Also available:
Del M
errick
Targeting Spelling
The ultimate resource for teaching spelling
Del Merrick
Student disk:
10 fun spelling
games for Year 6
students written to
support this program
Teacher disk:
hands-on activity cards,
assessment records,
Word Warm-Ups booklet
and all worksheets
Blake’s
10 fun games suitable for PC & Mac
© 2010 PASCAL PRESS. ALL RIGHTS RESERVED. www.pascalpresss.com.au
disk
6ages11–12
To open PC : will run automatically. MAC : click on disk icon. Installation instructions are on the disk.
SpellingspellingGamesGames
photocopiable
spelling reference
for each student
© 2015 BLAKE EDUCATION. ALL RIGHTS RESERVED. PENALTIES fOR UNAUTHORIzED COPyING IN
CLUDE A
$50,
000
fINE
INSTALLATION WINDOWS 1. Put disk in CD-ROM drive and it should begin automatically.
2. If it does not run then open Windows Explorer, navigate to the CD-ROM and double click the TGT_Spell_Yr_6 icon.
MAC Put disk in CD-ROM drive and double click TGT_Spell_Yr_6 icon.
SOFTWARE REQUIREMENTS WINDOWS & MAC Adobe Acrobat Reader, Microsoft Office Excel,
Microsoft Office Word.
Targeting
YEAR
6TeACher
DISk
★ Acomprehensiveintroductionfromtheauthorexplaininghowtousetheprogramanditsvariouselementstoachieveoutstandingresults
★ 32weeklylesson planswithteachingnotesandphotocopiableworksheets
★ AphotocopiableWord Warm-Ups bookletforusebyeachstudentthroughouttheyear
★ ABlake’s Spelling Games CD-ROMwith10spellinggameswrittentosupporttheprogram
★ ATargeting Spelling CD-ROM–withphotocopiablewordcardsforhands-onactivities,games,assessmentrecordkeeping,PencilWorkandSpellingCornercards.
★ BOARD WORk—developingconceptsthroughexplicitteachinganddemonstration
★ BOOk WORk—usingthewordlistsintheWordWarm-Upsbookletasafocusforlearning
★ WORD WORk —exploringworduse,wordbuildingandassociatedrules
★ MeMORy WORk —providinghelptostudentstomemorisesightwords
★ PenCil WORk —photocopiableworksheetsandSpellingCornercardstoenablestudentstoapplytheskillsandstrategiestheyhavebeenlearning
★ PRACTiCe WORk —usinghands-onmaterialsandspellinggamestoconsolidateandbuildskills
★ ASSeSSMenT —dictationofwordsandsentencesusingtheweek’sfocuslist.
This book contains:
each weekly lesson plan contains the following elements:
includesAustralian Curriculum correlations
is a whole-school spelling program that has been developed and trialled
in classrooms over many years with outstanding results. It can be used equally successfully by individual teachers and will provide students
with a solid foundation in spelling.
Targeting Spelling
Targetingyear 6
yea
r 6
TargetingSpelling
Targeting Spelling
Del Merrick
Year 6
First published 2015 byBlake Education Pty LtdABN 50 074 266 023108 Main RdClayton South VIC 3169www.blake.com.au
Targeting Spelling Year 6Copyright © Blake Education 2015ISBN 9781 921852 992
Author: Del MerrickPublisher: Lynn DickinsonEditor: Kerry Davies AETypesetter: Ruth SchultzDesign and illustration: Janice Bowles
Copying of this book for educational purposesThe purchasing educational institution may only photocopy pages within this book in accordance with The Australian Copyright Act 1968 (the Act) and provided the educational institution (or body that administers it) has given a remuneration notice to the Copyright Agency Limited (CAL) under the Act. It is a breach of copyright to scan or in any other way make digital copies of the worksheets.
It is mandatory that ALL photocopies are recorded by the institution for CAL survey purposes.
Copyright Agency LimitedLevel 15, 233 Castlereagh StreetSydney NSW 2000Telephone: (02) 9394 7600
The purchasing educational institution may store this book on a retrieval system only in accordance with the terms of the User Agreement printed on the inside back cover of this title.
© Australian Curriculum, Assessment and Reporting Authority 2010. This is a modified extract from the Australian Curriculum. ACARA neither endorses nor verifies the accuracy of the information provided and accepts no responsibility for incomplete or inaccurate information. You can find the unaltered and most up to date version of this material at http://www.australiancurriculum.edu.au/Home
This modified material is reproduced with the permission of ACARA.
TargetingSpelling
Targeting Spelling
Del Merrick
Year 6
First published 2015 byBlake Education Pty LtdABN 50 074 266 023108 Main RdClayton South VIC 3169www.blake.com.au
Targeting Spelling Year 6Copyright © Blake Education 2015ISBN 9781 921852 992
Author: Del MerrickPublisher: Lynn DickinsonEditor: Kerry Davies AETypesetter: Ruth SchultzDesign and illustration: Janice Bowles
Copying of this book for educational purposesThe purchasing educational institution may only photocopy pages within this book in accordance with The Australian Copyright Act 1968 (the Act) and provided the educational institution (or body that administers it) has given a remuneration notice to the Copyright Agency Limited (CAL) under the Act. It is a breach of copyright to scan or in any other way make digital copies of the worksheets.
It is mandatory that ALL photocopies are recorded by the institution for CAL survey purposes.
Copyright Agency LimitedLevel 15, 233 Castlereagh StreetSydney NSW 2000Telephone: (02) 9394 7600
The purchasing educational institution may store this book on a retrieval system only in accordance with the terms of the User Agreement printed on the inside back cover of this title.
© Australian Curriculum, Assessment and Reporting Authority 2010. This is a modified extract from the Australian Curriculum. ACARA neither endorses nor verifies the accuracy of the information provided and accepts no responsibility for incomplete or inaccurate information. You can find the unaltered and most up to date version of this material at http://www.australiancurriculum.edu.au/Home
This modified material is reproduced with the permission of ACARA.
978 1 76020 308 5 978-1-76020-452-5
Contents ContentsTargeting Spelling program overview ivIntroduction viWhat students need to know about spelling viiiHow students learn spelling 1About Targeting Spelling 2Year 6 overview 3Using the Word Warm-ups 4Areas of work 4A word about assessment 8 Weekly overview of teaching and learning procedures 9
Targeting Spelling ideas 10
Assessment 11Start-of-year checkpoints 12Start-of-year student response sheet 13Weekly assessment teacher data sheet 14Term assessment 15Term assessment student response sheets 16–19Term assessment teacher data sheet 20End-of-year checkpoints 21End-of-year student response sheet 22Start-of-year and end-of-year checkpoints teacher data sheet 23Lessons 1–32 24Answers 152
Word Warm-ups book Suffixes Compound Words Compound Words 1 (short vowels) Compound Words 2 (final e words)
Compound Words 3 (letter teams) Contractions Homophones
Assessment Start-of-year checkpoints Start-of-year student response sheet Weekly assessment teacher data sheet Term assessment Term assessment student response sheets Term assessment teacher data sheet End-of-year checkpoints End-of-year student response sheet Start-of-year and end-of-year checkpoints teacher data sheet Auditory discrimination test Pencil Work worksheets Spelling Corner activities Answers
CD Contents
iv v Targeting Spelling Year 6 © 2015 Blake Education
Targeting Spelling program overview Highlighted topics indicate concepts that need to be introduced at these levels.
LeSSon YeAr 1 YeAr 2 YeAr 3 YeAr 4 YeAr 5 YeAr 6
Term one
1 Short vowel a, CVC words
Short vowel a Adding s
Short vowelsPlural endings
Reviewing short vowels
Reviewing short vowels Prefixes in–, im–
2Short vowel e, CVC wordsAdding s
Short vowel eShort vowelsDoubling rule
Reviewing long vowels
Closed syllablesCommon endings, suffixes
Prefix dis–
3 Short vowel i, CVC words
Short vowel iDoubling rule
Short vowels Letter teams for the sound of a
Final e words, prefix a–
The e ruleSilent k, g, w
4 Short vowel o, CVC words Short vowel o Short vowels
SyllablesLetter teams for the sound of e Open syllables Prefixes ob–, per–
5 Short vowel u, CVC words Short vowel u
Long vowelsThe e rule
Letter teams for the sound of o Suffix –ic Prefix de–
6 Final consonant digraph ck
Consonant digraphs sh, ch
Adding ly Long vowels Letter teams for the
sound of i Soft c and g Prefixes inter–, trans–
7Initial or final digraphs sh, ch
Adding s, es
Schwa sound (mother)
Long vowelsopen syllables
Letter teams for the sound of oo (oo, ew)
Words ending in a, ar (schwa) Prefixes com–, con–
8 Initial or final digraph th
Compound words (short vowel elements)
Contractions Letter teams ou, ow Words ending in ymitto or missus (I send)pes or pedis (foot)
Term TWo
9 Initial blends br, grLong vowel a (came)The e rule
Letter teams ai, ay
Common endings Letter teams au, aw, oar, ore Hard and soft ch Verb suffixes –ate,
–ise
10 Initial blends fr, dr Long vowel i (time)Letter teams ee, eer
Compound words Tricky letter a
Words ending in ss
Prefixes and suffixes
Words ending in o
11 Initial blends pr, tr, cr Long vowel o (bone) Letter teams ea, ear More tricky letters Words beginning with e Suffix –fy
12 Initial blends pl, fl Long vowel u (cube) Letter teams oa, ow Letter teams er, ir, ur Words beginning with a, ad Soft g, c
13 Initial blends bl, glCompound words (long vowel elements)
Letter team oo (book)
Letter team er (schwa) Suffixes –ful, –less Suffixes –or, –ar
14 Initial blends sl, cl Nouns ending in yThe y rule
Letter team oo (moon)
Letter team ea (bread) Prefixes ex–, out– Suffix –ive, prefixes
mono–, bi–, micro–
15 Initial blends st, sm Patterns igh (high), y (my)
Letter team oo (moon) Letter teams ge, dge Suffix –al, words
ending in –el Prefixes e–, ex–
16 Initial blends sp, sn Contractions Letter team ar Letter teams ie, ei Compound words Prefix en–
LeSSon YeAr 1 YeAr 2 YeAr 3 YeAr 4 YeAr 5 YeAr 6Term THree
17 Final double letters ss
Letter team ai (rain)Compound words, syllables
Letter team ir (bird)Closed syllables –end syllables et, en, le
Words ending in id, ide Prefix re–
18 Final double letters ll Letter team ai (grain) Letter team er (her) Open syllables Words ending in
ect, ict Suffix –ion
19 Final consonant blend st Letter team ay (day) Letter team ur (turn)
Words ending in yThe y rulePrefixes and suffixes
Words ending in age Prefixes pre–, pro–
20Final consonant digraph ng
Adding s, ing
Letter team ee (see)Homophones
Letter teams or, ore, oar
Homophones Silent k, w Suffixes –er, –or
duco or ductus (I lead)
cedo or cessus (I go)
21 Final consonant digraph ng Letter team ee (steel) Letter team ou
(cloud) Silent b, t Suffix –ly Suffix –al
22 Final consonant digraph nd
Letter team ea (sea)The f to v rule
Letter team ow (cow) Letter teams oi, oy Prefixes pre–, pro–The y soundThe y rule
23 Final consonant digraph nt
Letter team ea (cream) Letter teams ou, ow Letter teams air,
are, ear
Letter pair qu
Common endings, affixes
Letter teams hy, sy
24 Final consonant digraph nk
Words ending in leCommon endings
Letter team aw (saw)Prefixes a–, al–
Antonyms, suffixes Prefix en–, suffix –en Prefix ab–, letter
team acc
Term four
25 Final consonant blend mp Letter team oa (coat) Letter team au
(sauce) Letter teams gu, qu Prefixes mis–, dis– Suffixes –ious, –ous
26 Final consonant blends ft, ff
Letter team oa (croak) Letter teams oy, oi
Endings el, al
Parts of speechSuffix –ion Prefix dia–, suffix –ile
27Final consonant blend tch
Adding s, ing, ed
Letter team ow (snow)Irregular past-tense verbs, antonyms
Letter teams are (care), air
Visual letter pattern ough
Parts of speechPrefixes in–, im–
Suffixes –able, –ible
Antonyms
28 Final consonant blend nch Letter team ar (car)
Words ending in yThe y rule
Letter teams th, wh, ph
Suffixes –ment, –ness
Letter teams –ure, –ude
29 Final consonant blend nd Letter team ar (start) Reviewing
contractions Prefixes up–, down– Words ending in our, suffix –ous Letter teams qu, ph
30 Final consonant blends lf, sp, sk
Letter teams or, ore (for, fore)
Reviewing compound words
Prefixes over–, under– Suffixes –able, –ible Suffixes –ian, –ial
31 Final y (my) Two-syllable words Prefixes un–, dis– Prefixes re–, de– Prefixes re–, de– Suffixes –ent, –ant
32 Visual letter pattern igh Homophones Suffixes –ful, –less Suffix –ion Prefixes con–, com– Suffixes –ence, –ance
ISBN 978 1 76020 452 5
iv v Targeting Spelling Year 6 © 2015 Blake Education
Targeting Spelling program overview Highlighted topics indicate concepts that need to be introduced at these levels.
LeSSon YeAr 1 YeAr 2 YeAr 3 YeAr 4 YeAr 5 YeAr 6
Term one
1 Short vowel a, CVC words
Short vowel a Adding s
Short vowelsPlural endings
Reviewing short vowels
Reviewing short vowels Prefixes in–, im–
2Short vowel e, CVC wordsAdding s
Short vowel eShort vowelsDoubling rule
Reviewing long vowels
Closed syllablesCommon endings, suffixes
Prefix dis–
3 Short vowel i, CVC words
Short vowel iDoubling rule
Short vowels Letter teams for the sound of a
Final e words, prefix a–
The e ruleSilent k, g, w
4 Short vowel o, CVC words Short vowel o Short vowels
SyllablesLetter teams for the sound of e Open syllables Prefixes ob–, per–
5 Short vowel u, CVC words Short vowel u
Long vowelsThe e rule
Letter teams for the sound of o Suffix –ic Prefix de–
6 Final consonant digraph ck
Consonant digraphs sh, ch
Adding ly Long vowels Letter teams for the
sound of i Soft c and g Prefixes inter–, trans–
7Initial or final digraphs sh, ch
Adding s, es
Schwa sound (mother)
Long vowelsopen syllables
Letter teams for the sound of oo (oo, ew)
Words ending in a, ar (schwa) Prefixes com–, con–
8 Initial or final digraph th
Compound words (short vowel elements)
Contractions Letter teams ou, ow Words ending in ymitto or missus (I send)pes or pedis (foot)
Term TWo
9 Initial blends br, grLong vowel a (came)The e rule
Letter teams ai, ay
Common endings Letter teams au, aw, oar, ore Hard and soft ch Verb suffixes –ate,
–ise
10 Initial blends fr, dr Long vowel i (time)Letter teams ee, eer
Compound words Tricky letter a
Words ending in ss
Prefixes and suffixes
Words ending in o
11 Initial blends pr, tr, cr Long vowel o (bone) Letter teams ea, ear More tricky letters Words beginning with e Suffix –fy
12 Initial blends pl, fl Long vowel u (cube) Letter teams oa, ow Letter teams er, ir, ur Words beginning with a, ad Soft g, c
13 Initial blends bl, glCompound words (long vowel elements)
Letter team oo (book)
Letter team er (schwa) Suffixes –ful, –less Suffixes –or, –ar
14 Initial blends sl, cl Nouns ending in yThe y rule
Letter team oo (moon)
Letter team ea (bread) Prefixes ex–, out– Suffix –ive, prefixes
mono–, bi–, micro–
15 Initial blends st, sm Patterns igh (high), y (my)
Letter team oo (moon) Letter teams ge, dge Suffix –al, words
ending in –el Prefixes e–, ex–
16 Initial blends sp, sn Contractions Letter team ar Letter teams ie, ei Compound words Prefix en–
ISBN 978 1 76020 452 5
iv v Targeting Spelling Year 6 © 2015 Blake Education
Targeting Spelling program overview Highlighted topics indicate concepts that need to be introduced at these levels.
LeSSon YeAr 1 YeAr 2 YeAr 3 YeAr 4 YeAr 5 YeAr 6
Term one
1 Short vowel a, CVC words
Short vowel a Adding s
Short vowelsPlural endings
Reviewing short vowels
Reviewing short vowels Prefixes in–, im–
2Short vowel e, CVC wordsAdding s
Short vowel eShort vowelsDoubling rule
Reviewing long vowels
Closed syllablesCommon endings, suffixes
Prefix dis–
3 Short vowel i, CVC words
Short vowel iDoubling rule
Short vowels Letter teams for the sound of a
Final e words, prefix a–
The e ruleSilent k, g, w
4 Short vowel o, CVC words Short vowel o Short vowels
SyllablesLetter teams for the sound of e Open syllables Prefixes ob–, per–
5 Short vowel u, CVC words Short vowel u
Long vowelsThe e rule
Letter teams for the sound of o Suffix –ic Prefix de–
6 Final consonant digraph ck
Consonant digraphs sh, ch
Adding ly Long vowels Letter teams for the
sound of i Soft c and g Prefixes inter–, trans–
7Initial or final digraphs sh, ch
Adding s, es
Schwa sound (mother)
Long vowelsopen syllables
Letter teams for the sound of oo (oo, ew)
Words ending in a, ar (schwa) Prefixes com–, con–
8 Initial or final digraph th
Compound words (short vowel elements)
Contractions Letter teams ou, ow Words ending in ymitto or missus (I send)pes or pedis (foot)
Term TWo
9 Initial blends br, grLong vowel a (came)The e rule
Letter teams ai, ay
Common endings Letter teams au, aw, oar, ore Hard and soft ch Verb suffixes –ate,
–ise
10 Initial blends fr, dr Long vowel i (time)Letter teams ee, eer
Compound words Tricky letter a
Words ending in ss
Prefixes and suffixes
Words ending in o
11 Initial blends pr, tr, cr Long vowel o (bone) Letter teams ea, ear More tricky letters Words beginning with e Suffix –fy
12 Initial blends pl, fl Long vowel u (cube) Letter teams oa, ow Letter teams er, ir, ur Words beginning with a, ad Soft g, c
13 Initial blends bl, glCompound words (long vowel elements)
Letter team oo (book)
Letter team er (schwa) Suffixes –ful, –less Suffixes –or, –ar
14 Initial blends sl, cl Nouns ending in yThe y rule
Letter team oo (moon)
Letter team ea (bread) Prefixes ex–, out– Suffix –ive, prefixes
mono–, bi–, micro–
15 Initial blends st, sm Patterns igh (high), y (my)
Letter team oo (moon) Letter teams ge, dge Suffix –al, words
ending in –el Prefixes e–, ex–
16 Initial blends sp, sn Contractions Letter team ar Letter teams ie, ei Compound words Prefix en–
LeSSon YeAr 1 YeAr 2 YeAr 3 YeAr 4 YeAr 5 YeAr 6Term THree
17 Final double letters ss
Letter team ai (rain)Compound words, syllables
Letter team ir (bird)Closed syllables –end syllables et, en, le
Words ending in id, ide Prefix re–
18 Final double letters ll Letter team ai (grain) Letter team er (her) Open syllables Words ending in
ect, ict Suffix –ion
19 Final consonant blend st Letter team ay (day) Letter team ur (turn)
Words ending in yThe y rulePrefixes and suffixes
Words ending in age Prefixes pre–, pro–
20Final consonant digraph ng
Adding s, ing
Letter team ee (see)Homophones
Letter teams or, ore, oar
Homophones Silent k, w Suffixes –er, –or
duco or ductus (I lead)
cedo or cessus (I go)
21 Final consonant digraph ng Letter team ee (steel) Letter team ou
(cloud) Silent b, t Suffix –ly Suffix –al
22 Final consonant digraph nd
Letter team ea (sea)The f to v rule
Letter team ow (cow) Letter teams oi, oy Prefixes pre–, pro–The y soundThe y rule
23 Final consonant digraph nt
Letter team ea (cream) Letter teams ou, ow Letter teams air,
are, ear
Letter pair qu
Common endings, affixes
Letter teams hy, sy
24 Final consonant digraph nk
Words ending in leCommon endings
Letter team aw (saw)Prefixes a–, al–
Antonyms, suffixes Prefix en–, suffix –en Prefix ab–, letter
team acc
Term four
25 Final consonant blend mp Letter team oa (coat) Letter team au
(sauce) Letter teams gu, qu Prefixes mis–, dis– Suffixes –ious, –ous
26 Final consonant blends ft, ff
Letter team oa (croak) Letter teams oy, oi
Endings el, al
Parts of speechSuffix –ion Prefix dia–, suffix –ile
27Final consonant blend tch
Adding s, ing, ed
Letter team ow (snow)Irregular past-tense verbs, antonyms
Letter teams are (care), air
Visual letter pattern ough
Parts of speechPrefixes in–, im–
Suffixes –able, –ible
Antonyms
28 Final consonant blend nch Letter team ar (car)
Words ending in yThe y rule
Letter teams th, wh, ph
Suffixes –ment, –ness
Letter teams –ure, –ude
29 Final consonant blend nd Letter team ar (start) Reviewing
contractions Prefixes up–, down– Words ending in our, suffix –ous Letter teams qu, ph
30 Final consonant blends lf, sp, sk
Letter teams or, ore (for, fore)
Reviewing compound words
Prefixes over–, under– Suffixes –able, –ible Suffixes –ian, –ial
31 Final y (my) Two-syllable words Prefixes un–, dis– Prefixes re–, de– Prefixes re–, de– Suffixes –ent, –ant
32 Visual letter pattern igh Homophones Suffixes –ful, –less Suffix –ion Prefixes con–, com– Suffixes –ence, –ance
ISBN 978 1 76020 452 5
vi vii Targeting Spelling Year 6 © 2015 Blake Education
IntroductionInTroDuCTIon
We communicate with each other through our language, both spoken and written.
Spoken language is strongly supported by our facial expressions, gestures and the way we move our bodies. We often replace the need for words with this “body” language. We frown in displeasure, smile our agreement, raise an eyebrow in question; we point, nod our heads, draw “pictures” with our hands, give a thumbs-up or a thumbs-down; we shrug our shoulders, fold our arms, stamp a foot and thrust our hands on our hips. Body language is highly eloquent and conveys much of the meaning behind our words.
In two-way conversation, we frequently omit words because we share contexts and understandings and we can fill in the gaps with our body language. one-way communication requires us to choose our words more carefully and speak in complete sentences. We need to be mindful of our audience, their level of understanding and the degree of formality required.
Written language is far more demanding than spoken language. Writing for an “absent” audience demands that we frame our ideas into complete sentences; we write them down legibly and correctly; and we add punctuation marks to guide the reader through what we want to say. We capitalise the first word of each sentence, as well as the names of people, places, days and special events. We end each sentence with a full stop, a question mark or an exclamation mark. We place speech marks around the spoken words of characters. We use apostrophes to indicate contractions and ownership. And, importantly, we spell each word in a standard and expected way, so that the reader immediately knows what we are writing about.
The spelling of words should never get in the way of writing. Writers who struggle with the spelling of words often lose track of what they are writing. They leave words out or circumvent words they can’t spell. They tend to ramble and omit punctuation marks as the business of encoding words leaves no room in their working memory. They rarely go back to edit or proofread what they have written.
As a writer, we can only draw on the words in our heads. We are constantly expanding this pool of words that we know and, ideally, can spell.
■ So what is spelling? Spelling is the ability to encode the words we choose to write. It is our ability to retrieve, correctly, the words chosen from our mind pool. It requires us to remember a correct sequence of letters and frequently requires us to add to or make changes to these letters to make our writing grammatically correct.
To remember these words, we need to learn the correct order of the letters. This is often very easy. For example, one of the first words children know how to spell is their name. The word is meaningful and the sequence of letters is familiar. Words like it, is, on, at and to are usually very easy for children to learn. But there are many words that writers will need to save on the “memory stick” in their heads, ready for easy retrieval.
ISBN 978 1 76020 452 5
vi vii Targeting Spelling Year 6 © 2015 Blake Education
Hence, writers need an effective and efficient means of learning how to spell the words they need. The methods will vary from writer to writer but, generally, they will employ the use of their senses as learning channels.
Vocal–auditory How a word sounds to the ear when it is spoken. Each lip movement represents a different chunk of sound (syllable). We use this vocal–auditory channel frequently to monitor words as we write them.
“Say the word you want to write and write what you say.”
Visual How a word “looks” – its shape, its length, the pattern of its letters.
Kinesthetic How a word is formed under our fingers as it runs off the end of the pencil. Writing the same word over and over again builds strong muscle memory. Spelling becomes a familiar action of the hand. It’s as if words automatically roll off the pencil onto the page.
These memories all work together to build a spelling “sense”.
