-condensing

Page 81: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

81

Contact Information (North America)

BuffaloTechnologyUSAInc.4030WestBrakerLane,Suite120Austin,TX78759-5319

GENERAL INQUIRIES MondaythroughFriday8:30am-5:30pmCSTDirect:512-794-8533|Toll-free:800-456-9799|Fax:512-794-8520|Email: [email protected]

TECHNICAL SUPPORT NorthAmericanTechnicalSupportbyphoneisavailable24hoursaday,7daysaweek.(USAand.Canada)..Toll-free: (866)752-6210|Email:[email protected].

Page 82: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

8�

BuffaloTechnologyUKLtd.176BuckinghamAvenue,Slough,Berkshire,SL14RDUnitedKingdom

GENERAL INQUIRIES Email:[email protected]

TECHNICAL SUPPORT Phone(UKonly):08712501260*Phone:+35361708050Email:[email protected]*Callscost8.5pperminute

TechnicalSupportOperatingHoursMonday-Friday(GMT)9:00AM-6:00PMMonday-Thursday9:00AM-4:30PMFriday

Contact Information (Europe)

Page 83: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

8�

ThankyouforyourinterestinBuffaloproducts.OurGPLsoftwaredeliverypolicyisoutlinedbelow.

Foreachindividualproductandrevision,pleasesendoneindividuallypackagedselfaddressedpaddedCDshippingenvelope,containingablankCD-Rtothefollowingaddress:

Buffalo Technology USA Inc.4030 W. Braker Lane Suite 120Austin, TX 78759Attn. GPL Department

WithintheenvelopecontainingtheselfaddressedpaddedCDshippingenvelope,pleaseincludeabankdraftormoneyorderfor$20(USD)(Madeoutto:BuffaloTechnology)tocoverourhandlingfee,postageandCDpreparation.TheCD-Rshouldhavethenameoftheproductandrevisionnumberclearlywrittenontheactual.CD-R.(not.on.the.insert).

WedonotsendGPLsourceinbulkonaDVD.AndorderconfirmationisnotrequiredbytheGNUGeneralPublicLicense.

Wearemorethanhappytocomplywithyourrequest;however,wemustaskyoutocomplywithourGPLdistributionpolicy,whichcomplieswiththeGNUGeneralPublicLicense.

Sincerely,BuffaloTechnologyGPLDepartment

GPL Information (North America)

Page 84: User Manual TeraStation HS-DTGL/R5… · on your TeraStation; see page 16 for more information. Note: If this page does not appear, or if you receive a popup window from your firewall

8�

ThankyouforyourinterestinBuffaloproducts.OurGPLsoftwaredeliverypolicyisoutlinedbelow.

Foreachindividualproductandrevision,pleasesendoneindividuallypackagedselfaddressedpaddedCDshippingenvelope,containingablankCD-Rtothefollowingaddress:

Buffalo Technology Ireland LtdFree Zone East, Shannon, Co. ClareIrelandAttn. GPL Department

WithintheenvelopecontainingtheselfaddressedpaddedCDshippingenvelope,pleaseincludeabankdraftormoneyorderfor€20(Euro)(Madeoutto:BuffaloTechnology)tocoverourhandlingfee,postageandCDpreparation.TheCD-Rshouldhavethenameoftheproductandrevisionnumberclearlywrittenontheactual.CD-R.(not.on.the.insert).

WedonotsendGPLsourceinbulkonaDVD.AndorderconfirmationisnotrequiredbytheGNUGeneralPublicLicense.

Wearemorethanhappytocomplywithyourrequest;however,wemustaskyoutocomplywithourGPLdistributionpolicy,whichcomplieswiththeGNUGeneralPublicLicense.

Sincerely,BuffaloTechnologyGPLDepartment

GPL Information (Europe)