Added to these perceptions about words, writers also conceptualise how words change to “fit” the grammar of the text they are writing. For example, different tenses require changes to the verb, most often by the addition of s, ing or ed; plurals require the addition of s or es; and contractions require a collapsed version of two words and the use of an apostrophe. While prefixes change word meaning, suffixes create many nouns, verbs, adjectives and adverbs.
This understanding of how grammar strongly influences the spelling of words is vital for all writers.
Writers also benefit from an understanding of the origin of words. Some come directly from other languages – words like pyjamas, spaghetti, croissant, pagoda and geyser. Some have only just entered our language – words like digital, byte, broadband, online and multimedia. Many of the words we use day to day have Latin or Greek roots. These “roots” generate a cluster of meaning-related words and, as such, provide a useful basis for learning. For example: struo, structus – I build, generates the words construct, construction, constructive, destruct, destruction, destructive, indestructible, structure, structural, structurally, instruct, instruction, instructor …
As teachers, we support our young writers by building
sound knowledge in four main areas:
1 Phonological: how words sound
2 Visual: how words look
3 Morphemic: how words change form for
grammatical reasons
4 Etymological: how words grow from Latin or Greek
roots or other origins.
I just know how to write it AND
I just know it looks right!
ISBN 978 1 76020 452 5
viii 1 Targeting Spelling Year 6 © 2015 Blake Education
What students need to know about spelling
Students need to know:• the names of the letters
of the alphabet • the sounds they
represent• consonants, e.g. b, f, s, l,
m, r, w • consonant blends, e.g.
br, fl, st, pr, sm, tw, gl• consonant digraphs
(buddies), e.g. ch, sh, ph, th
• that short vowels have a short, snappy sound – a, e, i, o, u
• that long vowels say their own name – a, e, i, o, u
• vowel controllers, e.g. final e, the letter r
• vowel teams, e.g. ai, oa, ou
• silent letters, e.g. knit, write, listen.
Students need to apply what they know to:• blend sounds to form a
word, e.g. b-a-t = bat; ch-ie-f = chief
• blend sound “chunks” into words (syllables), e.g. croc-o-dile = crocodile
• understand rhyming patterns, e.g. my, by, try, fly.
Students need to know:• that many English words
are derived from Latin and Greek roots
• that words are related in meaning through their root (e.g. the Latin word medicina gives rise to the words medicine, medical, medicinal, remedy, paramedic)
• that words have their origins in many different languages
• that we use many foreign words in our day-to-day language,
e.g. pizza, pyjamas, spaghetti, tabouli, croissant
• that the spelling of words is constantly evolving, e.g. yoghurt – yogurt, encyclopaedia – encyclopedia
• that new words are constantly being invented, e.g. megabyte, digital, while others have become obsolete or are rarely used, e.g. erstwhile, nickelodeon.
Students need to know:• how compound words
are constructed• that words are often built
from a “base” word
• that the most common endings are s, es, ing, ed, y, ly, er, est
• when to double a letter before adding an ending
PHonoLogICAL knowledgeHow words sound❂1
eTYmoLogICAL knowledgeHow words grow from a “root” word❂4
Students need to:• recall the appearance of
a word• “visualise” a word• remember what letters
look like and know how to write them
• identify little words in big words
• recognise words as compound words
• recognise contractions
• recognise visual rhyme, e.g. heard, beard
• recognise visual patterns, e.g. tough, cough, bough, through
• understand that letters can be grouped in certain ways, e.g. b can be followed by any vowel, but only by the consonants l and r
• recognise when a word “looks right”.
VISuAL knowledgeHow words look❂2
morPHemIC knowledgeHow words change form❂3
• when to change the y on the end of a word before adding an ending
• how to form plurals and apply the associated rules (words ending in y and f)
• how to form past tense, regular and irregular
• how to form verbal adjectives and present participles by adding ing (e.g. dancing, walking) and past participles
• how to make comparative adjectives and adverbs by adding er and est (e.g. bigger, biggest; higher, highest)
• that prefixes and suffixes are constant in their spelling
• that prefixes alter the meaning of the base word
• that suffixes alter the way a word is used, i.e. its grammar
• that suffixes can be noun-forming, e.g. –tion, verb-forming, e.g. –ate, adjective-forming, e.g. –ive, or adverb-forming, e.g. –ly
• when to use capital letters
• when to use apostrophes, for contractions and possessive nouns
• how to analyse and understand contractions, e.g. don’t = do not
• how to understand abbreviations
• how to understand acronyms, e.g. Qantas, Anzac.
ISBN 978 1 76020 452 5
viii 1 Targeting Spelling Year 6 © 2015 Blake Education
How students learn spelling
AuDITorY How it sounds• Listen to the word
– count the chunks (syllables).
• Listen to the different sounds made by letters or letter groups, e.g. voiced or unvoiced; hard or soft; schwa.
• Listen carefully to the correct pronunciation of a word.
VoCAL How you say it• Say it in slow
motion.• Stretch the word
out like chewing gum as you say it, and then snap it back together.
• Clap or tap the chunks (syllables) as you say them.
• Notice the position of the sound in your mouth (teeth, tongue, lips, throat), e.g. girl, giant; three, free.
• Take care with the way you pronounce the word, e.g. library not liberry; pumpkin not punkin.
• Always sound the ends of your words clearly.
VISuAL How it looks• Find and cut out
words from a magazine to paste in your book.
• Close your eyes and “see” the word. (Now write it from your memory.)
• Create a word picture of your word.
• Draw a line around the word to show the shape of the word.
• Count the chunks in the word (syllables). Write each syllable in a box.
• Look for the “hard” part of the word. Perhaps write the “hard” part in capital letters, e.g. hoRse, hoUse, neverTHEless.
KIneSTHeTIC How it feels to write it (muscle memory)• Write it on your
partner’s back for them to guess what it is.
• Write it in the air.• Write it with
different writing tools – nikko, chalk, gel pen, glitter pen.
• Write the word. Write over it in four different colours.
• Write the word in big letters (not capitals) on a blackboard or whiteboard.
• Use a timer. Set the timer for three minutes. See how many words you can write before time runs out.
TACTILe How the letter shapes feel• Do some rainbow
writing (go round the letter shapes of the word in different colours).
• Make the word with letter tiles.
• Write the word on graph paper, one letter per square.
• Create a spellamadoodle – write the words in a list around a shape, e.g. tree, truck, ball, basket.
• Feel the shape of the letters as you write the word in the sand.
• Trace over felt letters or letters written on sandpaper.
• Write the word with a wet brush.
Children receive a lot of information about spelling through their senses – sight, hearing and touch. Many have preferred ways of learning. For example, some may prefer to learn spelling by seeing the words and writing them several times; others may prefer to say the words and
spell them aloud letter by letter. To strengthen learning, spelling activities need to be designed or selected to cater for children’s different learning styles. Here are some ideas for tapping into the various modes of learning:
Good spelling ultimately relies on visual and muscle
memory.
ISBN 978 1 76020 452 5
2 3 Targeting Spelling Year 6 © 2015 Blake Education
About Targeting Spelling Targeting Spelling is a simple but highly effective approach to the teaching of spelling. It is based on the belief that spelling needs to be taught in an explicit and systematic way. It is designed to help students learn the skills and strategies they need to become proficient spellers. The content is carefully structured and sequenced, so that students can build their phonological, visual, morphemic and etymological knowledge. There are many opportunities for students to practise their skills through the manipulative materials provided on the accompanying CD. Spelling is not just about memorising words. It is a feature of writing and, as such, is strongly influenced by grammar. As we construct our sentences, we are constantly making decisions about what words to use and how to alter their spelling to fit the grammar. Verb tenses, plural and proper nouns, ownership, the informality of contractions and subject–verb agreement often require structural changes and therefore spelling changes. Students need to learn how to make these changes in the spelling of words and any rules that govern these changes. It is ideal to teach these grammatical changes to words early in spelling development while the words are still simple and, generally, phonically regular.Targeting Spelling Years 1–5 enabled students to build an effective repertoire of spelling skills and strategies, with teaching focused on building phonological and morphemic knowledge, and on strengthening visual memory.
■ About this bookTargeting Spelling Year 6 continues the spelling journey. It contains 32 core lessons covering four school terms, each lesson providing the basis of a weekly program. This allows time for review and consolidation of previous learning, assessment of student progress and an evaluation of each student’s learning needs. Although phonological knowledge still underlies much of the demands of spelling, Year 6 has a change in emphasis to building knowledge and understanding of prefixes and suffixes. Students need to understand that, in longer words, syllables are “slurred” over (the schwa sound), so they must become more reliant on what words look like, rather than how they sound. They need to apply rules when adding endings and consider the subtle changes in spelling when adding suffixes. Spelling is ultimately a visual skill, so we need to emphasise the importance of asking, “Does this word look right?” Explicit teaching should be part of every lesson, followed by application and practice.Ideally, about 15 minutes a day needs to be devoted specifically to the teaching of spelling but, if scheduling time for specific instruction is difficult, build it into lessons in other curriculum areas. remember, spelling impacts all other subjects throughout school and beyond. While many students quickly and easily develop a spelling “sense”, others will need much instruction and scaffolding. A spelling program needs to unfold slowly to maximise learning for all students. As teachers, we need to pace our instruction thoughtfully and provide many opportunities for student practice and application so that, as much as possible, no-one is left behind.The Year 6 overview opposite details the focus of each of the core lessons throughout the year. The word list for each lesson is also contained in the Word Warm-ups book.The Year 6 weekly overview on page 9 is a suggested guide for teachers to cover the content of each lesson during the week. not every lesson will follow the exact pattern provided in the weekly overview. However, the lessons are based on the principle that teacher instruction and demonstration early in the week leads to student practice and, finally, a demonstration of what students know through assessment. This procedure will vary according to the needs of individual students and the class as a whole. Teachers need to monitor student progress and modify the program as necessary.
ISBN 978 1 76020 452 5
2 3 Targeting Spelling Year 6 © 2015 Blake Education
Year 6 overviewTerm one
Lesson 1 Lesson 2 Lesson 3 Lesson 4
Prefixes in–, im– Prefix dis– Silent k, g, w Prefixes ob–, per–
Word Extra: impossible, inaccurate Word Extra: disapprove, disturb Word Extra: knuckles, written Word Extra: symbol, system
Lesson 5 Lesson 6 Lesson 7 Lesson 8
Prefix de– Prefixes inter–, trans– Prefixes com–, con– mitto or missus (I send) pes or pedis (foot)
Word Extra: develop, delete Word Extra: outburst, outbreak Word Extra: compare, construct Word Extra: emit, transmit
Term TWo
Lesson 9 Lesson 10 Lesson 11 Lesson 12
Verb suffixes –ate, –ise Words ending in o Suffix –fy Soft g, c
Word Extra: energy, chemist Word Extra: search, worst Word Extra: fulfil, seldom Word Extra: centre, general
Lesson 13 Lesson 14 Lesson 15 Lesson 16
Suffixes –or, –ar Suffix –ive Prefixes mono–, bi–, micro–
Prefixes e–, ex–Adding prefixes and suffixes Prefix en–
Word Extra: author, dollar Word Extra: active, selective Word Extra: exhibit, examine Word Extra: enforce, enthral
Term THree
Lesson 17 Lesson 18 Lesson 19 Lesson 20
Prefix re– Suffix –ion Prefixes pre–, pro– duco or ductus (I lead) cedo or cessus (I go)
Word Extra: recede, refrigerate Word Extra: emotion, exception Word Extra: preserve, propose Word Extra: recess, exceed
Lesson 21 Lesson 22 Lesson 23 Lesson 24
Suffix –al The y sound The y rule
Letter teams hy–, sy– Adding prefixes and suffixes Prefix ab–, letter team acc–
Word Extra: rural, casual Word Extra: journey, library Word Extra: liquid, squalid Word Extra: accident, accrue
Term four
Lesson 25 Lesson 26 Lesson 27 Lesson 28
Suffixes –ious, –ous Prefix dia–, suffix –ile Suffixes –able, –ible Antonyms Letter teams –ure, –ude
Word Extra: dangerous, generous Word Extra: diary, profile Word Extra: probable, possible Word Extra: exclude, sure
Lesson 29 Lesson 30 Lesson 31 Lesson 32
Letter teams qu, ph Adding common endings; Affixes Suffixes –ian, –ial Suffixes –ent, –ant Suffixes –ence, –ance
Word Extra: equator, elephant Word Extra: social, racial Word Extra: recent, decent Word Extra: fence, chance
ISBN 978 1 76020 452 5
2 3 Targeting Spelling Year 6 © 2015 Blake Education
Year 6 overviewTerm one
Lesson 1 Lesson 2 Lesson 3 Lesson 4
Prefixes in–, im– Prefix dis– Silent k, g, w Prefixes ob–, per–
Word Extra: impossible, inaccurate Word Extra: disapprove, disturb Word Extra: knuckles, written Word Extra: symbol, system
Lesson 5 Lesson 6 Lesson 7 Lesson 8
Prefix de– Prefixes inter–, trans– Prefixes com–, con– mitto or missus (I send) pes or pedis (foot)
Word Extra: develop, delete Word Extra: outburst, outbreak Word Extra: compare, construct Word Extra: emit, transmit
Term TWo
Lesson 9 Lesson 10 Lesson 11 Lesson 12
Verb suffixes –ate, –ise Words ending in o Suffix –fy Soft g, c
Word Extra: energy, chemist Word Extra: search, worst Word Extra: fulfil, seldom Word Extra: centre, general
Lesson 13 Lesson 14 Lesson 15 Lesson 16
Suffixes –or, –ar Suffix –ive Prefixes mono–, bi–, micro–
Prefixes e–, ex–Adding prefixes and suffixes Prefix en–
Word Extra: author, dollar Word Extra: active, selective Word Extra: exhibit, examine Word Extra: enforce, enthral
Term THree
Lesson 17 Lesson 18 Lesson 19 Lesson 20
Prefix re– Suffix –ion Prefixes pre–, pro– duco or ductus (I lead) cedo or cessus (I go)
Word Extra: recede, refrigerate Word Extra: emotion, exception Word Extra: preserve, propose Word Extra: recess, exceed
Lesson 21 Lesson 22 Lesson 23 Lesson 24
Suffix –al The y sound The y rule
Letter teams hy–, sy– Adding prefixes and suffixes Prefix ab–, letter team acc–
Word Extra: rural, casual Word Extra: journey, library Word Extra: liquid, squalid Word Extra: accident, accrue
Term four
Lesson 25 Lesson 26 Lesson 27 Lesson 28
Suffixes –ious, –ous Prefix dia–, suffix –ile Suffixes –able, –ible Antonyms Letter teams –ure, –ude
Word Extra: dangerous, generous Word Extra: diary, profile Word Extra: probable, possible Word Extra: exclude, sure
Lesson 29 Lesson 30 Lesson 31 Lesson 32
Letter teams qu, ph Adding common endings; Affixes Suffixes –ian, –ial Suffixes –ent, –ant Suffixes –ence, –ance
Word Extra: equator, elephant Word Extra: social, racial Word Extra: recent, decent Word Extra: fence, chance
4 5 Targeting Spelling Year 6 © 2015 Blake Education
using the Word Warm-upsThe Word Warm-ups book is the starting point and focus of each lesson. Each student will need their own copy. The Word Warm-ups text is provided at the back of the book and on the CD with layout that can be photocopied as a book and stapled. Students will use this book throughout the year.
Through the Word Warm-ups, students will be introduced to a number of important phonic and structural elements with an emphasis on prefixes and suffixes. The word lists provide the springboard for teaching students how to apply rules and how to make the subtle adjustments needed in spelling (and often pronunciation), particularly when adding suffixes. The book lists “international” words – words that have come from other languages that are now absorbed into English – which can be used to add to the Word Extra lists. It also contains a sight word checker that can be used to gather valuable diagnostic information on incoming or graduating students.
It also lists the basic spelling rules as a reference for students. Some rules have more variations than are listed, such as the doubling rule. For example, in Australian English, if a two-syllable word ends with a vowel plus a consonant and the stress is not at the end of the word, the final consonant is not doubled when adding ing or ed, as in targeting and focusing. But note that, if the word ends in l, it is doubled, as in travelling and labelling.
For more information about spelling rules, go to http://oxforddictionaries.com. under the tab, Better Writing, choose Spelling and scroll down the list to Spelling rules and Tips.
Each teaching session of the week should begin with a Word Warm-up, where the students “chant” the words in a selected list, either as a class or in pairs. By chanting the words, the students are tapping into the visual, vocal and auditory channels of learning. By pronouncing the ends of the words clearly, they will develop an auditory memory for the whole word.
For the first teaching session of the week, begin with a Warm-up using a list of words previously studied. For the rest of the week, do a Warm-up using that week’s list of words.
Areas of workTargeting Spelling sets out the content under a number of work areas that support the teaching and learning process. These are:
❥ Board Work❥ Book Work❥ Word Work❥ Word Extra❥ Pencil Work❥ Assessment
During the week, teachers can focus on different aspects of the spelling process, moving from explicit teaching and learning early in the week, to practice, to a final assessment at the end of the week.
ISBN 978 1 76020 452 5
4 5 Targeting Spelling Year 6 © 2015 Blake Education
■ Board WorkBoard Work is the workface of spelling. This work will provide you with the language of spelling and ideas for the explicit teaching and demonstration of spelling concepts, patterns and rules. Board Work provides a focus for all students and is part of every spelling lesson.
■ Book WorkThe Word Warm-ups book contains lists of words that are the focus of your daily spelling sessions. After starting each session with a Word Warm-up, use open or Closed Book Work to strengthen the learning of the current list of words.
During open Book Work, the Word Warm-ups book is open in front of the students and selected students are asked to spell words orally from the list with an ending added. This allows them to concentrate on selecting correct endings and applying any rules, without having to also memorise the word.
During Closed Book Work, the Word Warm-ups book is closed and students are asked to write dictated words, with or without endings. (no erasers allowed.) This gives students the chance to think about and show what they know about spelling. It is practice time, not test time. As teachers, we need to closely observe what the students are doing, so we can provide scaffolding if necessary. Their responses will guide our further teaching.
■ Word WorkWord Work is part of the weekly plan. This is a session devoted to exploring word use – common endings and rules – and making discoveries about compound words, homophones, antonyms, syllables, prefixes and suffixes.
Hands-on materials are invaluable for enabling students to show what they think they know. The CD contains ready-made cards for the preparation of Compound Word and Homophone baggies. Students reassemble the cards working in pairs or small groups. You could also prepare Prefix and Suffix baggies to consolidate knowledge and understanding.
Demonstrate how to learn multi-syllable words by boxing the syllables, colouring each syllable or drawing a Syllable Slide.
Prepare a Suffixes chart for display (see the CD). use it during spelling lessons and as a reference for students when writing during other curriculum activities.
pros per ouspros per ousprosperous or pros per ous
Suffixesnoun Adjective Verb–ness–ment–or, –er, –ar–ion (–sion, –tion)–ian–ier–ist–ism–ory, –ary–ance, –ence–ship
–ful–less–able, –ible–al–ial–ile–ous, –ious–some–ish–ive–ic–ent
–ise–fy–ate–en
Common endings s, esing, edy, lyer, est
ISBN 978 1 76020 452 5
6 7 Targeting Spelling Year 6 © 2015 Blake Education
■ Word ExtraAll good spellers have a good visual memory for words – they remember what words “look like”. We need to show our students ways of remembering words, especially those that do not follow a “sound” pattern. High-frequency words, or sight words, very often fall into this category. A sight word checker is included in the Word Warm-ups book for the discretionary use of the teacher. Two words for review are included in each weekly list. Teachers may substitute or add extra words, either from the international word list in the Warm-ups book or from the class curriculum, that best suit the needs of the class or individual students. At this stage, it is expected that most students are able to spell basic sight words. However, for some students, Word Extra may consist of sight words not yet mastered.
■ Pencil WorkPhotocopiable worksheets accompany each lesson to give students the opportunity to apply the skills and strategies they have been learning. Set your students up for success by ensuring you have covered any teaching points before the students engage in the work. A set of these worksheets is also provided on the CD. Answers are provided at the back of this book and on the CD.
A Word Workout is provided in each lesson as a stimulus for uninterrupted silent writing. This gives students an opportunity to apply and display growing spelling knowledge. You may extend the time as students become more fluent and proficient.
The Spelling Corner activities enable individual student practice. The 64 cards in the set comprehensively cover the year’s spelling content. They can be used as part of the spelling lessons and/or copied onto card (from the CD) and laminated for use throughout the year. Students can write their answers in their spelling notebooks, on the photocopied Spelling Corner sheets or on the laminated cards (using erasable markers). Answers are provided at the back of this book and on the CD.
Practice WorkIn addition to the worksheets, students need to engage in word play, through games, puzzles and other word-based activities, to build skills and strategies. The Targeting Spelling ideas on page 10 offer a wide range of practical activities to help students make discoveries about words. The CD also includes additional resources, including a list of common suffixes and cards for work with compound words, contractions and homophones.
Word WorkoutWrite for five minutes.
Do not stop. Do not speak.
Sketch and describe a bicycle.
ISBN 978 1 76020 452 5
6 7 Targeting Spelling Year 6 © 2015 Blake Education
■ Digital spelling gamesSeveral spelling games support this program and they can be found on the Spectacular Spelling Games Year 6 CD sold by Blake Education. These games are also available for iPads and are called Eggy Spelling 6.
■ AssessmentAssessment of student progress is an important part of the weekly lesson. Dictate the words and sentences derived from the weekly list to check students’ progress and to diagnose any areas of difficulty or confusion. use the results to address any issues with the class or with individual students.
Start-of-year checkpoints are provided to ascertain student readiness to engage in the program (see Assessment page 12). They also provide a benchmark against which to measure future progress.
At the end of each term, check students’ progress through the assessment items on page 15. use the results to review any areas of uncertainty and to direct further teaching and learning. The proofreading corrections are given in the Answers at the back of this book and on the CD.
End-of-year checkpoints offer a quick snapshot of the skills covered throughout the year (see Assessment page 21). The results will pinpoint the strengths and weaknesses of individual students and the class as a whole.
8 9 Targeting Spelling Year 6 © 2015 Blake Education
A word about assessmentBefore commencing any program in spelling, it is important to ascertain what knowledge and skills your students already have. Spelling is the encoding of spoken words into written language; therefore, at the very minimum, students will need to have a basic knowledge of the alphabet and the different ways we can use its letters to represent the spoken sounds of our language.
Check their short-term and visual sequential memory (remembering what a sequence of letters looks like). Show a sight word flashcard for five seconds. Ask the students to write the word from their memory. Start with short words and build to longer ones. Evaluate the results. For incorrect words, check whether the student has written the correct number of letters and whether the sequence of the letters is correct. Spelling is ultimately a visual skill, so students need to develop a good visual memory.
Check their ability to discriminate between sounds. often students confuse sounds such as d and b, m and n, dr and tr. If you suspect a student has problems, use the auditory discrimination test provided on the CD to pinpoint areas of concern. Further check that students are correctly forming and pronouncing sounds.
Check what students already know about spelling. Ask them to write some words they know. They should try to write at least ten words. Alternatively, dictate some words from a sight word list from the simple to the more difficult, such as he, is, go, they, was, have, want, they, done, said, what, could. Evaluate the results.
observe the way students pronounce words. often, mispronounced and poorly pronounced words lead to spelling errors. Students need to clearly sound the end of every word. By linking what is heard with what is said, they develop a strong auditory memory of the whole word. The vocal, visual and auditory channels all work together to help them spell efficiently. While they may write a word by matching it to an auditory or visual memory, they will often need to monitor its correctness by saying the word.
observe how students hold their pencils and form the letters of words. Poorly formed letters can lead to perceived mistakes in spelling. Some students may need some exercises or activities to correct the way they form letters. Some may need a pencil grip to correct their pencil hold or to give better pencil control.
■ Diagnostic assessmentLearning to spell is a developmental process and your students will need time to master the many skills and strategies involved. Practice and application is vital to their success. Weekly assessment should be diagnostic in nature. observe students closely and intervene to help any students who may be struggling. Assessment pieces are provided with each lesson.
■ Sight Wordsuse the sight word checker in the Word Warm-ups book to diagnose errors in sight word spelling. remember, many of these words never change their spelling, so once learned they should always be spelled correctly.
ISBN 978 1 76020 452 5
6 7 Targeting Spelling Year 6 © 2015 Blake Education
■ Digital spelling gamesSeveral spelling games support this program and they can be found on the Spectacular Spelling Games Year 6 CD sold by Blake Education. These games are also available for iPads and are called Eggy Spelling 6.
■ AssessmentAssessment of student progress is an important part of the weekly lesson. Dictate the words and sentences derived from the weekly list to check students’ progress and to diagnose any areas of difficulty or confusion. use the results to address any issues with the class or with individual students.
Start-of-year checkpoints are provided to ascertain student readiness to engage in the program (see Assessment page 12). They also provide a benchmark against which to measure future progress.
At the end of each term, check students’ progress through the assessment items on page 15. use the results to review any areas of uncertainty and to direct further teaching and learning. The proofreading corrections are given in the Answers at the back of this book and on the CD.
End-of-year checkpoints offer a quick snapshot of the skills covered throughout the year (see Assessment page 21). The results will pinpoint the strengths and weaknesses of individual students and the class as a whole.
8 9 Targeting Spelling Year 6 © 2015 Blake Education
A word about assessmentBefore commencing any program in spelling, it is important to ascertain what knowledge and skills your students already have. Spelling is the encoding of spoken words into written language; therefore, at the very minimum, students will need to have a basic knowledge of the alphabet and the different ways we can use its letters to represent the spoken sounds of our language.
Check their short-term and visual sequential memory (remembering what a sequence of letters looks like). Show a sight word flashcard for five seconds. Ask the students to write the word from their memory. Start with short words and build to longer ones. Evaluate the results. For incorrect words, check whether the student has written the correct number of letters and whether the sequence of the letters is correct. Spelling is ultimately a visual skill, so students need to develop a good visual memory.
Check their ability to discriminate between sounds. often students confuse sounds such as d and b, m and n, dr and tr. If you suspect a student has problems, use the auditory discrimination test provided on the CD to pinpoint areas of concern. Further check that students are correctly forming and pronouncing sounds.
Check what students already know about spelling. Ask them to write some words they know. They should try to write at least ten words. Alternatively, dictate some words from a sight word list from the simple to the more difficult, such as he, is, go, they, was, have, want, they, done, said, what, could. Evaluate the results.
observe the way students pronounce words. often, mispronounced and poorly pronounced words lead to spelling errors. Students need to clearly sound the end of every word. By linking what is heard with what is said, they develop a strong auditory memory of the whole word. The vocal, visual and auditory channels all work together to help them spell efficiently. While they may write a word by matching it to an auditory or visual memory, they will often need to monitor its correctness by saying the word.
observe how students hold their pencils and form the letters of words. Poorly formed letters can lead to perceived mistakes in spelling. Some students may need some exercises or activities to correct the way they form letters. Some may need a pencil grip to correct their pencil hold or to give better pencil control.
■ Diagnostic assessmentLearning to spell is a developmental process and your students will need time to master the many skills and strategies involved. Practice and application is vital to their success. Weekly assessment should be diagnostic in nature. observe students closely and intervene to help any students who may be struggling. Assessment pieces are provided with each lesson.
■ Sight Wordsuse the sight word checker in the Word Warm-ups book to diagnose errors in sight word spelling. remember, many of these words never change their spelling, so once learned they should always be spelled correctly.
ISBN 978 1 76020 452 5
8 9 Targeting Spelling Year 6 © 2015 Blake Education
Weekly overview of teaching and learning proceduresThe lessons provide weekly plans for the teaching and learning of spelling. They contain blocks of work that teachers can dip into throughout the week. Teachers can go backwards and forwards, sometimes doing Board Work or Book Work, sometimes games or Pencil Work. Sometimes the emphasis will be on learning and practising words; at other times, on word building and extension activities. Below is a guide as to how teaching and learning could take place over a week, with teaching and learning passing through five phases.
1. Introduce the words of the week and explore their meaning.2. Learn the words through open and/or Closed Book Work
and learning strategies.3. Extend word knowledge through word building, applying
spelling rules and manipulative materials such as Prefix or Compound Word baggies.
4. Practise new learning through Pencil Work, the Word Workout, Spelling Corner, games, word play and so on. See page 10 for more ideas.
5. Assess progress through word and dictation tests and observations.
monDAYINTRODUCE the words
Board Work • Introduce the focus
element.• Students explore and
discuss the element.Book Work • Introduce the word list
in the Word Warm-ups book.
• Analyse the words and discuss meanings of unfamiliar words.
• Note pattern/s.• Students “chant” the
words together, taking care to say the ends of their words.
Word Extra• Introduce the Word
Extra words.• Options: – Add other words from
class units of work.– Add words from the
international word list in the Word Warm-ups book.
– Add troublesome words identified in students’ writing
• Demonstrate ways of remembering through:
– letter patterns– syllables– visual or rhyming
patterns.
WeDneSDAYEXTEND
word knowledge
Word Work • Explore with students
how and why words change form, such as for:
– plural nouns– adverbs (ly)– present or past tense,
past participles– comparing (bigger,
biggest)– word building with
prefixes and suffixes– subject–verb agreement.• Review and demonstrate
word + ending. (Display common endings on right-hand side of board.)
• Review any rules that apply, e.g. the doubling rule, the e rule, the y rule.
open Book Work • Give individual students
a word to spell orally from the list + common ending, prefix or suffix. (Remind students of any rules.)
Closed Book Work • Ask students to write
some words – say the word first, then add an ending. (Remind students of any rules.)
THurSDAYPRACTISE
new learning
Pencil Work• Instruct students to
complete the worksheet, including the Word Workout. They can use the Spelling Corner as individual practice.
Practice Work• Engage students in
a range of activities to build skills and strategies, such as:
– interactive whiteboard– word puzzles, crosswords– word sorts – Suffix baggies– Prefix baggies– cutting up words and
gluing back together– synonyms and antonyms– word chains, steps,
snakes– compound words– software: Spectacular
Spelling Games, Eggy Spelling 6
– creating word lists with a certain element (rhyming words, word building, visual patterns)
– spelling board games– locating and
highlighting words of 2, 3, 4 syllables in junk mail or magazines.
frIDAYASSESS
progress
Assessment• Assess students’ ability
to spell:– words containing the
“focus” for the week– variations of these words – sight words and Word
Extra words– compound words– contractions– words with prefixes or
suffixes added.• Use different forms of
assessment, such as:– list words– dictation– proofreading– student-generated
dictation – personal writing– observation.• Use the checklists in the
Word Warm-ups book to check individual sight-word knowledge.
note: Students should maintain a spelling notebook for all written spelling-related activities, for assessment and for the diagnosis of spelling problems.
Start each day
with a Word
Warm-up
TueSDAYLEARN
to spell the words
Board Work • Review the focus
element.open Book Work • Students “chant”
the words together. Pause between the top and bottom sets.
Closed Book Work• Students review the
list for two minutes. Close books. Students write as many words as they can remember.
• Students write words given orally, with or without common endings. Scaffold if necessary (refer to Suffixes chart).
Word Extra• Review extra words. • Discuss any
structural patterns.• Explore word
building.note: We need to develop children’s ability to “see” whether a word looks right or wrong. This is essential to proofreading.
ISBN 978 1 76020 452 5
10 TARGETING SPELLING YEAR 6
Don’t underestimate the power of rhyming words to help students develop strong links between the vocal, visual and auditory channels. Make lists of rhyming words that students can be directed to read aloud, in groups or as a whole class. Direct students to create rhyming lists of their own or with a spelling buddy.
• PlayBeat the Clock. use a timer and tell the students they have three minutes, or until the sand runs through an egg timer, to write as many three-letter words as they can. (use other criteria as appropriate.)
• PlacestudentsinpairstomakeWord Snakes or Word Steps. Words are stepped down and begin with the last letter of the word before.Direct students to work in pairs, using
supermarket or department store catalogues. • List three items under each letter
of the alphabet (excluding x).• List words of one, two
and three syllables.
Play word games, such as ‘I Spy’ or ‘I Went
Shopping’.
Give students simple crossword puzzles and word
searches to complete.
Draw a circle on the board. In the centre, write a short vowel or vowel team.
Around the outside write suitable letters for the beginnings and
endings of words containing the phonic element. Ask students to
write as many words as they can. Ask students to read their lists
to a buddy.
Ask students to gather words and make lists from the books they are reading, e.g. words with doubled letters in them, words ending in y, words containing ee or sight words such as pronouns.
Ask students to sit in a circle in groups. One
begins by saying the name of a person (or an animal or fruit). The next person has to say a name beginning with
the last letter (or sound). No repeats.
Write a long word on the board
and ask students to write as
many words as they can from
its letters, e.g. department,
investigation, computerised.
Prepare some short texts with a given number of spelling errors. Ask students to find and fix the
mistakes. Introduce them to editing marks.
Have a Spelling Bee.
All students stand to start
and, in turn, spell a word
dictated from a list. Students
sit if they misspell a word.
Continue until you have the
‘Last Person Standing’.
Prepare a memory game using homophones or antonyms
(ten pairs of words).
Prepare two-syllable word cards, cut jigsaw fashion. Place a starting dot on the cards containing the first syllable. Students reassemble the words and say them to a buddy.
Tell students to write words on 1 cm quad-
ruled paper, one letter per square, and then
draw around the shape of the word with a coloured pencil.
Targeting Spelling ideasIn these early years, students are quickly building a speaking and reading vocabulary. This is followed more slowly by their writing vocabulary – the words they know and can spell. We need to give students high exposure
to words. We need to offer them many opportunities to “play” with words and make discoveries about how they look, how they sound and how they are used. Here are some ideas:
ISBN 978 1 76020 452 5
11 TARGETING SPELLING YEAR 6
AssessmentASSESSMEnT
■ using the assessment toolsTargeting Spelling provides not only a weekly teaching plan, but also a methodology for assessing student progress and diagnosing potential problems. Here you’ll find a number of tools to assist that task, including checkpoints, term assessments, student response sheets and teacher data sheets, all also provided on the CD for photocopying.
At the start of the yearuse the start-of-year checkpoints on page 12 before commencing the program. The results will provide you with baseline data and a benchmark against which to measure future progress.
Give students a start-of-year response sheet each (page 13, also included on the CD) and ask them to record their name and the date. using the start-of-year checkpoints, dictate each of the five word lists in turn and ask the students to write each set of five words.
These items will test the students in several different areas. Collect and analyse the results of each student and the class as a whole. The results can be recorded on each student’s response sheet, below the test and on the Year 6 teacher data sheet on page 23 (also provided on the CD).
Weeklyuse the weekly assessment items in the lessons to check spelling progress. Students write their answers in their spelling notebooks. Students score a mark out of 20 – 10 for the Focus Words and Word Extra and 10 for the dictated sentences. (Deduct 1 mark for each spelling error.) The results can be recorded in the Year 6 teacher data sheet on page 14 (also provided on the CD).
At the end of each termuse the term assessment tasks on page 15 to evaluate student progress for the term. Give students a response sheet each (pages 16–19, also included on the CD) and ask them to record their name and the date.
Dictate the ten Word Extra and ten Focus Words, which have been selected from the lessons throughout the term, and the sentence, which contains five more Focus Words. For the proofreading task, ask the students to circle the ten mistakes (Focus Words) and write them correctly below each sentence. Students score a mark out of 35. Collect and analyse the results of each student and the class as a whole. The results can be recorded on each student’s response sheet and on the Year 6 teacher data sheet on page 20 (also provided on the CD).
At the end of the yearTo administer the end-of-year checkpoints on page 21, follow the same procedure as for the start-of-year checkpoints, dictating the five groups of five words. The results can be recorded on each student’s response sheet (page 22), below the test and on the Year 6 teacher data sheet on page 23 (also provided on the CD).
12 13 Targeting Spelling Year 6 © 2015 Blake Education
Start-of-year checkpoints Year 6, teacher data sheet
1 2345
Closed syllablesOpen syllablesCommon endings (rules)Compound wordsPrefixes and suffixes
1 2 3 4 5
correctvillagegingersuccesscancel
vacantmobilevitalmajorsolar
cyclingtravellerenemiescertainlychallenged
halfwaydatabasechessboardstorehouseoutskirts
adventurousinaccurateexceptiondisadvantagepreventable
STuDenT nAme 1 2 3 4 5
S = Sound D = Developing ✓ = Trouble spot
ISBN 978 1 76020 452 5
11 TARGETING SPELLING YEAR 6
AssessmentASSESSMEnT
■ using the assessment toolsTargeting Spelling provides not only a weekly teaching plan, but also a methodology for assessing student progress and diagnosing potential problems. Here you’ll find a number of tools to assist that task, including checkpoints, term assessments, student response sheets and teacher data sheets, all also provided on the CD for photocopying.
At the start of the yearuse the start-of-year checkpoints on page 12 before commencing the program. The results will provide you with baseline data and a benchmark against which to measure future progress.
Give students a start-of-year response sheet each (page 13, also included on the CD) and ask them to record their name and the date. using the start-of-year checkpoints, dictate each of the five word lists in turn and ask the students to write each set of five words.
These items will test the students in several different areas. Collect and analyse the results of each student and the class as a whole. The results can be recorded on each student’s response sheet, below the test and on the Year 6 teacher data sheet on page 23 (also provided on the CD).
Weeklyuse the weekly assessment items in the lessons to check spelling progress. Students write their answers in their spelling notebooks. Students score a mark out of 20 – 10 for the Focus Words and Word Extra and 10 for the dictated sentences. (Deduct 1 mark for each spelling error.) The results can be recorded in the Year 6 teacher data sheet on page 14 (also provided on the CD).
At the end of each termuse the term assessment tasks on page 15 to evaluate student progress for the term. Give students a response sheet each (pages 16–19, also included on the CD) and ask them to record their name and the date.
Dictate the ten Word Extra and ten Focus Words, which have been selected from the lessons throughout the term, and the sentence, which contains five more Focus Words. For the proofreading task, ask the students to circle the ten mistakes (Focus Words) and write them correctly below each sentence. Students score a mark out of 35. Collect and analyse the results of each student and the class as a whole. The results can be recorded on each student’s response sheet and on the Year 6 teacher data sheet on page 20 (also provided on the CD).
At the end of the yearTo administer the end-of-year checkpoints on page 21, follow the same procedure as for the start-of-year checkpoints, dictating the five groups of five words. The results can be recorded on each student’s response sheet (page 22), below the test and on the Year 6 teacher data sheet on page 23 (also provided on the CD).
12 13 Targeting Spelling Year 6 © 2015 Blake Education
Start-of-year checkpoints Year 6, teacher data sheet
1 2345
Closed syllablesOpen syllablesCommon endings (rules)Compound wordsPrefixes and suffixes
1 2 3 4 5
correctvillagegingersuccesscancel
vacantmobilevitalmajorsolar
cyclingtravellerenemiescertainlychallenged
halfwaydatabasechessboardstorehouseoutskirts
adventurousinaccurateexceptiondisadvantagepreventable
STuDenT nAme 1 2 3 4 5
S = Sound D = Developing ✓ = Trouble spot
ISBN 978 1 76020 452 5
12 13 Targeting Spelling Year 6 © 2015 Blake Education
STuDenT nAme 1 2 3 4 5
Start-of-year checkpoints Year 6STuDEnT rESPonSE SHEET
Name: _____________________________________________________________________ Date: ________ /________ /___________
1 2 3
Score Score Score
4 5
Score Score
Comments
ISBN 978 1 76020 452 5
14
STuD
enT n
Ame
12
34
56
78
910
1112
1314
1516
1718
1920
2122
2324
2526
2728
2930
3132
Wee
kly as
sessm
ent Y
ear 6
, teac
her d
ata sh
eet
Targeting Spelling Year 6 © 2015 Blake EducationISBN 978 1 76020 452 5
Targeting Spelling Year 6 © 2015 Blake Education
Term assessment Year 6
15
Term one
1 Word Extrainaccurate disapproval written system delete construct disturb knuckles symbols outbreak2 focus Wordsdissolve knowledge wretched obstacles descend decade interview communicate pedestrian conscious3 DictationEvery individual will be immunised to impede the spread of disease and avoid disaster.
4 ProofreadingStudents find and fix the ten spelling mistakes. You are not permited to leave until you are dismist. After a brief intavil, the compare announced the final
concert item. The people were left desolate and desprate after the
devistating floods. Jessica was warmly congratuled on the compleeshun
of her solo voyage around the world. The men grew impashent to complete their expadition.
Term TWo
1 Word Extraenergy chemist worst fulfil general exhibits author select examining enthralled2 focus Wordsseparately criticise potatoes magnifying horrified extinguish digital successful governor biennial 3 DictationElaborate celebrations and magnificent displays were organised to greet the new century.
4 ProofreadingStudents find and fix the ten spelling mistakes. Car advertisments appear regully on television. He has several photoes of the train acksident. Many animals are endangerd by the polluted
envirament. Many different ceral crops are grown in this rejun. The government will introduce new policys to simplefy
the tax laws.
Term THree
1 Word Extrarecede recess preserve proposal casual journey liquid refrigerator accident exception 2 focus Wordsactual system proficient succeed abruptly individual caution process punctual pyramid 3 DictationAs a remedy, the doctor prescribed pills and recommended strict personal hygiene.
4 ProofreadingStudents find and fix the ten spelling mistakes. The library was closed temprally while renivashuns
were carried out. The cars were excessavly damaged in the colison. Council regalations require all dogs to be registed. He is the conducter of the Sydney Symfony Orchestra. As the floodwaters reseeded, there was nothing left to
retreeve.
Term four
1 Word Extragenerous diary probably sure equator social possible decent chance dangerous2 focus Wordsmosquito partial invisible delicious musician specially reliance assistant diameter mobile3 DictationThe people were dependent on their politicians for crucial assistance in the wake of the typhoon.
4 ProofreadingStudents find and fix the ten spelling mistakes. He waited patently to cross the pidestran crossing. The maintainence of electrical appliances is essenshal. As the temprature rose, the humidity became
intollerable. The auction concluded with the sale of an anteek
dimond necklace. The enormus bear was barely visable in the dark cave.
ISBN 978 1 76020 452 5
16 17 Targeting Spelling Year 6 © 2015 Blake Education
Term 1 assessment Year 6STuDEnT rESPonSE SHEET
Name: _____________________________________________________________________ Date: ________ /________ /___________
Results
1 2 3 4
1 Sight Words 2 Focus Words 4 Proofreading: Find and fix the ten mistakes.
You are not permited to leave until you are dismist.
After a brief intavil, the compare announced the final concert item.
The people were left desolate and desprate after the devistating floods.
Jessica was warmly congratuled on the compleeshun of her solo voyage around the world.
The men grew impashent to complete their expadition.
Name: _____________________________________________________________________ Date: ________ /________ /___________
3 Dictation
ISBN 978 1 76020 452 5
16 17 Targeting Spelling Year 6 © 2015 Blake Education
Term 2 assessment Year 6STuDEnT rESPonSE SHEET
Name: _____________________________________________________________________ Date: ________ /________ /___________
Results
1 2 3 4
1 Sight Words 2 Focus Words 4 Proofreading: Find and fix the ten mistakes.
Car advertisments appear regully on television.
He has several photoes of the train acksident.
Many animals are endangerd by the polluted envirament.
Many different ceral crops are grown in this rejun.
The government will introduce new policys to simplefy the tax laws.
3 Dictation
ISBN 978 1 76020 452 5
18 19 Targeting Spelling Year 6 © 2015 Blake Education
Term 3 assessment Year 6STuDEnT rESPonSE SHEET
Name: _____________________________________________________________________ Date: ________ /________ /___________
Results
1 2 3 4
1 Sight Words 2 Focus Words 4 Proofreading: Find and fix the ten mistakes.
The library was closed temprally while renivashuns were carried out.
The cars were exessavly damaged in the colison.
Council regalations require all dogs to be registed.
He is the conducter of the Sydney Symfony Orchestra.
As the floodwaters reseeded, there was nothing left to retreeve.
3 Dictation
ISBN 978 1 76020 452 5
18 19 Targeting Spelling Year 6 © 2015 Blake Education
Term 4 assessment Year 6STuDEnT rESPonSE SHEET
Name: _____________________________________________________________________ Date: ________ /________ /___________
Results
1 2 3 4
1 Sight Words 2 Focus Words 4 Proofreading: Find and fix the ten mistakes.
He waited patently to cross the pidestran crossing.
The maintainence of electrical appliances is essenshal.
As the temprature rose, the humidity became intollerable.
The auction concluded with the sale of an anteek dimond necklace.
An enormus bear was barely visable in the dark cave.
3 Dictation
ISBN 978 1 76020 452 5
20
TERm
1TE
Rm 2
TERm
3TE
Rm 4
STu
DenT
nAm
eW
ord
Extra
Focu
s W
ords
Dicta
tionProofing
Word
Extra
Focu
s W
ords
Dicta
tionProofing
Word
Extra
Focu
s W
ords
Dicta
tionProofing
Wor
d Extra
Focu
s W
ords
Dicta
tionProofing
Term
asses
smen
t Yea
r 6, te
ache
r data
shee
t
Targeting Spelling Year 6 © 2015 Blake EducationISBN 978 1 76020 452 5
21
TERm
1TE
Rm 2
TERm
3TE
Rm 4
STu
DenT
nAm
eW
ord
Extra
Focu
s W
ords
Dicta
tion
Proofi
ngW
ord
Extra
Focu
s W
ords
Dicta
tion
Proofi
ngW
ord
Extra
Focu
s W
ords
Dicta
tion
Proofi
ngW
ord
Extra
Focu
s W
ords
Dicta
tion
Proofi
ng End-of-year checkpoints Year 6, teacher data sheet
1 2345
Latin and Greek rootsLetter teams ph, qu, silent letters Common endings (rules)Prefixes Suffixes
1 2 3 4 5
educationintermittentpedestrianmissionproductive
antiqueorphanknowledgewretchedgnome
endangeredurgencyterrifiedcompletingindustries
accompanyimpatientmicrophonepermissiondiameter
separationgradualattractivecriticiseelectrician
STuDenT nAme 1 2 3 4 5
S = Sound D = Developing ✓ = Trouble spot
Targeting Spelling Year 6 © 2015 Blake EducationISBN 978 1 76020 452 5
22
End-of-year checkpoints Year 6STuDEnT rESPonSE SHEET
Name: _____________________________________________________________________ Date: ________ /________ /___________
Targeting Spelling Year 6 © 2015 Blake Education
1 2 3
Score Score Score
4 5
Score Score
Comments
ISBN 978 1 76020 452 5
23
Clos
ed sy
llabl
es
Open
sylla
bles
Com
mon
end
ings
(ru
les)
Com
poun
d wo
rds
Prefi
xes a
nd su
ffixe
s
Latin
and
Gre
ek ro
ots
Lette
r tea
ms p
h, q
u,
silen
t let
ters
Com
mon
end
ings
(ru
les)
Prefi
xes
Suffi
xes
Year 6 checkpoints, teacher data sheetStart-of-year checkpoints
End-of-year checkpoints
STUDENT NAmE
Targeting Spelling Year 6 © 2015 Blake EducationISBN 978 1 76020 452 5
24 25 TargeTing Spelling Year 6 © blake educaTion 2015
Teaching notes Focus: Prefixes in–, im– (not, within)
Begin by revising the concept of prefixes. A prefix is a word part added to the beginning of a word to change its meaning, e.g. replay, dislike, unhappy.
■ Board WorkToday, we will look at words that begin with the prefixes, in– and im–. Remember, prefixes affect the meaning of words.
• in– and im– loosely mean not or within, e.g. inaccurate = not accurate (Your calculations are inaccurate.), impolite = not polite (He was rude and impolite to his brother.)
• Prefixes are always spelled in the same way.
• Explain that prefixes are attached to base words or words that have their roots in the early languages of Latin or Greek.
■ Word Work• Split the students into an A Team and a B
Team.
• List the following words on the board and ask the A Team to write them down, adding the prefix in–: flame, direct, valid, vest, different, capable, flammable, cite, action, expensive.
• List the following words on the board and ask the B Team to write them down, adding the prefix im–: prove, mortal, migrate, polite, port, plant, personal, paired, pact, print.
• As a class, read and discuss the new words.
• Discuss some words that can be built by adding suffixes, e.g. indicate: indicator, indication, indicative;
invade: invasion, invasive (note how the d becomes an s); individual: individuality; inferior: inferiority; inhale: inhalant, inhalation, inhaler; indulge: indulgent, indulgence; inhabit: inhabitable; impulse: impulsive, impulsively, impulsiveness; impress: impressive, impression, impressionable; impatient: impatience; immense: immensity; impose: imposition; immunise: immunisation; imitate: imitator, imitation, imitable.
lesson 1 term 1
incurindicateindividualinferiorinflictinhaleinhabitindulgeinvade
imploreimpulseimpressimpatientimposeimitateimmaculateimmenseimmunise
Word Warm-ups
Word extra
impossible inaccurate
■ Book WorkTell the students to open their Word Warm-ups book to page 2, List 1.• Point out that all their words this week begin
with in– or im–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Remind students of the e rule.
• Ask selected students to spell some words from the list with common endings added, e.g. inhaling, invading, indicating, individually, immensely, implored, imitating, impatiently.
ISBN 978 1 76020 452 5
24 25 TargeTing Spelling Year 6 © blake educaTion 2015
Word Work, continued• Write this list of base words on the board: perfect,
ability, correct, passable, visible, press, voice, competent, convenient, adequate, pact, dependent. Ask students, individually, to add the correct prefix, in– or im–, to make another word.
• As a class, discuss the results.• Discuss antonyms: inhale, exhale; inferior, superior.
term 1
lesson 1
■ Word ExtraAdd two to five words to the weekly Warm-ups list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
■ Pencil WorkThe worksheet focuses on understanding the function and the application of prefixes, suffixes and common endings, on applying rules when adding common endings and suffixes, and proofreading.Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 1 and 2.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• impatience • indulgent• imitation • inhaling• impulsive • inferior• imposing • indication
Dictation❥ Great hardship was inflicted on the people during the invasion.❥ We were impressed by his good manners and immaculate dress.❥ The country’s inhabitants live on the edge of an immense desert.❥ He waited impatiently for their decision to include him in the team.
Word extra• impossible • inaccuracy
To words ending in ade, ide, ode or ude add sion to form nouns.
invade provide explode includeinvasion provision explosion inclusion
ISBN 978 1 76020 452 5
26 27 TargeTing Spelling Year 6 © blake educaTion 2015
2 Add endings to complete the words correctly. Heincur____________________manydebtsduetohisimpuls(e)____________________spending. Alltheinhabit____________________havebeenimmunise____________________againstmalaria. Themeterindicate____________________theyhavebeeninhal(e)____________________impureair. Theinvad(e)_________________soldiersimpose____________anight-timecurfewonallcitizens.
3 Nouns are often built from verbs. Join the nouns and verbs that belong together.
inhabit indicator imagine impairment indicate inhalation impress immunisation invade indulgence impair imposition indulge inhabitant immunise imagination inhale invasion impose impression
4 Circle the spelling error in each sentence and write the correct word on the line.
Acurfewwasimposedonalltheinhabitentsofthecity. ______________________________________
Youareallindividualyresponsibleforbuyingyourtickets. ______________________________________
Hewavedhishand,indicateingwhichwayweshouldgo. ______________________________________
MrJacobswasimmenslyproudofhisson’sachievements. ______________________________________
Thecountryisdry,barrenanduninhabittedbypeople. ______________________________________
term 1 lesson 1 Pencil Work 1Name:________________________________________________________________________________
❂
❂
❂
1 Add prefixes to build some new words. Use your dictionary to check meaning.
❂
Add in–
direct
correct
different
capable
sane
Add im–
patient
pure
possible
perfect
mobile
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Draw, describe and name an imaginary bird or animal.
ISBN 978 1 76020 452 5
26 27 TargeTing Spelling Year 6 © blake educaTion 2015
term 1 lesson 1 Spelling Corner 2
term 1 lesson 1
Write antonyms for these words. Words will begin with the prefixes im– or in–.
im+pulse+ive+ity ______________________________________________________
immunise+a+tion ______________________________________________________
inferior+ity ______________________________________________________
im+prove+ment ______________________________________________________
un+inhabit+able ______________________________________________________
un+import+ant ______________________________________________________
indulge+ence ______________________________________________________
im+mortal+ity ______________________________________________________
imitate+ion ______________________________________________________
impress+ion+able ______________________________________________________
patient ______________________________________________________
valid ______________________________________________________
formal ______________________________________________________
perfect ______________________________________________________
correct ______________________________________________________
personal ______________________________________________________
proper ______________________________________________________
capable ______________________________________________________
passable ______________________________________________________
significant ______________________________________________________
Spelling Corner 1
Build new words by joining the word parts. Apply your spelling rules.
ISBN 978 1 76020 452 5
28 29 TargeTing Spelling Year 6 © blake educaTion 2015
Teaching notes Focus: Prefix dis– (not, opposite)
■ Book Work Tell the students to open their Word Warm-ups book to page 2, List 2.• Point out that all their words this week begin
with dis–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Remind students of the e rule.
• Ask selected students to spell some words from the list with common endings added, e.g. diseases, discharged, disguising, dispatches, dispenser, dissolving.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes.
• Ask the students to close their books and write as many words as they can remember.
• Share and evaluate the results.
ConsolidationAsk the students to use their dictionary to list ten words beginning with dis- .
Ask them to share their lists in groups of four. The students should be able to explain the meanings of all their words.
lesson 2 term 1
diseasedisasterdiscussdiscreditdischargediscountdisembarkdisfiguredisguise
disgustdisposedispatchdispensedispersedisputedismissdislocatedissolve
Word Warm-ups
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
Word extra
disapprovedisturb
■ Board WorkToday, we will look at words that begin with the prefix dis–. Remember, prefixes affect the meaning of words.
• dis– loosely means not or opposite to, e.g. dishonest = not honest (He was being dishonest.), disobey = opposite of obey (A soldier must not disobey an order.)
• Prefixes are always spelled in the same way.
• Explain that prefixes are attached to base words or words that have their roots in the early languages of Latin or Greek.
• Write these two lists of words on the board.
Divide the class into groups A and B. Ask each group to write the words in their list to include the prefix dis-. Discuss the results.
Group A Group Benchantedabledadvantageinfectappoint
assemblecouragebelieveentangleconnect
ISBN 978 1 76020 452 5
28 29 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• List the following words on the board: qualify, honour,
cover, mantle, comfort, connect, coloured, cord, able, band. Ask the students to write them down, adding the prefix dis–.
• Discuss words that can be built by adding suffixes, e.g. disastrous (note the e is dropped when adding –ous), discussion, disfigurement, disembarkation, disposal, dispersal, dismissal, dislocation.
• Explain that dis– added to many words will form an antonym.
• List the following words on the board: prove, credit, believe, embark, honour, agree, like, approve, organised, advantaged. Ask the students to write them down, adding the prefix dis–. Discuss their list of antonyms.
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
■ Pencil WorkThe worksheet focuses on understanding the function and the application of prefixes and suffixes.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 3 and 4.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
term 1
lesson 2
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• disfigured • dissolved• disgusting • dislocated • dispatches • discusses • dispenser • disputing
Dictation❥ Disease spread quickly following the flood disaster.❥ He disembarked from the ship, disguised as a sailor.❥ The discredited worker was dismissed from his job.❥ There has been much discussion about the disposal of e-waste.
Word extra• disapproving • disturbed
ISBN 978 1 76020 452 5
30 31 TargeTing Spelling Year 6 © blake educaTion 2015
1 Build these words with prefixes.
2 Now use some of those words to complete these sentences. You may need to add endings.
YoumaythinkhewillwinbutI______________________________________withyou. Thecrowdreactedangrilywhenthegoalwas______________________________________. Theelectrician______________________________________thepowersupplybeforeinstallingourTV. Icannothelpbut______________________________________yourfancifulstory! He______________________________________theusedbatteriesfromhisdigitalcamera.
3 Add a suffix to the word in the box to complete each sentence correctly. dispose The______________________________________ofe-wasteisanurgentproblem. discuss Wehadabrief_________________________________aboutwhowouldbuythetickets. disappoint Itwasagreat______________________________________whenourteamlostthegame. disgrace Hisunsportingbehaviourisquite______________________________________. dismiss Herconstantlatenessforworkledtoher______________________________________.
4 Complete this table of verbs by adding the endings. Think about your spelling rules.
Add s Add ing Add ed
dispense
discharge
disperse
dislocate
dissolve
Pencil Work 2Name:________________________________________________________________________________
term 1 lesson 2
❂
❂
❂
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Describe a disastrous event, such as an oil spill.
graceconnectloyalcardallowplease
dis
_____________________________________
_____________________________________
_____________________________________
_____________________________________
_____________________________________
_____________________________________
obedientqualifybelieveagreeadvantageorganised
dis
_____________________________________
_____________________________________
_____________________________________
_____________________________________
_____________________________________
_____________________________________
ISBN 978 1 76020 452 5
30 31 TargeTing Spelling Year 6 © blake educaTion 2015
term 1 lesson 2
Add suffixes to build new words.Apply your spelling rules. Read your list to a friend.
Be a word sleuth. Use your dictionary to make a list of ten words beginning with dis– and their meanings.Share your words and meanings with a friend.
dispose+al ______________________________________________________
disast(e)r+ous ______________________________________________________
discuss+ion ______________________________________________________
dislocate+ion ______________________________________________________
disembark+ation ______________________________________________________
disagree+able ______________________________________________________
disperse+al ______________________________________________________
dismiss+al ______________________________________________________
disfigure+ment ______________________________________________________
discourage+ment ______________________________________________________
Spelling Corner 3
term 1 lesson 2 Spelling Corner 4
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
ISBN 978 1 76020 452 5
32 33 TargeTing Spelling Year 6 © blake educaTion 2015
■ Book WorkTell the students to open their Word Warm-ups book to page 2, List 3.• Work through each set of words. Ensure the
students understand the meanings of all words.
• Chant the words together, keeping a steady pace.
• Ask students at random to close their eyes and try to spell words from each set. Remind them to think about what the words look like.
Open Book Work• Ask the students to refer to their list and spell
some words with any common endings that apply, e.g. kneading, knapsacks, gnawed, gnomes, writhing, wretchedly, wrestler.
Consolidation• Divide the class into three groups. Ask each
group to study one set of words from the list. Allow two minutes. At the end of this time, ask the students to close their books and write down as many words as they can remember. Evaluate their learning.
• Ask the students, working in pairs, to prepare a list of ten words beginning with wr, gn or kn. They should use a dictionary. When they have finished, pairs meet and share their words with each other.
rule: You must be able to read your words and know what they mean.
knackkneadknobblyknapsackknick-knackknowledge
gnawgnashgnomegnatgnarled
writhewreathwretchedwranglewrestle
Word Warm-ups
Word extra
knuckleswritten
lesson 3
term 1
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Board Work• Write these words on the board: know, knife,
knee.
• Ask a student to read the words. Ask the class what they notice about these words. Establish that the letter k is silent in each word.
• List some more words on the board, asking the students to say the words and notice the silent k, e.g. knit, knob, knot, kneel, knew.
• Remind the students that, when they write these words, they will not hear the k sound. They will need to remember what the words look like.
• Write these words on the board: write, wrote, wrong, wriggle.
• Ask a student to read the words. Ask the class what they notice about these words. Establish that the letter w is silent in each word.
• List some more words on the board, asking the students to say the words and notice the silent w, e.g. wring, wreck, wrist, wretch. Explain any unfamiliar words.
• Remind the students that, when they write these words, they will not hear the w sound. They will need to remember what the words look like.
• Write these words on the board: gnome, gnat, gnaw.
• Ask a student to read the words. Ask the class what they notice about these words. Establish that the letter g is silent in each word.
• Remind the students that, when they write these words, they will not hear the g sound. They will need to remember what the words look like.
• Reiterate that the k in kn, the g in gn and the w in wr are silent letters.
Teaching notes Focus: Silent letters k (knee), g (gnaw), w (write)
To spell words with silent letters,
you need to remember what the words LOOK LIKE.
ISBN 978 1 76020 452 5
32 33 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Explore compound words containing words with
silent letters, e.g. doorknob, doorknocker, swordfish, swordfight, shipwreck, kneepads, kneecap, topknot, wrongdoing, penknife, wristwatch, wristband.
• Review homophones. Discuss the differences in meaning between knead, need; no, know; new, knew; night, knight; nit, knit; not, knot; ring, wring; rung, wrung.
• Discuss the difference between wrist and wrest, knock and knack, wreath and wreathe.
• Explore words that can be built by adding suffixes, e.g. knowledgeable, wretchedness.
term 1
lesson 3
■ Pencil WorkThe worksheet focuses on present-tense and past-tense verbs, word meanings, compound words and completing words to match sentence grammar.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 5 and 6.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• knobbly • wrangling• gnats • knick-knacks• gnawed • knowledge • knapsack • writhing
Dictation❥ Three gnomes appeared, their faces wreathed in smiles.❥ The old woman kneaded the dough with rough, gnarled hands.❥ The wrestler felt wretched when he lost the match.❥ The wounded dragon gnashed its teeth and writhed in pain.
Word extra• knuckles • written
■ Word ExtraAdd two to five words to the weekly Warm-ups list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
34 35 TargeTing Spelling Year 6 © blake educaTion 2015
Pencil Work 3Name:________________________________________________________________________________
term 1 lesson 3
❂
❂
❂
1 Add a suffix to the word in the box to complete each sentence correctly. wrestle Dadlikestowatch______________________________________onthesportschannel. gnat ______________________________________aresmallinsectswithonepairofwings. writhe Helay______________________________________inpain,holdinghishurtwrist. knowledgeHeisavery______________________________________researchscientist. gnaw Theexplorersoftenexperienced______________________________________hunger.
2 Write sentences to clearly show the difference in meaning between: wreathewreathknockknack _______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
3 Join two words to make a compound word. wrist knife top wreck wrong knob knock knot knee doing door pads pen watch ship band door fight knee knock sword cap wrist out
4 Add the endings to complete this table of verbs. Think about your spelling rules.
Add s Add ing Add ed
wrestle
knead
writhe
gnaw
wrangle
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about the extraordinary life of Gilbert Grimsby, garden gnome.
ISBN 978 1 76020 452 5
34 35 TargeTing Spelling Year 6 © blake educaTion 2015
term 1 lesson 3 Spelling Corner 6
term 1 lesson 3
Join the word parts. Write the new words. Use your spelling rules. Check the dictionary for meanings.
Find and fix the eight spelling mistakes.Writethecorrectspellingsonthelinesbelow.
Spelling Corner 5
wrap+er ______________________________________________________
knot+y ______________________________________________________
knowledge+able ______________________________________________________
knight+hood ______________________________________________________
answer+able ______________________________________________________
wretched+ness ______________________________________________________
wrong+ful+ly ______________________________________________________
wreck+age ______________________________________________________
knife+s ______________________________________________________
knit+ing ______________________________________________________
Here is an experiment to explain how a potato loses weight.
1Washanddryalargepotato.Placeitonakitchinscaleandweighitcarefly.Recorditsweightinyoursiencenotebook.
2Placethepotatoinadryplaceforabowt20days.
3Weighthepotatoagain.Eventhroughthepotatomaylookthesamesize,itwillweighlessthanwhenyoufirstweighedit.
Why?Thishappenedbecasealargepartofthepotatoismadeupofwater.
Inthedryair,someofthewaterevapouratedandthepotato“lostweight”.
Ifleftforalongtime,thepotatowouldshrivvelupandbecomemuchlighter.
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
ISBN 978 1 76020 452 5
36 37 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• List the verbs from the table below.
• Show how we can change these verbs to nouns by adding the suffix –ion.
verb noun
perfectperceiveobstructobjectobserveperspirepermitpersuade
perfectionperceptionobstructionobjectionobservationperspirationpermissionpersuasion
Note that when words end in ade, ide, ode or ude, the d is often changed to an s when adding a suffix, e.g. invade, invasion; collide, collision; erode, erosion; conclude, conclusion.
■ Book WorkTell the students to open their Word Warm-ups book to page 3, List 4.
• Today the words in our list begin with the prefixes ob– and per–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkList the common endings on the board. Remind the students about the e rule. Ask selected students to spell some of the words with common endings added, e.g. observing, obstacles, perspiring, persuaded, perceived.
Closed Book Work• Write three to five words on the board.
• Tell the students they have one minute to view the words.
• Rub the words off the board and ask the students to write what they can remember.
• Evaluate the results.
• Repeat with different words.
objectobstructobtainobscureobsoleteobserveobstacleobnoxiousobvious
perfectperformperfumepermitpersuadepersistperspireperceivepersonnel
Word Warm-ups
Word extra
symbolsystem
Many verbs can be changed to their noun form
by adding the suffix –ion.
lesson 4 term 1
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
Teaching notes Focus: Prefixes ob– (against, in the way of), per– (through); Adding suffixes
ISBN 978 1 76020 452 5
36 37 TargeTing Spelling Year 6 © blake educaTion 2015
term 1
lesson 4
■ Word Work• Place the students in pairs and set the following task. • Using your dictionary, make a list of ten words
beginning with ob– or per–. The words should be different from those in your list. When you share your words with the class, you need to know how to say the word and give its meaning.
• Do some further word building, e.g. performance, performer; perfumery; persuasion, persuasive, persuasiveness; perspiration, antiperspirant; persistence; objection, objective; obstruction, obstructive; observant, observance, observation, observatory; obscurity, symbolic, symbolism; systematic.
■ Pencil WorkThe worksheet focuses on word building, spelling words to match sentence grammar, and word meaning through synonyms.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 9 and 10.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• obstacles • obnoxious• objective • observer• perspiring • perfection• obviously • obsolete
Dictation❥ He obtained a free ticket to the final performance.❥ I tried to persuade her to persist with her studies.❥ The smell of perfume permeated the room.❥ All personnel objected to using obsolete equipment.
Word extra• symbol • system
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
38 39 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add a suffix to the word in the box to complete the sentences correctly. perspire Therewerebeadsof______________________________________onhisforehead.
obtain Mysisterhasfinally______________________________________herdriver’slicence. perform The______________________________________willbeginateighto’clockthisevening. observe An______________________________________personnoticesmanysmalldetails. persist Wewererewardedforour_________________________________whenwewonthegame.
2 Build some great new words! Note any spelling rules. perfume+ery __________________________________ object+ion+able __________________________________
perform+ance __________________________________ observe+ant __________________________________
perspire+ation __________________________________ obscure+ity __________________________________
person+al+ity __________________________________ obtain+able __________________________________
persuasive+ness__________________________________ observe+at+ory __________________________________
3 Join these words with their synonyms. persuade cover,screen,hide,shade persist block,bar,resist,barricade,hinder obvious barrier,hitch,drawback,handicap obscure coax,convince,induce,talkinto obstruct continuesteadily,endure obstacle apparent,plain,evident,visible
4 Add letters to these words to complete the sentences.
P E R
P E R
O B
O B
P E R
P E R
Pencil Work 4Name:________________________________________________________________________________
term 1 lesson 4
❂
❂
❂
❂
Wetriedto__________Dadtotakeustothebeach.
All__________mustparkinthestaffcarpark.
Duringtheeclipse,themoonwas__________bytheearth.
Iwasableto__________apunnetoffreshstrawberries.
Ifyou__________,youwillsoonsolvethepuzzle.
Thesmellofher__________lingeredintheair.
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Are you observant? List twenty things in the school playground.
ISBN 978 1 76020 452 5
38 39 TargeTing Spelling Year 6 © blake educaTion 2015
term 1 lesson 4 Spelling Corner 8
term 1 lesson 4
Change these verbs to nouns by adding the suffix –ion.You may need to change or add some letters.
Change the prefixes to make new words.Check word meanings in your dictionary.
Spelling Corner 7
object ______________________________________________________
obstruct ______________________________________________________
perfect ______________________________________________________
perspire ______________________________________________________
observe ______________________________________________________
persuade ______________________________________________________
__________________________________________
__________________________________________
__________________________________________
perdein
fect
__________________________________________
__________________________________________
__________________________________________
obrecon
tain
__________________________________________
__________________________________________
__________________________________________
perrecon
ceive
__________________________________________
__________________________________________
__________________________________________
obincon
struct
__________________________________________
__________________________________________
__________________________________________
perinre
sist
__________________________________________
__________________________________________
__________________________________________
obrepre
serve
40 41 TargeTing Spelling Year 6 © blake educaTion 2015
■ Book WorkTell the students to open their Word Warm-ups book to page 3, List 5.
• Point out that all their words this week begin with de–.
• Point out that the prefix de– is pronounced with a schwa sound in the top set of words and a short e sound in the bottom set. Give illustrations.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Remind students of the e rule.
• Ask selected students to spell some words from the list with common endings added, e.g. describing, despising, devoured, decades, delicately, desperately.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes.
• Ask the students to close their books and write as many words as they can remember.
• Share and evaluate the results.
despisedevisedevicedestroydeprivedescribedescenddevourdetergent
decadedelegatedetonatedevastatedelicatedefinitedesperatedesolatedestitute
Word Warm-ups
Word extra
developdelete
lesson 5 term 1
■ Board Work• Today, we will look at words that begin with
the prefix de–. Remember, prefixes affect the meaning of words.
• de– loosely means down or away from, e.g. depart = leave, part from. (We depart at noon.)
• Prefixes are always spelled in the same way.
• Explain that prefixes are attached to base words or words that have their roots in the early languages of Latin and Greek.
Teaching notes Focus: Prefix de– (down, away from)
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
ISBN 978 1 76020 452 5
38 39 TargeTing Spelling Year 6 © blake educaTion 2015
term 1 lesson 4 Spelling Corner 8
term 1 lesson 4
Change these verbs to nouns by adding the suffix –ion.You may need to change or add some letters.
Change the prefixes to make new words.Check word meanings in your dictionary.
Spelling Corner 7
object ______________________________________________________
obstruct ______________________________________________________
perfect ______________________________________________________
perspire ______________________________________________________
observe ______________________________________________________
persuade ______________________________________________________
__________________________________________
__________________________________________
__________________________________________
perdein
fect
__________________________________________
__________________________________________
__________________________________________
obrecon
tain
__________________________________________
__________________________________________
__________________________________________
perrecon
ceive
__________________________________________
__________________________________________
__________________________________________
obincon
struct
__________________________________________
__________________________________________
__________________________________________
perinre
sist
__________________________________________
__________________________________________
__________________________________________
obrepre
serve
40 41 TargeTing Spelling Year 6 © blake educaTion 2015
■ Book WorkTell the students to open their Word Warm-ups book to page 3, List 5.
• Point out that all their words this week begin with de–.
• Point out that the prefix de– is pronounced with a schwa sound in the top set of words and a short e sound in the bottom set. Give illustrations.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Remind students of the e rule.
• Ask selected students to spell some words from the list with common endings added, e.g. describing, despising, devoured, decades, delicately, desperately.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes.
• Ask the students to close their books and write as many words as they can remember.
• Share and evaluate the results.
despisedevisedevicedestroydeprivedescribedescenddevourdetergent
decadedelegatedetonatedevastatedelicatedefinitedesperatedesolatedestitute
Word Warm-ups
Word extra
developdelete
lesson 5 term 1
■ Board Work• Today, we will look at words that begin with
the prefix de–. Remember, prefixes affect the meaning of words.
• de– loosely means down or away from, e.g. depart = leave, part from. (We depart at noon.)
• Prefixes are always spelled in the same way.
• Explain that prefixes are attached to base words or words that have their roots in the early languages of Latin and Greek.
Teaching notes Focus: Prefix de– (down, away from)
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
ISBN 978 1 76020 452 5
40 41 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• List the following words on the board: tour, liver, tail,
lay, rail, press, sire, serve, void, value. Ask the students to write them down, adding the prefix de–. Share their understandings.
• Discuss words that can be built by adding suffixes. Note the subtle spelling changes required, e.g. destroy: destroyer, destruction, destructive; despise: despicable; describe: description, descriptive, descriptor;
deprive: deprivation; delegate: delegation; detonate: detonation, detonator; devastate: devastation; delicate: delicateness, delicacy; desperate: desperation; desolate: desolation; destitute: destitution; definite: indefinite.
• Explain the difference between devise (verb) and device (noun), and delegate used as a noun and as a verb.
term 1
lesson 5
■ Pencil WorkThe worksheet focuses on word building, spelling words to match sentence grammar, and word meaning.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 9 and 10.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• descending • devoured• desperately • description• desolation • depriving• definitely • despised
Dictation❥ In this decade, the island has been twice devastated by floods.❥ A timing device was used to detonate the bomb.❥ The family were left destitute after fire destroyed their home.❥ Use detergent in warm water to wash the delicate china plates.
Word extra• development • deleted
■ Word ExtraAdd two to five words to the weekly Warm-ups list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
42 43 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add the noun maker –ion to the following words. Make any necessary spelling adjustments.
demonstrate_____________________________________________ desolate _____________________________________________
devastate _____________________________________________ detonate_____________________________________________
desperate _____________________________________________ delegate _____________________________________________
deprive _____________________________________________ definite _____________________________________________
2 Add the correct endings to the bold words. deprive:Theconvictwas_____________________________________ofhisfreedomforsixyears. definite:Iwill_____________________________________betherebysixo’clock. devise:Scientistsare_____________________________________newwaysofproducingenergy. demonstrate:Hundredsof_____________________________________gatheredinthesquare. devastate:Allhermementosweredestroyedina_____________________________________fire.
3 Choose from the words in the box to complete the sentences correctly.
_____________________________________windsanddamaginghailareexpected. Youcanselectfrommanydifferentcheesesata_____________________________________. Shegavethepolicea_____________________________________ofthepersonwhofledtheaccident. Thequeenworeagownoffinecottonedgedwith_____________________________________lace. Thetsunamicausedthe_____________________________________ofmanyseasidevillages.
4 Fill in the missing letters to match the synonym. de____________________ hate,detest,dislike de________________________ sure,certain,positive de________________ gadget,machine,contraption de________________________portray,show,represent de________________________ lonely,sad,empty,hopeless
Pencil Work 5Name:________________________________________________________________________________
term 1 lesson 5
❂
❂
❂
❂
describedescriptivedescriptiondelicatedelicacydelicatessendestroydestructivedestructiondestruction
Word WorkoutWrite for five minutes.
Do not stop. Do not speak.
Describe your best friend.
ISBN 978 1 76020 452 5
42 43 TargeTing Spelling Year 6 © blake educaTion 2015
term 1 lesson 5 Spelling Corner 10
term 1 lesson 5
Join endings to the base words.
Add the prefix de–. Check any unfamiliar words in a dictionary.
vote ______________________________________________ part ______________________________________________
tour ______________________________________________ code ______________________________________________
pressed ______________________________________________ cent ______________________________________________
port ______________________________________________ crease______________________________________________
formed ______________________________________________ feat ______________________________________________
face ______________________________________________ frost ______________________________________________
void ______________________________________________ liver ______________________________________________
lay ______________________________________________ light ______________________________________________
value ______________________________________________ brief ______________________________________________
serve ______________________________________________ rail ______________________________________________
Spelling Corner 9
descend delegate detonate demonstrate
–s –s –ing –s
–ing –ing –ed –ing
–ed –ed –or –ed
–ant –ion –ion –ion
–ive
ISBN 978 1 76020 452 5
44 45 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board WorkToday, we will look at words that begin with the prefixes inter– and trans–. Remember, prefixes affect the meaning of words.
• inter– means between or together, e.g. interact = act together (We interacted comfortably with each other.), intervene = come between (She quickly intervened to stop the argument.)
• trans– means across, e.g. transport = to carry across. (I use public transport to get to work.) You can translate books from one language to another.
• Prefixes are always spelled in the same way.
• Explain that prefixes are attached to base words or words that have their roots in the early languages of Latin and Greek
■ Book WorkTell the students to open their Word Warm-ups book to page 3, List 6.
• Point out that all their words this week begin with inter– or trans–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Remind students of the e rule and the
doubling rule.
• Ask selected students to spell some verbs from the list with common endings added, e.g. interfering, intercepted, interviewer, intervening, translating, transmitted, transferring.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes.
• Ask the students to close their books and write as many words as they can remember.
• Share and evaluate the results.
interactinterfereinterceptinterruptinterjectintersectinterveneinterviewinterval
transacttransfertransformtransporttranslatetransittransmittransmissiontransparent
Word Warm-ups
Word extra
outburstoutbreak
lesson 6 term 1
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
Teaching notes Focus: Prefixes inter– (between, together), trans– (across)
ISBN 978 1 76020 452 5
44 45 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Discuss words that can be built by adding suffixes, e.g.
interact: interaction, interactive; interfere: interference; intercept: interception; interrupt: interruption; interject: interjection, interjector; intersect: intersection; intervene: intervention; interview: interviewer, interviewee; transact: transactor, transaction; transfer: transference, transferrable, transferee; transform: transformer, transformation; transport: transportation, transportable; translate: translator, translation, translatable; transit: transition; transmit: transmitter, transmittable, transmission; transparent: transparency.
• Discuss the difference in meaning between interact and transact.
• Prepare some Prefix baggies. Write up to 20 words on strips of card. Cut jigsaw fashion between the prefix and the rest of the word. Make several sets. Store in zip-lock bags. Students work in pairs to reassemble and say the words. Words could include: interact, interfere, intercept, interrupt, interject, intersect, intervene, interview, intercede, interface, intersperse, intermittent, intermediate, interlude, interchange, transfer, transact, transport, transform, translate, transfix, transfigure, transparent, transmit, transmitter, transmission, transfuse, transpose, transcribe, transplant, translucent, transgress, transistor.
term 1
lesson 6
■ Pencil WorkThe worksheet focuses on understanding the function and the application of prefixes and suffixes while building vocabulary.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only
at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 11 and 12.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• intercepted • transparent • transferred • interactive• interjection • translator• interval • transmitter
Dictation❥ The interview was interrupted by an important phone call.❥ To transact business in France, he required a translator.❥ Static sometimes interferes with radio transmission.❥ New tunnels and bridges have transformed public transport.
Word extra• outburst • outbreak
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
44 45 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Discuss words that can be built by adding suffixes, e.g.
interact: interaction, interactive; interfere: interference; intercept: interception; interrupt: interruption; interject: interjection, interjector; intersect: intersection; intervene: intervention; interview: interviewer, interviewee; transact: transactor, transaction; transfer: transference, transferrable, transferee; transform: transformer, transformation; transport: transportation, transportable; translate: translator, translation, translatable; transit: transition; transmit: transmitter, transmittable, transmission; transparent: transparency.
• Discuss the difference in meaning between interact and transact.
• Prepare some Prefix baggies. Write up to 20 words on strips of card. Cut jigsaw fashion between the prefix and the rest of the word. Make several sets. Store in zip-lock bags. Students work in pairs to reassemble and say the words. Words could include: interact, interfere, intercept, interrupt, interject, intersect, intervene, interview, intercede, interface, intersperse, intermittent, intermediate, interlude, interchange, transfer, transact, transport, transform, translate, transfix, transfigure, transparent, transmit, transmitter, transmission, transfuse, transpose, transcribe, transplant, translucent, transgress, transistor.
term 1
lesson 6
■ Pencil WorkThe worksheet focuses on understanding the function and the application of prefixes and suffixes while building vocabulary.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only
at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 11 and 12.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• intercepted • transparent • transferred • interactive• interjection • translator• interval • transmitter
Dictation❥ The interview was interrupted by an important phone call.❥ To transact business in France, he required a translator.❥ Static sometimes interferes with radio transmission.❥ New tunnels and bridges have transformed public transport.
Word extra• outburst • outbreak
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
46 47 TargeTing Spelling Year 6 © blake educaTion 2015
Pencil Work 6Name:________________________________________________________________________________
term 1 lesson 6
❂
❂
❂
1 Build these words with prefixes. Check meanings in a dictionary.
2 Now use some of those words to complete these sentences. You may need to add endings. Thedirectors_____________________________________anoffertobuythecompany. Everyonewasincludedintheteam_____________________________________me! Ididalotofresearchformy_____________________________________onearlytransport. Hewasabouttostartanargument,buttheteacher_____________________________________. Thenursegavemean_____________________________________againstswineflu.
3 Complete this table of nouns by adding –ion. Obey the spelling rules.
interrupt_______________________________________________ intervene _______________________________________________
interject _______________________________________________ transit _______________________________________________
intersect _______________________________________________ translate _______________________________________________
transact _______________________________________________ interact _______________________________________________
4 Choose the correct prefix: trans– or inter–. Ienjoyplaying______________________activevideogames. Thesouthbankoftheriverwas______________________formedintoaparkland. Thisbookhasbeen______________________latedfromItalianintoEnglish. Unfortunately,thetennismatchhasbeen______________________ruptedbyrain. Thegreatsportingeventwas______________________mittedtocountriesacrosstheglobe.
❂
interconexpre
cept
__________________________________________
__________________________________________
__________________________________________
__________________________________________
interproinre
ject
__________________________________________
__________________________________________
__________________________________________
__________________________________________
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write ten questions you would ask if you were to interview
the Prime Minister.
ISBN 978 1 76020 452 5
46 47 TargeTing Spelling Year 6 © blake educaTion 2015
translate+or ______________________________________________transfer+ence ______________________________________________transfuse+ion ______________________________________________transfer+able ______________________________________________
transmit+er ______________________________________________transform+ation ______________________________________________intermit+ent ______________________________________________interview+ee ______________________________________________internal+ly ______________________________________________
interchange+able ______________________________________________
interfere+ence ______________________________________________
interact+ive ______________________________________________
term 1 lesson 6 Spelling Corner 12
term 1 lesson 6
Build new words by adding suffixes.Apply your spelling rules.
Add endings to complete these tables.Read your words to a friend.
Don’t forget the rules.
Spelling Corner 11
Add s Add ing Add ed
intervene
transmit
interrupt
translate
transfer
interfere
ISBN 978 1 76020 452 5
48 49 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board WorkToday, we will look at words that begin with the prefixes, com– and con–. Remember, prefixes affect the meaning of words.
• com– and con– mean with or together, e.g. combine = mix together (Combine the flour and milk.), converse = to talk with (He is conversing with his friends.)
• Prefixes are always spelled in the same way.• Explain that prefixes are attached to base
words or words that have their roots in the early languages of Latin and Greek.
complycomplexcompletecomputecomperecommendcommunicatecomplicatecompulsory
conferconfirmconserveconsiderconditionconsciousconfiscatecongratulateconvalesce
Word Warm-ups
Word extra
compareconstruct
lesson 7 term 1
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 4, List 7.
• Point out that all of their words this week begin with con– or com–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Remind students of the e rule and the y rule.
• Ask selected students to spell some words from the list with common endings added, e.g. completing, complied, computer, complicated, conferring (note we double the r), congratulating, convalesced.
Closed Book Work• Ask the students to silently read through the
list twice.
• With books closed, ask them to write three words beginning with com– and three words beginning with con–.
• Evaluate the results.
Teaching notes Focus: Prefixes com–, con– (with, together)
ISBN 978 1 76020 452 5
48 49 TARGETING SPELLING YEAR 6 © BLAKE EDUCATION 2015
■ Word Work• Discusswordsthatcanbebuiltbyaddingsuffixes,e.g.
comply: compliance, compliant; complex: complexity, complexion; complete: completeness, completion; compute: computer, computation; commend: commendable, commendation, recommend, recommendation; communicate: communication, communicative, non-communicative; complicate: complication, uncomplicated; confer: conference; confirm: confirmation, unconfirmed; conserve: conservation, conservationist, conservative;
consider: considerable, consideration, considerate, inconsiderate, reconsider; condition: conditional, unconditional; conscious: consciousness, unconscious, unconsciousness; confiscate: confiscation; congratulate: congratulations, congratulatory; convalesce: convalescence.
• Write this list of base words on the board: plain, fuse, descend, pose, sequence, pare, fine, pact, cave, current, bat, front, pile, tour, trite.Askstudents,individually,toaddthecorrectprefix, con– or com–,tomakeanotherword.Asaclass,discusstheresults.
TERM 1
LESSON 7
■ Pencil WorkThe worksheetfocusesonwordbuilding,spellingwordstomatchsentencegrammar,andwordmeaning.
WordWorkoutAskthestudentstowriteaboutthesettopicforfiveminutes.Writingshouldbeuninterrupted.Studentsmust notaskforadviceorhelp.Thinkingneedstobespontaneous.Theyneedtoget“intotheflow”.Shareonlyattheend.Thisisatimeforstudentstoshowwhattheyknowaboutspelling.
SpellingCornerLearningisreinforcedbySpellingCorneractivities13 and14.
PracticeWorkUsewordgamesandotheractivitiestobuildskillsandstrategies(seeIntroduction,pages6,7,9and10forideas).
■ Assessment Usetheassessmentitemstochecktheprogressofyourstudents. Dictate the
wordsandsentences,andusetheresultstodiagnoseproblems,interveningifnecessary.Chooseallitemsormakeaselectiontosuittheneedsofyourclass.
Focus Words• complicated • communication• confiscate • convalescing• compliance • unconfirmed• conserving • commendable
Dictation❥ Sheisconsciousandherconditionisstable.❥ Icongratulateyouoncompletingthiscomplexcomputergame.❥ Votingisnotcompulsorybutitisrecommended.❥ Would you consider being the compere of our school concert?
Word Extra• comparison • construction
■ Word ExtraAddtwotofivewordstotheweeklyWarm-upslist.Thesewordsmaybeselectedfromcurriculumcontent,fromthesightwordorinternationalwordlistsintheWordWarm-upsbookorrevisionarywordsfrompreviousspellingprograms.Tworevisionarywordsareofferedhere.
Y6-TS-Lessons.indd 49 16/02/2017 11:58 AM
ISBN 978 1 76020 452 5
50 51 TargeTing Spelling Year 6 © blake educaTion 2015
Pencil Work 7Name:________________________________________________________________________________
term 1 lesson 7
❂
❂
❂
1 Highlight the correct prefix.
Theteachercomcon fiscatedthecom
con icIhadundermydesk!
Hewenttotheseasidetocomcon pletehiscom
con valescence.
Jordanisacomcon pliantstudentandisalwayscom
con siderate.
Weattendedacomcon ferencetodiscussthelatestcom
con puterhardware.
Ihavetocomcon cedethatthisgameisfartoocom
con plicatedforme!
2 Complete this table.Add s Add ed Add –ation
confirm
consider
combine
conserve
3 Join the word parts to build new words. Remember the spelling rules. confer+ence ________________________________ comply+ance ________________________________
commune+ity ________________________________ in+complete ________________________________
complex+ity ________________________________ in+consider+ate ________________________________
recommend+ation ________________________________ un+condition+al ________________________________
conserve+ation ________________________________ re+conditioned ________________________________
4 Complete the words using the sentences as a clue. com________e____________ Yourassignmentmustbe_____________byFriday. comp____________ Heisthe_____________ofapopularTVquizshow. com________________r Granthasabrandnewlaptop_____________. con____________v____ Itisimportantto_____________water,notwasteit. uncon____________o________ Hewasknocked_____________byafallingbeam.
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about something you have constructed, such as a Lego house.
❂
ISBN 978 1 76020 452 5
50 51 TargeTing Spelling Year 6 © blake educaTion 2015
term 1 lesson 7 Spelling Corner 14
term 1 lesson 7
Add the suffix –ation or –ion.
Write the base word in each of these words (e.g. concealment, conceal).
Spelling Corner 13
computer ______________________________________________ inconsiderate ______________________________________________
complexity ______________________________________________ unconditional ______________________________________________
compliance ______________________________________________ unconsciously ______________________________________________
completion ______________________________________________ recommendation______________________________________________
committee ______________________________________________ discontinued ______________________________________________
congratulations______________________________________________ inconsistent ______________________________________________
continuous ______________________________________________ incomplete ______________________________________________
Add –ation Add –ion
consider complete
confront confiscate
commend construct
confirm communicate
converse congregate
consult company
conserve complicate
continue contemplate
ISBN 978 1 76020 452 5
52 53 TargeTing Spelling Year 6 © blake educaTion 2015
Teaching notes Focus: Greek and Latin roots mito or missus (I send), pes or pedis (foot)
■ Board Work• Explain that many words used in English
today have their roots or origins in the early languages of Greek and Latin.
• Today we will study two groups of words with Greek and Latin roots.
• Write mito and missus – I send on the board and explain how this is the root of a number of words we use today in English. Write the words emit, permit, dismiss, missile and circle the mit or miss in each word. Discuss meaning.
• Write pes and pedis – the foot on the board and explain how this is the root of a number of words we use today in English. Write the words pedal, pedlar, expedition, centipede and circle the ped in each word. Discuss meaning.
commitpermitremitremissdismissmissilemissionintermissionintermittent
pedalpedestalpedlarpedestrianexpeditionimpedecentipedemillipedestampede
Word Warm-ups
Word extra
emittransmit
lesson 8 term 1
■ Book WorkTell the students to open their Word Warm-ups book to page 4, List 8.
• Point out that all of their words this week have Greek or Latin roots.
• Work through the words in the list. Explain unfamiliar words.
• It is important to use both your eyes and your ears to learn to spell these words correctly.
• Chant the words together, keeping a steady pace.
Open Book WorkAsk selected students to spell words from the list with endings added, e.g. committed, permitting, dismisses, pedals.
Many English words have their origins, or roots, in the early
languages of Latin and Greek.e.g. age: postage village cottage
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
On some days, ask the students to work in pairs and choose a list to
read softly together or to each other.
ISBN 978 1 76020 452 5
52 53 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word WorkExplore word building, e.g. mitto or missus: commitment, committee, uncommitted; permission, permissible; remittance; remission; dismissal, dismissive; pes or pedis: expeditionary; impediment, unimpeded.
term 1
lesson 8
■ Pencil WorkThe worksheet focuses on word meaning, correct grammatical use, spelling and etymological knowledge.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 15 and 16.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• stampede • intermittent• missile • committee• impediment • admitted • permission • mission
Dictation❥ Both centipedes and millipedes have many legs.❥ Pedlars are not permitted to sell their wares in the inner-city streets.❥ Wet weather impeded the expedition through the rainforest.❥ He pedalled his bike across the pedestrian crossing.
Word extra• emit • transmit
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
54 55 TargeTing Spelling Year 6 © blake educaTion 2015
Pencil Work 8Name:________________________________________________________________________________
term 1 lesson 8
❂
❂
❂
1 Add the correct endings to the incomplete words. Rainfellintermittent_____________allday. Whenclasswasdismiss_____________,Jaypedal_____________homequickly. Youarenotpermit_____________tothrowpapermissile_____________. Thisticketwillgainyouadmit_____________tothenextfourmatches. Acommit_____________hasbeenformedtoplanthenewsportsstadium.
2 Write sentences to show the difference in meaning between the words. pedalpeddle pedestalpedestrian
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
3 Put in the missing vowels using the sentences as clues. A_____________isacreaturewithmanylegs. c____nt____p____d____
Wemetourfriendsinthefoyerat_____________. ____nt____rm____ss________n Spookedbyahelicopter,thebrumbies_____________. st____mp____d____d Scottledan_____________totheSouthPole. ____xp____d____t________n Crossthestreetatthe_____________crossing. p____d____str________n
4 Sort these words into the four word families. admitcommitteemissiondismisscommittalmissionarydismissal admittanceintermissionadmissioncommitmentdismissive
_________________________________
_________________________________
_________________________________
_________________________________
_________________________________
_________________________________
_________________________________
_________________________________
_________________________________
_________________________________
_________________________________
_________________________________
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write a report under the headline Football Fans Stampede.
ISBN 978 1 76020 452 5
54 55 TargeTing Spelling Year 6 © blake educaTion 2015
term 1 lesson 8 Spelling Corner 16
term 1 lesson 8
Build these words.
Add endings to complete this table of verbs.
Spelling Corner 15
Obey your spelling rules!
Add s or es Add ing Add ed
admit
commit
permit
emit
transmit
stampede
dismiss
adreperetrans
__________________________________________
__________________________________________
__________________________________________
__________________________________________
__________________________________________
mit
adreperetrans
__________________________________________
__________________________________________
__________________________________________
__________________________________________
__________________________________________
mission
ISBN 978 1 76020 452 5
56 57 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• Write the words operate, demonstrate,
elevate, irrigate on the board, asking the students to note they all end in –ate. Ask a student to read the words.
• Notice that these words are verbs.
• Notice how we stress (or emphasise) the last syllable and “slur” over the middle part of the word.
• Remind them that this slurring over the sound is called a schwa sound, and is very common in English.
• Write the words advertise, sympathise, emphasise, authorise on the board, asking the students to note they all end in –ise. Ask a student to read the words.
• Notice that these words are also verbs.
• Notice that again we stress (or emphasise) the last syllable.
• It is important to use both your eyes and your ears to learn to spell these words correctly.
Word Warm-ups
Word extra
energychemist
lesson 9 term 2
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 4, List 9.
• Point out that all their words this week end in –ate or –ise. These are usually verb-forming suffixes. Point this out on the suffixes chart (see CD).
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkRemind students of the e rule. Ask the students to spell selected words from the list with endings added, e.g. operating, irritating, separating, advertisers, recognised, analysing.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes.
• Ask the students to close their books and write as many words as they can remember.
• Share and evaluate the results.
operateinvestigateirritateestimateexcavatenavigateseparatepopulatenominate
advertiseapologisecriticiseorganiserecogniseminimiseexerciseterroriseanalyse
Teaching notes Focus: Verb suffixes –ate, –ise
Use your eyes especially to spell the middle part of
words correctly.
ISBN 978 1 76020 452 5
56 57 TARGETING SPELLING YEAR 6 © BLAKE EDUCATION 2015
■ Word WorkExplore word building, e.g. operate: operation, operative, cooperate; investigate: investigation, investigative, investigator; irritate: irritable, irritability, irritation; estimate: estimation; excavate: excavation, excavator; navigate: navigation, navigator, navigable; separate: separation, separator, separatist; populate: population, popular; nominate: nomination, nominee, denomination, denominator; advertise: advertiser, advertisement; apologise: apology, apologetic, apologetically; criticise: critical, uncritical, critically, critic, criticism; organise: organisation, organisational, organiser, disorganised; recognise: recognition, recognisable, unrecognisable; minimise: minimal, minimum; terrorise: terrorist, terrorism; analyse: analysis, analyst.
TERM 2
LESSON 9
■ Pencil WorkThe worksheet focuses on word meaning, word building and correct grammatical use.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 17 and 18.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• excavate • navigator• apologies • estimates• exercising • separated• criticised • minimise
Dictation❥ The police are investigating the terrorist organisation.❥ He was irritated by all the criticism he received.❥ I must apologise for not recognising you when you arrived.❥ TV advertising reaches much of the population.
Word Extra• energy • chemist
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
It’s easy to change verbs ending in –ate to nouns, e.g. operate, operation; populate, population.
Y6-TS-Lessons.indd 57 16/02/2017 11:58 AM
ISBN 978 1 76020 452 5
58 59 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add the endings to complete this table.Add ing Add –ion
investigate
excavate
irritate
separate
2 Complete these sentences. Build on the words in the box. apologise Heofferedasincere________________________________________forhispoorbehaviour. advertise Ireadan________________________________________fortheholidayinthismagazine. operate Thesurgeonperformedafive-hour________________________________________. criticise Dandoesnotlike________________________________________ofanykind! terrorise Severalpeoplewereinjuredinthe________________________________________attack.
3 Choose from the words in the box to complete the sentences correctly.
Scientistswill________________________________________thestrange,luminousrocksfromspace. Myteacherisnever________________________________________ofmyeffortsasanartist. The________________________________________ofthatcountryexceeds20million. Ireallymust________________________________________forbeinglate. Socceristhemost________________________________________gameintheworld.
4 Write these words. Check the meaning of any unfamiliar words.
Pencil Work 9Name:________________________________________________________________________________
term 2 lesson 9
❂
❂
❂
❂
criticisecriticalcriticismapologiseapologeticapologypopulatepopularpopulationanalyseanalystanalysis
__________________________________________
__________________________________________
__________________________________________
iseistism
organ
__________________________________________
__________________________________________
__________________________________________
iseistism
terror
__________________________________________
__________________________________________
__________________________________________
isealum
minim
__________________________________________
__________________________________________
__________________________________________
isealism
critic
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about a sport that is popular at your school.
ISBN 978 1 76020 452 5
58 59 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 9 Spelling Corner 18
Add the noun maker –ion. Use a dictionary to check the meaning of any unfamiliar words.
Join endings to the base words.
term 2 lesson 9 Spelling Corner 17
nominate______________________________________________ irrigate ______________________________________________
operate ______________________________________________ interrogate ______________________________________________
generate ______________________________________________ populate ______________________________________________
elevate ______________________________________________ separate ______________________________________________
excavate ______________________________________________ renovate ______________________________________________
regulate ______________________________________________ innovate ______________________________________________
filtrate ______________________________________________ demonstrate ______________________________________________
illustrate ______________________________________________ educate ______________________________________________
operate terror advertise organ
–s –ist –ment –ist
–ed –ism –ing –ism
–ing –ise –er –ic
–ion –ise+–ing –ed –ise
–ion+–al –ise+–ation
ISBN 978 1 76020 452 5
60 61 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• Write the words solo, polo, hero, zero, pesto,
asking the students to note they all end in o. Ask a student to read the words.
• Notice that the o at the end of the word is pronounced as a long vowel.
• It is important to use both your eyes and your ears to learn to spell these words correctly.
Word Warm-ups
Word extra
searchworst
lesson 10 term 2
■ Book WorkTell the students to open their Word Warm-ups book to page 5, List 10.
• Point out that all their words this week end in o. These endings are usually found on the end of nouns.
• Work through the words in the list. Explain unfamiliar words.
• To help students learn to spell cappuccino correctly, point out that there is a cup (the u) in the middle to hold the coffee. To assist memory, tell them cappuccino has 1 Cup with 2 Ps and 2 Cs on either side.
• Chant the words together, keeping a steady pace.
• Point out that these words have different plural forms. Some add s and some add es.
• Tell the students that the plural of words in the top set is formed by adding s. give examples.
• Tell the students that the plural of words in the bottom set are usually formed by adding es. Give examples.
• Point out, however, that some of these words can be spelled either way, namely, cargoes (cargos), tornadoes (tornados), avocadoes (avocados), volcanoes (volcanos).
Open Book WorkAsk the students to spell selected words from the list in their plural form, e.g. solos, pianos, photos, studios, echoes, cargoes, potatoes, tomatoes, volcanoes.
solosilocellophotopianoradiostudiostereocappuccino
heroechopotatotomatoembargocargotornadoavocadovolcano
Words ending in ohave different plural forms. Some add s and some add es.
You will need to remember what these words LOOK LIKE.
Teaching notes Focus: Words ending in o
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
ISBN 978 1 76020 452 5
60 61 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word WorkExplore some word building, e.g. soloist, pianist, cellist, photograph, photography, photographer, radiography, radiographer, studious, student, stereophonic, stereotype, heroine, heroic, volcanic.
term 2
lesson 10
■ Pencil WorkThe worksheet focuses on the spelling of words ending in o and their plural forms, and word building.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 19 and 20.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• soloist • echoing• cargoes (cargos)• embargo • stereo• tornadoes (tornados)• photos • heroes
Dictation❥ She played a solo on her cello in the recording studio.❥ I bought tomatoes and avocadoes (avocados) at the market.❥ I listened to beautiful piano music on the radio.❥ The volcanic eruption destroyed their potato crops.
Word extra• search • worst
■ Word ExtraAdd two to five words to the weekly Warm-ups list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
62 63 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 10 Pencil Work 10Name:________________________________________________________________________________
❂
❂
❂
1 Write the plural form of these words. photo ________________________________________ potato ________________________________________
volcano ________________________________________ hero ________________________________________
cargo ________________________________________ cello ________________________________________
studio ________________________________________ tomato ________________________________________
echo ________________________________________ silo ________________________________________
2 Add suffixes to build new words. hero+ism ________________________________________ hero+ine ________________________________________
piano+ist ________________________________________ solo+ist ________________________________________
cello+ist ________________________________________ stereo+phonic________________________________________
3 Name the following items.
____________ ____________ ____________ ____________
____________ ____________ ____________ ____________
4 Spell the missing words. All words end in o. Aloneunderthespotlight,shegaveafines______________________performance. Thegovernmentplacedane_____________________________ontheexportofnativewildlife. Ihadfish,p____________________________chipsandalettuceandt____________________________salad. Iheardonther_________________________thatav_____________________________haderupted. At__________________________________sweptacrossthecountry,rippinghousesandshedsapart.
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about a musical instrument you play or would like to play.
ISBN 978 1 76020 452 5
62 63 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 10 Spelling Corner 20
Find and fix the eight spelling mistakes.Write the correct spelling on the lines.
Write two or three sentences about one of the following topics.
term 2 lesson 10 Spelling Corner 19
The Piano
Thepianoisakeybordinstrumentinwhichsoundsaremadebystringsbeingstrukbysmall,paddedhammers.Thepianiststrikesthekeys,whichoperateleversthatmoovthepaddedhammers.
Themettlestringsaremountedonaframe.Thesestringsvibrateandprodusediffrentmusicalnotes.Theloudnessoftonedependsonhowhardthepianiststrikesthekeys.
Apianistcanplayamelodyandaharmonyatthesametime.Thepianocanproduceagraterangeofmusicalsoundsandiswellsuitedtotheconcertpianist,whousualyperformssoloatapianorecital.
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
■InsideaTVstudio ■Fleeingthevolcano■Goingsolo ■Survivingatornado
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
ISBN 978 1 76020 452 5
64 65 TargeTing Spelling Year 6 © blake educaTion 2015
Teaching notes Focus: Suffix –fy (to make or cause to be)
■ Board Work Today, we will look at words that end with the suffix –fy. Remember, suffixes change the grammar of words. The suffix –fy usually signals a verb. Point this out on the suffix chart (see CD).
• Explain that the suffix –fy means to make or cause to be. Give examples: clarify = to make clear; simplify = to make simple; terrify = to cause terror.
• Explain that suffixes are attached to base words or words that have their roots in the early languages of Latin and Greek.
• Discuss the rule for adding endings to verbs ending in y.
(i.e. Change y to i before adding -es or –ed. Do NOT change the y to add –ing)• Complete the following table with the
students:
Word Warm-ups
Word extra
fulfilseldom
lesson 11 term 2
■ Book WorkTell the students to open their Word Warm-ups book to page 5, List 11.
• Point out that all of their words this week end in –fy.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkReview the y rule. Ask selected students to spell some verbs from the list with common endings added, e.g. signifying, simplifies, modified, qualifier, terrifying, testifies, classified.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes.
• Ask the students to close their books and write as many words as they can remember.
• Share and evaluate the results.
signifysimplifymagnifymodifynotifyqualifyjustifyidentifyterrify
defyintensifyhorrifymystifyverifypacifytestifyclarifyclassify
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
Verb Add –ing Add –es Add -ed
magnify qualify terrify notify
classify
ISBN 978 1 76020 452 5
64 65 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Discuss how we can change verbs to nouns by adding
a suffix. For verbs ending in –fy, we most often change the y to i and add c-a-t-i-o-n.
Work through some examples on the board.
verb noun
simplifymagnifymodifyidentify
simplificationmagnificationmodificationidentification
• Now ask the students to change these verbs to nouns in the same way: justify, notify, classify, clarify, qualify. Check their understanding.
• Explore word families, e.g. terrify: terrific; horrify: horrific; pacify: pacific, pacifier; justify: justifiable, unjustified; identify: identifiable, unidentified, identity, identification; intensify: intensity; signify: significant, insignificant, significance, insignificance; magnify: magnification, magnificent, magnificence; qualify: disqualify; defy: defiant, defiance; verify: verifiable, verification.
term 2
lesson 11
■ Pencil WorkThe worksheet focuses on understanding and applying the y rule, word meaning (synonyms) and word building.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 21 and 22.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
Remember the y rulewhen adding to verbs
ending in –fy. dignify dignified
defy defiant
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• pacify • testifying• justified • mystified• classification • defiant• simplify • modifies
Dictation❥ He used a magnifying glass to identify the tiny insect.❥ He raised a hand to signify that I had been disqualified.❥ People were terrified as the cyclone intensified.❥ Stan was notified of the horrifying events by phone.
Word extra• fulfil • seldom
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
Verb Add –ing Add –es Add -ed
magnify qualify terrify notify
classify
ISBN 978 1 76020 452 5
66 67 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 11 Pencil Work 11Name:________________________________________________________________________________
❂
❂
❂
❂
1 Use the y rule to complete this table by adding the endings.Add ing Add ed Add –cation
simplify simplifying simplified simplification
identify
modify
qualify
verify
2 Match these words to their meanings. modify boost,enlarge,exaggerate,amplify mystify tell,advise,instruct,inform classify alter,adjust,vary,adapt magnify sort,order,list,arrange,file notify baffle,confuse,perplex,confound
3 Build new words by adding prefixes and suffixes. Remember to use the y rule.
dis+qualify ____________________________________ un+justify+ed ____________________________________
defy+ant ____________________________________ defy+ance ____________________________________
signify+ic+ant ____________________________________ signify+ic+ance____________________________________
de+classify ____________________________________ magnify+ic+ent____________________________________
4 Here are three different word families: sign, just, identify. Using three different colours, highlight the words that belong in each family.
signature unidentified injustice unjustly
justifiable signal identity significant
identifiable justification signatory identification
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write a terrible tale about a toothless tiger.
ISBN 978 1 76020 452 5
66 67 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 11 Spelling Corner 22
Be a word builder.Write the words. Use the y rule.
Change these verbs to nouns.
Spelling Corner 21
simplify simplification
clarify ______________________________________________
verify ______________________________________________
identify ______________________________________________
notify ______________________________________________
qualify ______________________________________________
modify ______________________________________________
magnify ______________________________________________
defyant ____________________________________________
ance____________________________________________
verifyable ____________________________________________
ed ____________________________________________
terrifyic ____________________________________________
ing ____________________________________________
justifyed ____________________________________________
able ____________________________________________
horrifyic ____________________________________________
ed ____________________________________________
magnifycent ____________________________________________
cence____________________________________________
pacifyic ____________________________________________
er ____________________________________________
term 2 lesson 11
ISBN 978 1 76020 452 5
68 69 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• Review the hard and soft sounds of g and c.
Write g and c on the board. • Here are two consonants that each have two
different sounds – a hard sound and a soft sound.
• Write girl, goat, gate, bag on the board and ask a student to read the words while the other students listen for the sound of the g in each word. Establish that this is the hard g sound.
• Write gel, cage, strange, gypsy, giant on the board and ask a student to read the words while the other students listen for the sound of the g in each word. Establish that this is the soft g sound. The g is soft when followed by e, i or y.
• Write these words on the board: garbage, guest, judge, organise, arrangement. Ask which words have a soft g sound.
• Write coat, candle, caught, picnic on the board and ask a student to read the words while the other students listen for the sound of the c in each word. Establish that this is the hard c sound.
• Write city, cell, cycle, cent, face on the board and ask a student to read the words while the other students listen for the sound of the c in each word. Establish that this is the soft c sound. The c is soft if it is followed by an e, i or y.
• Write these words on the board: carrots, cyclone, captain, comb, rice, collect. Ask which words have a soft c sound.
Word Warm-ups
Word extra
centregeneral
lesson 12 term 2
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 5, List 12. • Work through the top set. Remind the
students that a soft g is followed by an i, e or y.
• Work through the bottom set. Remind the students that a soft c is followed by an i, e or y.
• Explain any unfamiliar words.
Open Book WorkAsk the students to refer to their list and spell some words with common endings added. Remind them of any rules that might apply, e.g. urgently, obliging, emerging, policies, celebrating, successes.
Closed Book Work• Divide the class in half. Ask one half to study
the soft c words, and the other the soft g words. Allow three minutes for silent study.
• Ask the students to write down as many words as they can remember from the list. Evaluate their learning.
arrangeagendadigitalurgentengineregionobligeemergelegend
accidentincidentpolicepolicyfacilityterracecerealcelebratecentury
Teaching notes Focus: Soft g (page), soft c (race)
ISBN 978 1 76020 452 5
68 69 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Discuss the idea of words being grouped together in a “family” – the base or stem
of the word remains the same but different prefixes or suffixes can be added to change the way we use the word, e.g. arrange: arrangement; urgent: urgency; engine: engineer, engineering; oblige: obligation, obligatory; emerge: emergency, emergent; legend: legendary; accident: accidental; incident: incidental; success: successful, successive, succession; celebrate: celebration, celebratory.
• Point out the difference between cereal and serial.
term 2
lesson 12
■ Pencil WorkThe worksheet focuses on plural forms, word building and the spelling of words in context.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 23 and 24.
Practice Work Use word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
When c or g is followed by an e, i or y,
they have soft sounds. city, centre, cycle
germs, ginger, gym
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• obliging • legends• cereal • century• digital • policies • celebrating • arrangement
Dictation❥ There are several items of urgent business on the agenda.❥ The police dealt with the incident at the terrace house.❥ A state of emergency was declared after fire swept the region.❥ Rice is grown in terraces in many regions of Asia.
Word extra• centre • general
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
70 71 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add a suffix to the words in the box to complete the sentences correctly. success Thepolicemanretiredafteralongand____________________________________career. policy Thegovernmentintroducedseveralnew____________________________________. engine Mydadisan_________________________________intheBridge-across-the-Bayproject. region Ourhockeyteamiscompetinginthe____________________________________finals. arrange Thelibrarianis____________________________________thebooksinalphabeticalorder.
2 Put in the missing letters using the sentences as clues. Fortunately,no-onewasinjuredinthecar____________. a____________d________t Craigwasbornatthebeginningofthis____________. c________t________y Jo____________thechairsinrowsoften. a________________g________
Theambulancetookthemantothe____________ward. em________________n____y Manybreakfast____________aremadefromrice,wheatandcorn. c____r____________s
3 Write these words in plural form. success ____________________________________ century ____________________________________
cereal ____________________________________ incident____________________________________
policy ____________________________________ terrace ____________________________________
accident ____________________________________ legend ____________________________________
emergency ____________________________________ region ____________________________________
4 Build new words by adding suffixes. Spelling alert!
term 2 lesson 12 Pencil Work 12Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes.
Do not stop. Do not speak.
Write the story behind one family photo.
celebrate_____________________________________________
_____________________________________________
ionory
_____________________________________________
_____________________________________________
menter
arrange
_____________________________________________
_____________________________________________
ationatory
oblige
_____________________________________________
_____________________________________________
sary
legend
ISBN 978 1 76020 452 5
70 71 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 12 Spelling Corner 24
Spell the missing words.
Add the endings to complete this table.
term 2 lesson 12 Spelling Corner 23
LastSaturday,therewasana____________________________________involvingtwocarsandatruck.Onewitnessmadeanu____________________________________calltothep____________________________________.Anothercalledanambulance.
Theambulancetookthethreev____________________________________tothee____________________________________wardatthelocalh____________________________________.
Onecarburstintoflamesandafiree____________________________________wascalledtothescene.Thefirewassoonextinguished.
Thepolicequestionedeyewitnessesaboutthei____________________________________.
Onewitnesshadrecordedthemomentofthecrashonhisd____________________________________camera.
Add s or es Add ing Add ly
terrace arrange digital
facility incite regional
engine oblige accidental
policy police incidental
ISBN 978 1 76020 452 5
72 73 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• Write the words conductor, director, editor,
instructor on the board, asking the students to note they all end in or. Ask a student to read the words.
• Point out that the –or used here is a noun-forming suffix and means one who. So one who conducts is a conductor, one who edits is an editor and so on. Refer students to the suffixes chart (see CD).
• Notice how we stress (or emphasise) the first syllable and “slur” over the end of the word.
• Remind them that this slurring over the sound is called a schwa sound, and is very common in English.
• Because we often slur over the endings of these words, we can easily confuse them with words ending in –ar.
• Write the words dollar, cellar, beggar, mortar and ask the students to note that they all end in –ar.
• Again we stress the first sound and “slur” over the end.
• Because the end of both groups of words sound the same, it is important to use both your eyes and your ears to learn to spell these words correctly.
Word Warm-ups
Word extra
authordollar
lesson 13
term 2
■ Book WorkTell the students to open their Word Warm-ups book to page 6, List 13.
• Point out that all their words this week end in –or or –ar.
• Work through the words in the list. Explain unfamiliar words. Tell the students to especially note the difference in the homophones sensor and censor.
• Chant the words together, keeping a steady pace.
Open Book WorkAsk the students to spell the plural form of selected words ending in –or and –ar and some with other endings, e.g. regularly, similarly.
Closed Book Work• Write two words from each set on the board.• Allow one minute to view the words.• Rub the words off the board and ask students
to write what they can remember.• Evaluate the results.
tenorvendorsensorcensorsculptorsolicitorsurvivorgovernorcommentator
liarscholarnectarregularsingularsimilarspectacularperpendicularbinoculars
Teaching notes Focus: Suffixes –or, –ar
Use your eyes especially to spell the end part of
words correctly.
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
On some days, ask the students to work in pairs and choose a list to
read softly together or to each other.
ISBN 978 1 76020 452 5
72 73 TARGETING SPELLING YEAR 6 © BLAKE EDUCATION 2015
■ Word WorkIdentify the base of selected words and explore word building, e.g. govern: governor, government, governmental; sculpt: sculptor, sculpture; solicit: solicitor, solicitous, unsolicited; survive: survivor, survival; censor: censorship; sense: sensor, sensitive, sensitivity; comment: commentator, commentary; similar: similarity, dissimilar; regular: regularity, irregular, irregularity; scholar: scholarship, scholarly; spectacle: spectacles, spectacular.
TERM 2
LESSON 13
■ Pencil WorkThe worksheet focuses on words and word meanings and spelling of words ending in –or and –ar.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 25 and 26.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• solicitor • similar • spectacular • liars • nectar • government • censorship • singular
Dictation❥ The sculptor carved a statue of the governor in white marble.❥ The tenor won a scholarship to study singing at the university.❥ There were no survivors of the plane crash over the Atlantic Ocean.❥ The sports commentator gave regular updates of the state of play.
Word Extra• author • dollar
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
Y6-TS-Lessons.indd 73 16/02/2017 11:59 AM
ISBN 978 1 76020 452 5
74 75 TargeTing Spelling Year 6 © blake educaTion 2015
1 Name the following: amalesingerwithahighvoice _______________________________________
apersonwhoadvisesclientsinlegalmatters _______________________________________
apersonwhorepresentstheQueeninastateofAustralia _______________________________________
apersonwhotellslies _______________________________________
sweetliquidfromaflower _______________________________________
2 Add the correct suffix, –or or –ar. Regul___________exercisewillkeepyoufitandhealthy. Onesurviv___________oftheplanecrashtoldoftheterrifyingevents. Mynewsneakersaresimil___________totheonesyouarewearing. Iboughtthisleatherwalletfromastreetvend___________. Thecommentat___________keptusuptodatewithalltheactioninthecyclerace.
3 Join the word parts. Write the meaning of each new word. Use your dictionary.
nectar+ine ____________________________________________________________________________________________________________________
dis+similar ____________________________________________________________________________________________________________________
ir+regular ____________________________________________________________________________________________________________________
govern+ess ____________________________________________________________________________________________________________________
scholar+ship ____________________________________________________________________________________________________________________
censor+ship ____________________________________________________________________________________________________________________
4 Add the endings to complete this table of words.
Add ing Add ed Add –or
survive
sculpt
govern
sense
commentate
term 2 lesson 13 Pencil Work 13Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about a place you visit regularly.
ISBN 978 1 76020 452 5
74 75 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 13 Spelling Corner 26
Spot the 13 spelling mistakes.Write the correct words on the lines below.
Write as many words as you can, using the letters in the word below.Letters can only be used once in any one word.
Sleepandregularexercizeareessenshalforgoodhealth.Thesenatersvotedagainsttheproposednewtaxes.Allthesurvivorshavebeentakentohospatilsthroughoutthecity.Wehadaspectacularveewofthevalleyfromthemountainlookout.Abirdwatcherusuallycarrysapairofbinoculers.Ihavejustbortashirtthatissimilatoyours.Wemeetregulyattheparktorideourskatebords.Theguvernorwasaskedtoofficilyopenthenewbridge.
term 2 lesson 13 Spelling Corner 25
commentator
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
The record is 140!
ISBN 978 1 76020 452 5
76 77 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Discuss how we can often change adjectives
to adverbs by adding –ly. • Work through some examples on the board.
• Now ask the students to change these adjectives to adverbs in the same way: impulsive, impressive, expensive, productive, pensive. Check their understanding.
Teaching notes Focus: Adjective suffix –ive; Prefixes mono–, bi–, micro–
■ Board Work Today, we will look at words that end with the suffix –ive. Remember, suffixes change the grammar of words. The suffix –ive usually signals an adjective. Refer students to the suffixes chart (see CD).
• Explain that the suffix –ive means having to do with. Give examples: active = having to do with action; responsive = having to do with responding.
• Explain that the suffixes are attached to base words or words that have their roots in the early languages of Latin and Greek.
• Today, we will also look at words that begin with the prefixes mono– (meaning one), bi– (meaning two) and micro– (meaning small).
Remember, prefixes change the meanings of words.
Word Warm-ups
Word extra
activeselective
lesson 14
term 2
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 6, List 14.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkReview the e rule. Remind the students that we only drop the e before adding ing and y. Ask selected students to spell some words with common endings added, e.g. attractively, expressively, productively, monologues, microscopes.
attractivesensitiveintensiveimpressiveimperativeexpressivepensiveexpensiveproductive
monopolymonotonemonologue
bicyclebiennialbilingual
microscopemicrophonemicrowave
Remember the e rule when adding suffixes.
productively productivity
verb noun
activeattractivesensitiveintensive
activelyattractivelysensitivelyintensively
ISBN 978 1 76020 452 5
76 77 TargeTing Spelling Year 6 © blake educaTion 2015
Word Work Continued• Explore some word families, e.g. attraction,
attractiveness, unattractive; sensitivity, sensitiveness, insensitive, sensation, sensational; intensive, intensity; impression, impressiveness, unimpressive; expression, expressiveness; product, production, unproductive; monopoly, monopolise; microscope, microscopic.
• Explain the difference between monologue and dialogue, bisect and dissect, biennial and biannual, bilingual and multilingual.
term 2
lesson 14
■ Pencil WorkThe worksheet focuses on antonyms, word meaning, word building and the use of more and most to show comparative adjectives.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. They need to get “into the flow”. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 27 and 28.
Practice Work Use word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• microscope • productive• sensitive • unattractive• bilingual • intensively• microphone • expression
Dictation❥ The monologue was long and tedious, and he spoke in a monotone.❥ It is imperative that your bicycle brakes are in good working order.❥ Her attractive red sports car was very expensive.❥ The skating championships are impressive biennial events.
Word extra• actively • selective
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
78 79 TargeTing Spelling Year 6 © blake educaTion 2015
1 Write the correct prefix, in– or un–, to complete the antonyms. Whenwefinallysawthehouse,itlookeddraband____________attractive. Atthistimeoftheyear,grapesareplentifuland____________expensive. TheirperformanceintheWorldCupgamewas____________impressive. Poorsoilandlowrainfallmakethisareaquite____________productive. Onlyan____________sensitivepersonwouldnotfeelsorryfortheirplight.
2 Add suffixes to build new words. Spelling alert! monotone+ous _____________________________________ sensitive+ity _____________________________________
microscope+ic _____________________________________ bisect+ion _____________________________________
productive+ity _____________________________________ attractive+ness _____________________________________
expressive+ness_____________________________________ active+ity _____________________________________
3 Match the words to their meanings. biennial alongtalkbyoneperson biannual cutintotwoequalparts monologue twiceayear dialogue cutintopiecestoexaminetheparts bisect conversationbetweenpeople dissect onceeverytwoyears
4 Add more or most to show comparison. Sarahisthe__________________________attractivegirlinourclass. Theseredapplesare__________________________expensivethanthesegreenones. Fertilisersareusedtomakethesoil__________________________productive. Yourperformanceonsportsdaywas__________________________impressive. Jack’sreadingofthepoemwas__________________________expressivethanmine.
term 2 lesson 14 Pencil Work 14Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes.
Do not stop. Do not speak.
Sketch and describe a bicycle.
ISBN 978 1 76020 452 5
78 79 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 14 Spelling Corner 28
Find and fix the eight spelling mistakes.Write the correct spelling on the lines below.
Change these adjectives to adverbs by adding –ly.
term 2 lesson 14 Spelling Corner 27
attractive ______________________________________________
sensitive ______________________________________________
pensive ______________________________________________
productive ______________________________________________
impulsive ______________________________________________
impressive ______________________________________________
intensive ______________________________________________
expressive ______________________________________________
The Mighty Cylinder
Followthissimpleproceeduretodiscuverthestrengthofacylinder.
1 Rollasinglesheetofcopypaperintoatubeandsliparubberbandaroundit.
2 Standthetubeonitsendonaflatsurfis.Careflyplaceabookontop.Youwillseehowthetubecaneasylysupporttheweightofthebook.
Thetubeisacylinder.Thisshapeismuchstrongerthanaflatobject.
Thereforyoucanplacethebookontopofthepaperwithoutcrushingit.
Pillorsandcolumnsaretypesofcylindersandareusedinbuildingsbecosetheyareabletosupportgreatweight.
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
ISBN 978 1 76020 452 5
80 81 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work 1• Write the words export, expand, explain and
explode on the board and review the prefix ex–, meaning out of. Export = to carry out of the country (root – porto, I carry).
• Prefixes are always spelled in the same way.
• Remind students that prefixes are attached to base words or words that have their roots in the early languages of Latin and Greek.
■ Board Work 2• List these verbs: expel, exhale, exclaim,
exclude, interrupt, intercept, intervene.
• Show how we can change these verbs to nouns by adding noun suffixes. Note the subtle changes in spelling needed.
Word Warm-ups
Word extra
exhibitexamine
lesson 15
term 2
■ Book WorkTell the students to open their Word Warm-ups book to page 6, List 15.
• Today the words in our list begin with ex– or e–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkAsk selected students to spell some of the words with common endings added, e.g. expelled, explicitly, extinguisher, elapsed, elaborately, elevating.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes.
• Ask the students to close their books and write as many words as they can remember.
• Share and evaluate the results.
expelexpireexplicitexhaleextinctexcludeexperienceextinguishextravagant
electelapseelasticelaborateeliminateelongateelevateelementeligible
Teaching notes Focus: Prefixes e–, ex–; Adding prefixes and suffixes
Verb noun
expelexcludeextinct exclaimelaborateeliminateelevate
expulsionexclusionextinctionexclamationelaborationeliminationelevation
Many verbs can be changed to nouns
by adding the suffix –ion.
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
ISBN 978 1 76020 452 5
80 81 TARGETING SPELLING YEAR 6 © BLAKE EDUCATION 2015
■ Word Work• Place the students in pairs and set the following task. • Using your dictionary, make a list of ten words
beginning with –ex. The words should be different from those in the Warm-ups list. When you share your words with the class, you need to know how to say the word and give its meaning.
• Do some further word building, e.g. expel: expulsion (note change); expire: expiry; exclaim: exclamation, exclamatory; exclude: exclusion, exclusive, exclusivity, exclusiveness (note how the d is changed to an s); explicit: explicitly, explicitness; extravagant: extravagance; elect: election, elector, electorate, electoral; elastic: elasticity; elaborate: elaborately, elaboration; elevate: elevation, elevator; eliminate: elimination; eligible: eligibility, ineligible; element: elementary, elemental.
TERM 2
LESSON 15
■ Pencil WorkThe worksheet focuses on word building, spelling words to match sentence grammar, and word meaning.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 29 and 30.
Practice Work Use word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• elastic • extravagant • elements • excluding • elongated • expiry • elaborate • exclaimed
Dictation❥ He is not eligible for re-election.❥ The experienced firefighters quickly extinguished the blaze.❥ His elimination in round one excluded him from any further games.❥ Two hours have elapsed since the elevator stopped between floors.
Word Extra• exhibit • examine
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
Y6-TS-Lessons.indd 81 16/02/2017 11:59 AM
ISBN 978 1 76020 452 5
82 83 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 15 Pencil Work 15Name:________________________________________________________________________________
❂
❂
❂
❂
1 Add a noun suffix to the word in bold to complete the sentence correctly. elect:Hundredsofpeoplewillvoteintheupcoming__________________________. expire:Thiscontainerofmilkispastits__________________________date. eliminate:Four____________________________roundswilldecidewhowillcompete. exclude:The__________________________ofthewingerfromtheteamcausedanoutcry. elevate:Werodetothetopflooroftheskyscraperinan__________________________.
2 Match these words with their meanings. elevate stretchouttoagreaterlength explicit cometoanend elongate removeorgetridof expire liftorraiseup eliminate veryclearlyandfullysetout
3 Write these words. All begin with the prefix ex–.
4 Be a word finder.
poseampleportchangeit
ex
__________________________________
__________________________________
__________________________________
__________________________________
__________________________________
elasticexplodeelementextinct
elapseexpiryelevationexperience
exitelection
D E X P I R Y T N V
E X T I N C T H E G
Y P C S L E B H L M
R E U N Z D E P E W
J R K E D O L R C E
C I T S A L E O T X
F E B P I P M L I I
T N E A N X E G O T
I C W L P E N Q N V
S E L E V A T I O N
actpertplaincitedterminate
ex
__________________________________
__________________________________
__________________________________
__________________________________
__________________________________
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about an international sporting event.
ISBN 978 1 76020 452 5
82 83 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 15 Spelling Corner 30
Change the prefixes to make new words.Check word meanings in your dictionary.
Add suffixes to build new words.
term 2 lesson 15 Spelling Corner 29
elect+or+ate ______________________________________________
expire+y ______________________________________________
elastic+ity ______________________________________________
element+ary ______________________________________________
elevate+or ______________________________________________
eliminate+ion ______________________________________________
extinct+ion ______________________________________________
extinguish+er ______________________________________________
explicit+ness ______________________________________________
expose+ure ______________________________________________
Think about the e rule.
__________________________________________
__________________________________________
__________________________________________
exdisins
tinct
__________________________________________
__________________________________________
__________________________________________
exprein
clude
__________________________________________
__________________________________________
__________________________________________
exredis
pel
__________________________________________
__________________________________________
__________________________________________
expredis
tend
__________________________________________
__________________________________________
__________________________________________
exumtrans
pire
__________________________________________
__________________________________________
__________________________________________
exredis
claim
ISBN 978 1 76020 452 5
84 85 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• Today, we will look at words that begin with
the prefix en–. Remember, prefixes affect the meaning of words.
• en– means in or into, e.g. enclose = close in (I have enclosed a photo of my sister.)
• Prefixes are always spelled in the same way.
• Explain that prefixes are attached to base words or words that have their roots in the early languages of Latin and Greek.
Word Warm-ups
Word extra
enforceenthral
lesson 16
term 2
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 7, List 16.
• Point out that all their words this week begin with en–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Remind students of the e rule.
• Ask selected students to spell some verbs from the list with common endings added, e.g. enduring, enticing, endorsed, enlarging, entertainer, entreaty, envisaged.
Closed Book Work• Write five words on the board.
• Allow one to two minutes for students to study them.
• Rub the words off the board.
• Dictate the words, with endings added, for the students to write, e.g. enduring, enchantment, enlargement, entertainment, enticing.
• Evaluate the results.
endureendangerenticeenchantendorseengrossedenlargeenquireenslave
entireentitleensueentreatentangleentertainendeavourenvisageenvironment
Teaching notes Focus: Prefix en– (in, into)
ISBN 978 1 76020 452 5
84 85 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• List the following words on the board: able, close, act,
counter, courage, joy, rolled, danger, grave, core. Ask the students to write them down, adding the prefix en–.
• Discuss their findings. • List the following words on the board; endanger, entice,
enchant, endorse, enlarge, enslave, entangle, entitle, entertain, enforce. Ask the students to build nouns by adding the suffix –ment.
• Discuss their findings. • Discuss other word building, e.g. enduring (adjective),
endangered (adjective), enchantress, enquiry, entirety, environmental, disentangle.
• Prepare Prefix baggies. In each zip-lock bag, place 10 to 12 words cut between the prefix and the base word. Use the above words.
term 2
lesson 16
■ Pencil WorkThe worksheet focuses on spelling, word meaning and morphology.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 31 and 32.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• envisage • enquiry • entertainment • enticing • endeavour • enduring• ensuing • entirely
Dictation❥ He endorsed our plan to save the endangered turtles.❥ He was engrossed in his book, entitled Tales of Enchantment.❥ He had to endure ten years of enslavement.❥ The enlarged photo clearly shows damage to the environment.
Word extra• enforce • enthralled
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
86 87 TargeTing Spelling Year 6 © blake educaTion 2015
1 Complete this table by adding the endings.Add s Add ing Add –ment
enlarge
enforce
entertain
endorse
enchant
2 Match these words and meanings. envisage supportorapproveof endorse tryorattemptsomething enchant whole,complete,unbroken endeavour picturesomethinginyourmind entire delight,charm,castaspellover
3 Fill in the missing letters to complete the words correctly. en____________g________d Theturtlebecame_______________inthefishingline. enf____r________m____________ Thepoliceareresponsibleforlaw_______________. en________r________ Amagnifyingglasswill_______________theprint. en____________g____________d Wemustfighttopreserveour_______________wildlife. end____________d Ourcountryhas_______________droughtfortenlongyears.
4 Add prefixes to build some new words. Use your dictionary to check meaning.
term 2 lesson 16 Pencil Work 16Name:________________________________________________________________________________
❂
❂
❂
❂
__________________________________________
__________________________________________
__________________________________________
enmisre
treat
__________________________________________
__________________________________________
__________________________________________
enrede
tail
__________________________________________
__________________________________________
__________________________________________
enreac
quire
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about an enchanted forest.
ISBN 978 1 76020 452 5
86 87 TargeTing Spelling Year 6 © blake educaTion 2015
term 2 lesson 16 Spelling Corner 32
Add the suffix –ment to build nouns.Read your list to a friend.
term 2 lesson 16 Spelling Corner 31
entangle ______________________________________________ encourage______________________________________________
entitle ______________________________________________ endorse ______________________________________________
entertain ______________________________________________ enforce ______________________________________________
enlarge ______________________________________________ enrich ______________________________________________
enchant ______________________________________________ enjoy ______________________________________________
entice ______________________________________________ enhance ______________________________________________
Be a word sleuth. Use your dictionary to make a list of ten words beginning with en– and their meanings.Share your words and meanings with a friend.
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
___________________________________________________ ______________________________________________________________________________________________________________
ISBN 978 1 76020 452 5
88 89 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• Write the words repay, rely, return, restore on
the board, asking the students to note they all begin with re. Ask a student to read the words.
• Notice that these words are verbs.• Notice that when the prefix re– is pronounced
with a schwa sound, we stress (or emphasise) the second syllable.
• Write the words refuge, regular, renovate on the board, asking the students to note they also begin with re. Ask a student to read the words.
• Notice how the prefix re– in these words is pronounced with a short e sound and the stress moves to the first syllable.
• It is important to use both your eyes and your ears to learn to spell these words correctly.
Word Warm-ups
Word extra
recederefrigerate
lesson 17
term 3
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 7, List 17.
• Point out that all their words this week begin with re–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkRemind students of the e rule. Ask the students to spell selected words from the list with endings added, e.g. retriever, recuperating, resembling, reluctantly, relatively, reminiscing, renovated.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes. • Ask the students to close their books and
write as many words as they can remember. • Share and evaluate the results.
retrievereprievereplenishreligionresemblerestrictreluctantrecuperateremunerate
recollectrecommendregulateregisterrelativereminisceremedyrenovateresonate
Teaching notes Focus: Prefix re–
Use your eyes especially to spell the end part of
words correctly.
ISBN 978 1 76020 452 5
88 89 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Write these words on the board: veal, lay, fresh, fine,
call, place, main, join, move, pair, possess, sent. Ask students to write them down, adding the prefix re–.
• Discuss the findings.• Ask the students to compose sentences, oral or written,
with some of the words.
• Explore word building: retrieval, replenishment, religious, resemblance, restriction, restrictive, unrestricted, reluctance, recuperation, recuperative, remuneration, remunerative, recollection, recommendation, regulation, regulatory, deregulate, registry, registration, unregistered, reminiscent, reminiscence, remedial, renovation, resonance, resonant.
term 3
lesson 17
■ Pencil WorkThe worksheet focuses on word meaning and on understanding that prefixes change the meanings of words.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 33 and 34.
Practice Work Use word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• resemblance • reprieve• recommended • remedies • resonating • remuneration • recollection • replenish
Dictation❥ When my relatives visit, we like to reminisce about our childhood.❥ It is a council regulation that all dogs be registered.❥ After major renovations, the house resembled a small palace.❥ I was reluctant to retrieve my ball from the murky water.
Word extra• recede • refrigerate
■ Word ExtraAdd two to five words to the weekly Warm-ups list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
90 91 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 17 Pencil Work 17Name:________________________________________________________________________________
1 Write these words. Check the meaning of any unfamiliar words.
2 Now choose some of those words to complete these sentences correctly. You may have to add endings.
WhenI______________________________myhomework,I’llplaygamesonmy_______________________________. Domesticoveruseandirrigationhavequickly_______________________________ourwatersupply. Hewassentoffthefieldaftera_______________________________withthereferee. Theathletes_______________________________ontheovaltoreceivetheirsportingtrophies.
3 Complete these nouns by adding the suffix –ion. refrigerate ____________________________________________________
remunerate ____________________________________________________
renovate ____________________________________________________
regulate ____________________________________________________
recollect ____________________________________________________
restrict ____________________________________________________
4 Fill in the missing letters. Thecathedralres________________edtothesoundofringingbells. Milk,butterandcheeseneedtobestoredinar________r____________r____________r. Mytwocousinsaretheonlyre________________v________IhaveinAustralia. Carsmustbere________st____________dtobedrivenonpublicroads. Recentheavyrainshavere____________n________________dourmajordams.
❂
❂
❂
❂
__________________________________________
__________________________________________
__________________________________________
recomde
plete
__________________________________________
__________________________________________
__________________________________________
reasdis
semble
__________________________________________
__________________________________________
__________________________________________
redecon
fuse
__________________________________________
__________________________________________
__________________________________________
rediscom
pute
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about your recollections of childhood.
ISBN 978 1 76020 452 5
90 91 TargeTing Spelling Year 6 © blake educaTion 2015
Spelling Corner 34
reduce+tion ______________________________________________
respect+ful ______________________________________________
reverse+al ______________________________________________
resist+ance ______________________________________________
require+ment ______________________________________________
refer+ence ______________________________________________
represent+at+ive ______________________________________________
remark+able ______________________________________________
reject+ion ______________________________________________
refuge+ee ______________________________________________
Be a word builder. Remember your spelling rules.
Join endings or suffixes to the base words.
Spelling Corner 33
resemble reminisce retrieve restrict
–s –ed –s –s
–ed –ing –ed –ed
–ing –ent –er –ive
–ance –ence –al –ion
term 3 lesson 17
term 3 lesson 17
ISBN 978 1 76020 452 5
92 93 TargeTing Spelling Year 6 © blake educaTion 2015
Teaching notes Focus: Suffix –ion
■ Board Work• List the words act, collect, predict, express on
the board. Ask a student to read the words. Point out that these words are verbs.
• Add the suffix –ion to the end of each word and ask a student to read the new words. Note the sound of the suffix. Point out that many students spell this suffix wrongly because they write what they hear, shun or shin. They must remember what the suffix looks like.
• –ion is a noun suffix. Words with this suffix usually end in –ion, –tion or –sion. refer students to the suffixes chart.
• Point out that not all words ending in –ion are nouns built from verbs. Some are nouns only, e.g. caption, occasion, or are both nouns and verbs, e.g. caution, fashion.
Word Warm-ups
Word extra
emotionexception
lesson 18
term 3
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 7, List 18.• Point out that all their words this week end in
–ion. These endings are usually found on the end of nouns.
• Work through the words in the list. Explain unfamiliar words.
• It is important to use both your eyes and your ears to learn to spell these words correctly.
• Chant the words together, keeping a steady pace.
Open Book WorkWith the students, explore orally the base words of some of the words in the list, e.g. pollute, decorate, demolish, decide, collide, impress.
cautioncaptioncommotionpollutiondecorationdemolitioninstructionreductionresolution
inclusionexclusionexplosionoccasiondecisiondivisioncollisionimpressionconclusion
Use your eyes and your ears
to spell words correctly.
ISBN 978 1 76020 452 5
92 93 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Explore word building, e.g. cautionary, instructional,
occasional, exceptional, decorative, inclusive, exclusive, explosive, decisive, divisive, impressive, conclusive, pollutant, fashionable.
• Working with old magazines, newspapers and junk mail catalogues, students work in pairs to list as many words ending in –ion as they can. The words should be listed on A4 sheets and pinned on the wall for sharing and as a spelling resource.
term 3
lesson 18
■ Pencil WorkThe worksheet focuses on application of the noun suffix –ion and word building.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 35 and 36.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• division • occasionally• explosions • resolution• collision • construction • instructional • captions
Dictation❥ Workers must use caution when entering a demolition site.❥ Christmas is an occasion for colourful decorations.❥ We must aim for the reduction of air and water pollution.❥ His decision to exclude James caused a flood of emotion.
Word extra• emotion • exceptional
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
94 95 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 18 Pencil Work 18Name:________________________________________________________________________________
❂
❂
❂
❂
1 Match these nouns with their base verbs. reduction decorate demolition collide inclusion explode collision divide decision include pollution demolish explosion decide conclusion pollute decoration reduce division conclude
2 Add –ive to these base words to build adjectives. Spelling alert! decorate__________________________________________ explode __________________________________________
include __________________________________________ conclude__________________________________________
decide __________________________________________ divide __________________________________________
impress __________________________________________ express __________________________________________
3 Spell the missing words. All words end in –ion. Followthein_________________________________________sformakingaglovepuppet.
Oc___________________________ally,wevisitthemuseumandtheartgallery.
Readthec___________________________belowthenewspaperphoto.
WehangupChristmasd_________________________________________severyyear.
Afterthedem_________________________________________oftheoldtheatre,constructionwillbeginonanother.
4 Add prefixes and suffixes to build new words. un+emotion+al _______________________________________________
caution+ary _______________________________________________
impression+able _______________________________________________
occasion+al _______________________________________________
instruction+al _______________________________________________
pre+caution _______________________________________________
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about your New Year’s resolution.
ISBN 978 1 76020 452 5
94 95 TargeTing Spelling Year 6 © blake educaTion 2015
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
Spelling Corner 36
Choose one topic to write about.
Write the base word from which these nouns have been built.
Spelling Corner 35
instruction ______________________________________________
resolution ______________________________________________
construction ______________________________________________
impression ______________________________________________
decoration ______________________________________________
inclusion ______________________________________________
reduction ______________________________________________
conclusion ______________________________________________
expression ______________________________________________
demolition ______________________________________________
■Anoccasiontocelebrate ■Instructionsformakingakite■Anexplosionoffireworks ■ThebestdecisionIevermade■OurChristmastreedecorations ■Theproblemofpollution
term 3 lesson 18
term 3 lesson 18
ISBN 978 1 76020 452 5
96 97 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board WorkToday, we will look at words that begin with two different prefixes, pre– and pro–. Remember, prefixes affect the meaning of words. Prefixes are always spelled in the same way.
• Explain that the prefix pre– often means before. Give examples: pretest, preview, prepaid, prejudge, prehistoric.
• Explain that the prefix pro– often means forward or in favour of. Give examples: progress, project, promote.
• Explain that the prefixes are attached to base words or words that have their roots in the early languages of Latin and Greek.
Word Warm-ups
Word extra
preservepropose
lesson 19
term 3
■ Book WorkTell the students to open their Word Warm-ups book to page 8, List 19.
• Point out that all their words this week begin with pre– or pro–.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkReview the e rule. Ask selected students to spell some verbs from the list with common endings added, e.g. precluding, precisely, preceding, previously, protected, propeller, processed.
Closed Book Work• Divide the class into Group A and Group B. Ask
Group A to study the pre– words and Group B the pro– words. Allow a few minutes.
• Ask the students to close their books and write as many words as they remember.
• Share and evaluate the results.
• In a different session, repeat the task with roles reversed.
precedepreciseprecludepredictprescribeprecariouspredicamentpreliminaryprevious
protectprocessprogressprovokeprovidepropelproclaimprohibitproficient
Teaching notes Focus: Prefixes pre–, pro–
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
On some days, ask the students to work in pairs and choose a list to
read softly together or to each other.
When pre- is added to a word beginning with e, it is separated by a hyphen.pre-empt pre-eminent
ISBN 978 1 76020 452 5
96 97 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Write these words on the board: tend, vent, long, pare,
view, test, fuse, serve, fix, gram. Ask the students to write the words, adding the correct prefix, pre– or pro–. Discuss their findings. Note: pretest and protest are both words.
• Explore the addition of suffixes, e.g. preclusion, prediction, predictable, unpredictable, precedent, precedence, imprecise, prescriptive, prescription, protective, protection, unprotected, procession, processor, progression, provocation (note the spelling change), propulsion (note the spelling change), provision (note that d becomes s), proclamation (note to drop the i), prohibitive, prohibition, proficiency.
• Discuss words whose spelling or meaning can be confused with that of other words, e.g. proceed, precede; proficient, efficient; presume, assume; profess, confess.
term 3
lesson 19
■ Pencil WorkThe worksheet focuses on exploring prefixes, studying the spelling and pronunciation changes when adding suffixes, and vocabulary building.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be
spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 37 and 38.
Practice Work Use word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• precluded • previously• prohibit • unprovoked • predictable • predicament • prescribed • protection
Dictation❥ She was proclaimed the winner as the wind propelled her boat over the
finishing line.❥ Preliminary time trials commence at precisely nine o’clock.❥ Flag bearers preceded the carnival procession.❥ He is proficient at maths and continues to make good progress in English.
Word extra• preserve • propose
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
To words ending in ade, ide, ode or ude add sion to form nouns.
invade provide explode includeinvasion provision explosion inclusion
ISBN 978 1 76020 452 5
98 99 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 19 Pencil Work 19Name:________________________________________________________________________________
❂
❂
❂
❂
1 Write these words.
2 Complete these words. Hewasproclaim_____________kingofthenorthlands. Thedoctorprescribe_____________bedrestandplentyoffluids. Theylinedthestreetstowatchthecarnivalprocess_____________. Seaweedbecameentangledintheboat’spropel_____________. Ourmakeshiftsheltergaveusprotect_____________fromthefierce,icywinds.
3 Match the verbs with their nouns and meanings. provoke prescription orderforuseastreatment precise propeller skilled,expert,accomplished proficient provocation exact,correct,specific prescribe precision driveforward,push,shove propel proficiency makeangry,irritate,goad,annoy
4 Build new words. Note pronunciation. un+predict+able___________________________________ preced(e)+ent ___________________________________
previous+ly ___________________________________ prohibit+ive ___________________________________
proficien(t)+cy ___________________________________ protect+ive ___________________________________
im+precise ___________________________________ procla(i)m+ation___________________________________
progress+ive ___________________________________ process+ion ___________________________________
__________________________________________
__________________________________________
__________________________________________
preende
vious
__________________________________________
__________________________________________
__________________________________________
proacre
cess
__________________________________________
__________________________________________
__________________________________________
proredis
claim
__________________________________________
__________________________________________
__________________________________________
predein
scribe
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
List the provisions you would need for a camping trip.
ISBN 978 1 76020 452 5
98 99 TargeTing Spelling Year 6 © blake educaTion 2015
Spelling Corner 38
Be a word builder.
Add the word parts to build new words.Use your spelling rules.
Spelling Corner 37
provision+al ______________________________________________
propel+er ______________________________________________
im+precise ______________________________________________
un+provoked ______________________________________________
protect+ive ______________________________________________
precarious+ly ______________________________________________
precise+ion ______________________________________________
previous+ly ______________________________________________
progressive ____________________________________________
ion ____________________________________________
processor ____________________________________________
ion ____________________________________________
prohibition ____________________________________________
ive ____________________________________________
prediction ____________________________________________
able ____________________________________________
protection ____________________________________________
or ____________________________________________
precedeent ____________________________________________
ence____________________________________________
production ____________________________________________
ive ____________________________________________
term 3 lesson 19
term 3 lesson 19
ISBN 978 1 76020 452 5
100 101 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• Explain that many words used in English
today have their roots or origins in the early languages of Latin and Greek.
• Today we will study two groups of words with Latin and Greek roots.
• Write duco, ductus (I lead) on the board and explain how this is the root of a number of words we use today in English. Write the words reduce, produce, product, educate and circle the duc part of each word. Discuss meaning.
• Write cedo, cessus (I go) on the board and explain how this is the root of a number of words we use today in English. Write the words success, process, procede, recede and circle the cess or ced part of each word. Discuss meaning.
Word Warm-ups
Word extra
recess exceed
lesson 20
term 3
■ Book WorkTell the students to open their Word Warm-ups book to page 8, List 20.
• Point out that all their words this week have Latin and Greek roots.
• Work through the words in the list. Explain unfamiliar words.
• It is important to use both your eyes and your ears to learn to spell these words correctly.
• Chant the words together, keeping a steady pace.
Open Book WorkAsk selected students to spell words from the list with endings added, e.g. conducted, producing, successful, incessantly.
conductdeductinductproductproducereduceinduceintroduceeducate
accessexcesssuccessprocessproceedsucceedrecedeprecedeincessant
Teaching notes Focus: Greek and Latin roots duco or ductus (I lead), cedo or cessus (I go)
Many English words have their origins, or roots, in the early
languages of Latin and Greek.e.g. fin (end): final finish finite
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
ISBN 978 1 76020 452 5
100 101 TARGETING SPELLING YEAR 6 © BLAKE EDUCATION 2015
■ Word Work• Explore word building, e.g.: duco or ductus
conduct: conductor; deduct: deduction, deductible; induct: induction; produce: product, production, productive, unproductive, productivity; reduce: reduction; induce: inducement; introduce: introduction, introductive; educate: education, educational, educable; abduct: abduction.
cedo or cessus access: accessible, accession, accessory; exceed: excess, excessive; succeed: success, successful, successive, successor; precede: precedent, precedence; recess: recession.
TERM 3
LESSON 20
■ Pencil WorkThe worksheet focuses on correct word use and word building, and explores a range of prefixes used to build different words.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 39 and 40.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• succeeded • excessive• receding • deduction• producing • inducement• conductor • proceeded
Dictation❥ The company is introducing new health products all the time.❥ The four successful students will be inducted as school leaders.❥ Many children do not have access to education.❥ The procession was preceded by the flag bearers.
Word Extra• recess • exceeding
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
Y6-TS-Lessons.indd 101 16/02/2017 12:16 PM
ISBN 978 1 76020 452 5
102 103 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add endings to complete the words correctly. incessantRainfell___________________________________fordays,causingmajorflooding. reduce A___________________________________inthepriceoffuelwaswelcomedbydrivers. conduct The___________________________________raisedhisbatonandthesymphonybegan. recede Floodwatersare___________________________________,butdamsarestillrising. excess ___________________________________forcewasusedtosubduetheprisoners.
2 Form nouns by adding the suffix –ion or –tion. produce _____________________________________________ reduce _____________________________________________
introduce_____________________________________________ educate_____________________________________________
process _____________________________________________ success _____________________________________________
deduct _____________________________________________ induct _____________________________________________
access _____________________________________________ recess _____________________________________________
3 Highlight the correct prefix. Thecarreachedspeedsinex
ac cessof150kph.
Theopeningofthebridgewasreprecededbyashortspeech.
Farmersprore ducefoodforthetablesofthenation.
Therewasanattempttoabin ducttheyoungprince.
Itwilltakesometimetosucprocessallofthedata.
4 Use the prefixes to write some different words.
term 3 lesson 20 Pencil Work 20Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Design a poster advertising a street procession.
__________________________________________
__________________________________________
__________________________________________
__________________________________________
__________________________________________
deproinabcon
duct
__________________________________________
__________________________________________
__________________________________________
__________________________________________
__________________________________________
reinprodeintro
duce
__________________________________________
__________________________________________
__________________________________________
__________________________________________
__________________________________________
proreacsucex
cess
ISBN 978 1 76020 452 5
102 103 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 20 Spelling Corner 40
Find the eight spelling errors in this text.Write the correct spelling on the lines below.
Join the word parts to build new words.
term 3 lesson 20 Spelling Corner 39
intro+duct+or+y ___________________________________________________
ex+cess+ive ___________________________________________________
pro+ceed+ings ___________________________________________________
pre+cede+ent ___________________________________________________
in+duce+ment ___________________________________________________
de+duct+ible ___________________________________________________
product+ive+ity ___________________________________________________
success+ful ___________________________________________________
success+ive ___________________________________________________
educate+ion+al ___________________________________________________
ab+duct+ion ___________________________________________________
ac+cess+ible ___________________________________________________
The Power of Music
Resentstudiesintomusichaveshownthatlerningtoplayamusicalinstramentimprovesnotonlyourabilitytolistenbutalsoourmotorskillsandourabilitytofocis,reasonandremember.Ithasbeennamedthemusicadvantage.
Themusicalexperientsstrengthenstheabilitytoknowwhatisimportanttolistentoandpayattenshintoinanynoisyenvirament,incloodingtheclassroom.
Listeningtomusicdoesn’thavethesameimpactonthebrainasmakingmusic,butcanstillbebeneficial.
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
Obey your spelling rules!
ISBN 978 1 76020 452 5
104 105 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board WorkToday our words end in the suffix –al.
• Remember, suffixes indicate the grammatical function of a word, e.g. noun, verb, adjective, adverb. Suffixes ensure that we use words correctly, so that what we say and write sounds right. The suffix –al most often forms an adjective.
• It is easy to confuse words ending in al, el or le because they all sound the same. When you learn these words, you need to remember what the words look like.
Word Warm-ups
Word extra
ruralcasual
lesson 21
term 3
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 8, List 21.
• Point out that all their words this week end in –al and are all adjectives.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkRemind students that many adverbs are formed by adding –ly to an adjective. Ask the students to spell selected adverbs, e.g. centrally, nationally, personally, medically, originally.
Closed Book Work• Write three to five words on the board.
• Tell the students they have one minute to view the words.
• Rub the words off the board and ask the students to write what they can remember.
• Evaluate the results.
• Repeat with different words.
centralnaturalnationalfrugalpersonalpunctualmedicalintegralactual
federalferaltrivialmanualgradualseveraloriginalAboriginalindividual
It is easy to confuse words
ending in al, el or le. Use your eyes to remember
the ends of these words.
Teaching notes Focus: Suffix –al
ISBN 978 1 76020 452 5
104 105 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Prepare some Suffix baggies. Each set could contain 10
to 12 words comprising base words and suffixes that change the words from adjectives to nouns by adding –ity, e.g. original-ity, personal-ity, punctual-ity, frugal-ity, actual-ity, trivial-ity, individual-ity. Other words could include: normal-ity, vital-ity, legal-ity, local-ity, brutal-ity, fatal-ity, banal-ity, mental-ity, cordial-ity, formal-ity, final-ity, real-ity.
• Students work in pairs to assemble words and write them in their notebooks. Words should be read aloud.
• Students should read their finished words to each other or to the class.
• Alternatively, write the base words on the board. Ask students to write them down and build nouns by adding –ity. Discuss the results.
• Explain how words are changed from one part of speech to another so that the things we say and write make grammatical sense.
• Remind them that many adjectives ending in –al can be changed to nouns by adding the suffix –ity, as in the examples provided, and that many adjectives ending in –al can be changed to adverbs by adding –ly.
• Write these words on the board: normal, oral, vital, visual, legal, brutal, casual, formal, fatal, mental, local, final. Ask the students to write them down, adding –ly to form adverbs. Check their understanding.
term 3
lesson 21
■ Pencil WorkThe worksheet focuses on vocabulary and on changing the function of words by changing the suffix.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 41 and 42.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• trivial • manually• feral • centrally • integral • frugal • personality • individuality
Dictation❥ I don’t know his actual name or his nationality.❥ There was a gradual improvement in his medical condition.❥ The federal government has a policy on the mining of our natural resources.❥ Several Aboriginal paintings hang in the National Gallery of Australia.
Word extra• rural • casual
■ Word ExtraAdd two to five words to the Warm-ups list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
106 107 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add –ly to form adverbs from these adjectives. gradual ___________________________________________ original ___________________________________________
personal ___________________________________________ medical ___________________________________________
central ___________________________________________ actual ___________________________________________
manual ___________________________________________ individual___________________________________________
natural ___________________________________________ national ___________________________________________
2 Form nouns by adding the suffix –ity. personal ___________________________________________ punctual ___________________________________________
original ___________________________________________ trivial ___________________________________________
individual ___________________________________________ national ___________________________________________
local ___________________________________________ final ___________________________________________
3 Build verbs and nouns by changing the suffix –al to –ate and –ation.
–ate –ation
punctual
medical
integral
gradual
federal
4 Fill in the missing letters. plain,simple,unaffected n________________al domesticanimalgonewild f________al minor,petty,unimportant t________________al donebyhand(notmachine) m____________al slowlychangingalittleatatime g________________al
term 3 lesson 21 Pencil Work 21Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Describe your personality.
ISBN 978 1 76020 452 5
106 107 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 21 Spelling Corner 42
Be a word builder.
Match these adjectives to a suitable noun.Write the pairs.
term 3 lesson 21 Spelling Corner 41
federal animal
natural decline
terminal person
manual achievement
medical character
frugal resources
gradual government
central illness
feral doctor
personal labour
originally ____________________________________________
ity____________________________________________
naturally ____________________________________________
ist____________________________________________
personally ____________________________________________
ity____________________________________________
fatally ____________________________________________
ity____________________________________________
nationally ____________________________________________
ist____________________________________________
casually ____________________________________________
ty ____________________________________________
individually ____________________________________________
ity____________________________________________
ISBN 978 1 76020 452 5
108 109 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board WorkToday we are going to review the different sounds of y and revisit the rules for writing the plural form of nouns ending in y.
• Write these words on the board: happy, lazy, gypsy, cylinder, cyclone, terrify. Ask a student to read the words, while the others note the different sounds made by y. Establish that the letter y can represent three different sounds: ē as in happy, ĭ as in cylinder and ī as in cyclone.
• Write these nouns on the board: baby, lady, country, gully, party. Remind the students that, to write the plural form, we must first change the y to i. With the students, write the plural form of the words on the board: babies, ladies, countries, gullies, parties.
• Write these nouns on the board: key, monkey, day, boy, trolley. Remind the students that we do not change y to i to write them in plural form because the letter before the y is a vowel. Ask selected students to spell the words keys, monkeys, days, boys, trolleys
• Make the generalisation that we change the y to i before adding an ending most of the time. (Refer them to the spelling rules in the Word Warm-ups book.)
Word Warm-ups
Word extra
journeylibrary
lesson 22
term 3
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 9, List 22.
• Work through each list, explaining any unfamiliar words. Ask the students to read the list together at a steady pace.
Open Book WorkThinking about the rules, how do you spell these words: mutinies, industries, ferries, canaries, lullabies?
Closed Book Work• Write three to five words on the board.
• Tell the students they have one minute to view the words.
• Rub the words off the board and ask the students to write what they can remember.
• Evaluate the results.
• Repeat with different words.
mutinymotleygaudyindustryordinarytemporaryferryfallacycanary
cymbalcylinderhysteriamysterypyramidpyjamasphysicalgymnasiumlullaby
Teaching notes Focus: The different sounds of y; Applying the y rule
ISBN 978 1 76020 452 5
108 109 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• To consolidate the rules for forming the plurals of
nouns ending in y, write this list of words on the board: enemy, valley, gully, jockey, fairy, key, country, story, family, journey. Ask the students to write them in plural form. They will need to think about the rules.
• Check their understanding.
• Explore word building, e.g. mutiny: mutinous; industry: industrial, industrialist, industrious; temporary: temporarily; ordinary: ordinarily, extraordinary; fallacy: fallacious; cylinder: cylindrical; mystery: mysterious; hysteria: hysterical.
term 3
lesson 22
■ Pencil WorkThe worksheet focuses on application of the y rule, word building and proofreading.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 43 and 44.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• ferries • gaudy • industries • cylinders • temporary • cymbals • fallacy • hysterical
Dictation❥ Many people go to a gymnasium to maintain their physical fitness.❥ It was a motley band of ordinary people who led the mutiny.❥ Great mysteries still surround the pyramids.❥ She dressed the baby in warm pyjamas and sang her a lullaby.
Word extra• journey • library
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
110 111 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add endings to the bold words to complete the sentences correctly. mystery Asoft,___________________________________soundcamefrombehindthelockeddoor. hysteria Peoplebecame______________________________asbuildingscollapsedaroundthem. temporaryHeisoutofwork,butonly_____________________________________________. physical Bensongoestoagymtokeephimself___________________________________fit. cymbal Withaclashof___________________________________thesymphonycametoa
stunningend.
2 Find and fix the mistake in each sentence. Asconditionsworsened,thesailorsbecamemutinus. _________________________________
OrdinrypeoplewereaffectedbytheIndustrialRevolution. _________________________________
Manyhavetriedtouncoverthemysterysofthepyramids. _________________________________
Theywereamotlygroupofpeoplewearingstripedpyjamas. _________________________________
Thereportofmasshysteriaisjustafalacy. _________________________________
3 Write the plural form of these words. Think about the yrule. industry ______________________________________ mystery ______________________________________
lullaby ______________________________________ canary ______________________________________
fallacy ______________________________________ mutiny ______________________________________
journey ______________________________________ library ______________________________________
4 Add the word endings. Think about the y rule. temporary+ly ______________________________________________ mutiny+ous ______________________________________________
ordinary+ly ______________________________________________ industry+al ______________________________________________
fallacy+ous ______________________________________________ industry+ous ______________________________________________
hysteri(a)+cal ______________________________________________ cylind(e)r+ic+al ______________________________________________
term 3 lesson 22 Pencil Work 22Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
List ten ways to keep physically fit.
ISBN 978 1 76020 452 5
110 111 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 22 Spelling Corner 44
Write these words in plural form.
Describe one of the following.
term 3 lesson 22 Spelling Corner 43
industry ____________________________________________ donkey ____________________________________________
lullaby ____________________________________________ canary ____________________________________________
mystery ____________________________________________ hobby ____________________________________________
monkey ____________________________________________ pony ____________________________________________
valley ____________________________________________ enemy ____________________________________________
trolley ____________________________________________ duty ____________________________________________
fallacy ____________________________________________ jockey ____________________________________________
city ____________________________________________ library ____________________________________________
key ____________________________________________ journey____________________________________________
■Ariverferry ■Yourpyjamas ■AnEgyptianpyramid■Agymnasium ■Anextraordinaryevent ■Cymbalsinabrassband
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
Think about the y rule.
ISBN 978 1 76020 452 5
112 113 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Explore other words that can be built
from these words, e.g. hygiene: hygienic, hygienically; hybrid: hybridise; hyphen: hyphenate, hyphenated; hydroponic: hydroponically; system: systematic, systematically, systematise; symptom: symptomatic, symptomatically; sympathy: sympathise, sympathetic, sympathetically; symphony: symphonic; synthetic: synthetically.
• Discuss ways of learning multisyllabic words.
• Draw a box for each syllable. Write one syllable in each box. Run your finger under the boxes, saying the word and looking at what is in each box. Do this several times. Close your eyes and try to picture what is in each box. Check by looking at the word again. Then write the word from your memory and check for accuracy.
■ Board WorkToday we will look at words that begin with hy and sy. • Write these words on the board: hyena, hype,
hydrant, hydroelectric. Read them aloud, asking the students to note that the y here is pronounced as a long i sound.
• Explain that there are words beginning with hy where the y is pronounced as a short i sound, e.g. hypnotise, hysterical, hymn.
• Write these words on the board: syrup, syllable, symbol, system. Read them aloud, asking the students to note that the y here is pronounced as a short i sound.
Word Warm-ups
Word extra
liquidsqualid
lesson 23
term 3
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 9, List 23. • Today the words in our list begin with hy
(high) and sy (sip).• Work through the words in the list. Explain
unfamiliar words. • Chant the words together, keeping a steady
pace.
Open Book WorkAsk selected students to spell the plural form of some words, e.g. hyenas, hydrants, symptoms, symphonies, synopses.
Closed Book Work• Divide the class into two groups. Group A
should study the top set of words and Group B the bottom set.
• Allow two to three minutes. • Ask the students to close their books and
write as many words as they can remember. • Share and evaluate the results.
hyenahygienehypehybridhyphenhydrogenhydranthydroponichypodermic
syrupsyringesystemsymbolsymptomsympathysymphonysynopsissynthetic
Teaching notes Focus: Letter teams hy–, sy–; Adding prefixes and suffixes
hy dro pon ic
hy po derm ic
ISBN 978 1 76020 452 5
112 113 TargeTing Spelling Year 6 © blake educaTion 2015
Word Work Continued• Another method is to colour each syllable a different
colour.• Another method of learning multisyllabic words is to
write them as Syllable Slides. Run your finger past each syllable, saying the word and looking at the letters.
• Point out that the word sympathy has its origin in the Latin word pathos meaning feeling. Other words with this origin are: empathy, pathetic, pathos, pathology.
• Symphony has its origin in the Latin word phono meaning voice or sound. Other words include: phone, phonic, gramophone, megaphone, earphones, cacophony.
term 3
lesson 23
■ Pencil WorkThe worksheet focuses on word building, spelling words to match sentence grammar, and word meaning.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 45 and 46.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• hybrid • hydrant• hygienic • symbols • sympathy • syrup • symphonies • systematic
Dictation❥ The farmer installed a hydroponic system for growing lettuce.❥ Synthetic materials have largely replaced natural ones.❥ The nurse gave me an injection with a hypodermic syringe.❥ Before studying our class novel, the teacher gave us a synopsis of the story.
Word extra• liquid • squalid
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
hy dro gen
sys tem at ic
hy po derm ic
ISBN 978 1 76020 452 5
114 115 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 23 Pencil Work 23Name:________________________________________________________________________________
❂
❂
❂
1 Match these words to their meanings. symptom outline,plan,summary syrup musicalcompositionforanorchestra symbol indicatorofillnessordisease synopsis compassion,tendernessoffeeling symphony emblem,token,sign sympathy thick,sweetliquid
2 Build the following words by adding the endings. Spelling alert! hygiene+ic ______________________________________ hyphen+ated ______________________________________
system+at+ic______________________________________ sympathy+ised ______________________________________
symphony+ic ______________________________________ system+at+ise______________________________________
symbol+ic ______________________________________ symbol+ise ______________________________________
3 Choose from the words above to complete these sentences. “Up-to-date”and“well-known”are______________________________________wordswhentheyare
usedasadjectives.
Thewhitedoveontheflagis______________________________________ofpeace.
Itisnot______________________________________todrinkuntreatedriverwater.
Thepolicecarriedouta______________________________________investigationintothecrime.
He______________________________________withmewhenheheardIhadlostmypetdog.
4 Be a word finder.
Y N O H P M Y S N S
G S Y R U P T H E Y
H Y P H E N I B G M
R M S Y M B O L O P
J P U G D F Z T R A
C T T I A L E O D T
F O B E L N E P Y H
S M Y N C X R D H Y
I S R E P E N Q N V
H Y P O D E R M I C
❂hyphensymbolhypehypodermicsymptoms
hydrogensyruphygienesympathysymphony
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write a synopsis of a well-known fairy story.
ISBN 978 1 76020 452 5
114 115 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 23 Spelling Corner 46
Spot the six spelling mistakes.Write the correct words on the lines below.
Write as many words as you can, using the letters in the word below (no plurals or verbs ending in s). Letters can only be used once in any one word.
term 3 lesson 23 Spelling Corner 45
The record is 167!
The HyphenHyphensoffenlinkthetwopartsofacompoundadjective,asinastar-studdedskyoracandle-litroom.Hyphensareallsousedwhenwedevideawordattheendofalineifthewholewordwo’ntfitin.Thehyphenshowsthattherestofthewordisonthenextline.Manyexampelsofthesewordbreakscanbefoundinanewspapper.
sympathetic
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
ISBN 978 1 76020 452 5
116 117 TARGETING SPELLING YEAR 6 © BLAKE EDUCATION 2015
■ Word Work• Explore other words that can be built from
these words, e.g. abduct: abduction, abductor; abrupt: abruptness; absolute: absolution; abundant: abundance; absurd: absurdity, absurdness; absent: absentee, absenteeism; abbreviate: abbreviation; accept: acceptable, unacceptable, acceptance; account: accountant, accountancy, accountable, unaccountable, accounted (for); accurate: accuracy, accurateness; accomplish: accomplishment; accompany: accompaniment; accommodate: accommodation;
accumulate: accumulation, accumulative; accelerate: acceleration, accelerator.
• Again discuss ways of learning multisyllabic words.
• Draw a box for each syllable. Write one syllable in each box. Run your finger under the boxes, saying the word and looking at what is in each box. Do this several times. Close your eyes and try to picture what is in each box. Check by looking at the word again. Then write the word from your memory and check for accuracy.
• Another method is to colour each syllable a different colour.
Teaching notes Focus: Prefix ab–, letter team acc–
■ Board WorkToday we will look at words that begin with ab and acc. Ab– is a prefix meaning away or from. The word abduct is derived from its root word duco or ductus = I lead and the prefix ab–.
Therefore, abduct means to lead away from.We will also study words with the beginning letter team acc.
Word Warm-ups
Word Extra
accidentaccrue
LESSON 24
TERM 3
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 9, List 24.
• Today the words in our list begin with ab or acc.
• Point out that when the second c is followed by e or i, the c is a soft c and therefore pronounced as an s. Give other examples: accent, accelerate, accident.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkAsk selected students to spell some words with endings added, e.g. abducted, absorbing, abruptly, absolutely, accurately, accelerating.
abductabsurdabsorbabsentabsoluteabdomenabruptabundantabbreviate
acceptaccentaccelerateaccountaccurateaccomplishaccompanyaccommodateaccumulate
ac cel er ate
ab bre vi ate
Y6-TS-Lessons.indd 116 16/02/2017 12:16 PM
ISBN 978 1 76020 452 5
116 117 TargeTing Spelling Year 6 © blake educaTion 2015
Word Work Continued • Another method of learning multisyllabic words is to
write them as Syllable Slides. Run your finger past each syllable, saying the word and looking at the letters.
• Point out that the word abbreviate has its origin in the Latin word brevis, meaning short. Other words with this origin are: brief, briefly, brevity.
• Access has its origin in the Latin root cedo or cessus, meaning I go. Other words include: accede, antecedent, concede, concession, intercede, intercession, recede, precede, precedence, proceed, process, procession, succeed, success, succession, incessant, recess, recession, excess.
term 3
lesson 24
■ Pencil WorkThe worksheet focuses on word building, word meaning and sentence construction.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 47 and 48.
Practice Work Use word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• abduction • abundantly• absentee • accommodation• abdomen • accompaniment• accent • acceptable
Dictation❥ I cannot accept such an absurd excuse for your absence.❥ She gave an accurate account of the explorer’s journey.❥ Joan is absolutely absorbed in her latest spy novel.❥ The car accelerated abruptly and disappeared from sight.
Word extra• accidents • accrue
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ab do men
ac com mo date
ac com plish ment
ISBN 978 1 76020 452 5
118 119 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 24 Pencil Work 24Name:________________________________________________________________________________
❂
❂
❂
❂
1 Change these adjectives to adverbs by adding –ly. accurate _____________________________________________ absolute _____________________________________________
absent _____________________________________________ absurd _____________________________________________
abrupt _____________________________________________ abundant _____________________________________________
2 Add the endings to complete this table. Spelling alert!
Add ed Add ing Add –ion
abbreviate
accelerate
accommodate
access
abduct
accumulate
3 Write sentences to clearly show the difference in meaning of these words.acceptexceptexpect
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
4 Add suffixes to build some new words. Use your dictionary to check meaning.
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about an accomplished player you know.
accept
_____________________________________________
_____________________________________________
anceable
account
_____________________________________________
_____________________________________________
antable
abundant
_____________________________________________
_____________________________________________
lycy
ISBN 978 1 76020 452 5
118 119 TargeTing Spelling Year 6 © blake educaTion 2015
term 3 lesson 24 Spelling Corner 48
Add the missing letters to complete the words.
Build new words.
term 3 lesson 24 Spelling Corner 47
account+ant ______________________________________________________
accomplish+ment ______________________________________________________
absent+ee+ism ______________________________________________________
accelerate+or ______________________________________________________
accept+able ______________________________________________________
accurate+cy ______________________________________________________
abrupt+ness ______________________________________________________
abduct+or ______________________________________________________
account+able ______________________________________________________
absurd+ity ______________________________________________________
accompany+ment ______________________________________________________
accompany+ist ______________________________________________________
ab________________ Johnwas____________fromschooltoday.
abb____________________________ Whenyou____________aword,youmakeitshorter.
acc____________ Iwill____________yourofferofaridehome.
acc________________________________ Dadpressedthe____________andthecarsurgedforward.
ab____________________ Aninsecthasthreeparts:head,thoraxand____________.
ab________________________ Iwasso____________inmybook,Ididn’thearthephone.
acc________________ Ihavefivehundreddollarsinmybank____________.
ab________________________ Heistellingyouthe____________truth.
Spelling rules!
ISBN 978 1 76020 452 5
120 121 TargeTing Spelling Year 6 © blake educaTion 2015
Teaching notes Focus: Suffixes –ious, –ous (the adjective makers)
■ Board Work• Write the words fame, danger, glory, venom
on the board. Ask a student to read the words. Add the suffix –ous, to each word and reread. Refer students to the suffixes chart (see CD).
• Note that –ous is a suffix, an adjective maker. Point out that –ious is a variant of –ous.
• Explain that the suffix –ous (and –ious) means full of. Thus, famous means full of
fame; dangerous means full of danger; spacious means full of space.
• Remind students that comparative adjectives are usually formed by adding –er and –est. (e.g. big, bigger, biggest). However, adjectives that end in a suffix are compared by placing more and most in front of the adjective. e.g. delicious, more delicious, most delicious.
• Complete this table of comparative adjectives with the students.
Word Warm-ups
Word extra
dangerousgenerous
lesson 25
term 4
■ Book WorkTell the students to open their Word Warm-ups book to page 10, List 25.
• Point out that all their words this week end in –ous or –ious and are all adjectives.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkRemind students that many adverbs are formed by adding –ly to an adjective. Ask the students to spell selected adverbs, e.g. curiously, furiously, obviously, enormously, ravenously, graciously.
Closed Book Work• Write five words on the board.
• Allow one to two minutes for students to study them.
• Rub the words off the board.
• Dictate the words, with endings added, for the students to write, e.g. curiously, furiously, graciously, enormously, ravenously.
• Evaluate the results.
curiousfuriousdeviousobviousvariousdeliciouspreciousspaciousgracious
courteousglamorousgorgeousporouspompousprosperousarduousenormousravenous
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
curious more curious most curious precious generous enormous glamorous
Adverbs are often formed by adding –ly to an adjective.
curious curiously courteous courteously
ISBN 978 1 76020 452 5
120 121 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Write these words on the board: adventure, venom,
danger, poison, fame, peril, ridicule, nerve, humour, labour. (note: drop the u in humour and labour when adding –ous.) Ask the students to write them down, adding –ous to each one. Tell them to be on the lookout for any changes of spelling needed. Share their findings.
• Explain that nouns are formed by adding different suffixes. Demonstrate by drawing a table. Note where letters are changed or dropped.
• Demonstrate how to learn multisyllable words by boxing the syllables, drawing a Syllable Slide or colouring each syllable.
term 4
lesson 25
■ Pencil WorkThe worksheet focuses on vocabulary, on changing adjectives ending in –ous or –ious to nouns and adverbs, on word meaning and word use.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 49 and 50.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• obviously • spacious• furious • enormously• glamorous • devious • pompous • porous
Dictation❥ He has become very prosperous by mining precious gemstones.❥ There were various delicious desserts to choose from.❥ We were ravenous after the long and arduous journey.❥ He bowed courteously to his gracious queen.
Word extra• dangerous • generous
■ Word ExtraAdd two to five words to the weekly Warm-ups list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
–ness –ity –ty –cy –y
deviousnessobviousnessarduousnessspaciousnessgraciousness
curiosityenormityprosperitypompositygenerosity
delicacyvariety
furycourtesy
pros per ous
pros per ous
ISBN 978 1 76020 452 5
122 123 TargeTing Spelling Year 6 © blake educaTion 2015
term 4 lesson 25 Pencil Work 25Name:________________________________________________________________________________
❂
❂
❂
❂
1 Add –ly to form adverbs from these adjectives. furious ______________________________________ courteous______________________________________
gracious______________________________________ enormous ______________________________________
obvious ______________________________________ ravenous ______________________________________
curious ______________________________________ pompous ______________________________________
2 Match these adjectives with their noun forms. delicious space furious courtesy spacious curiosity enormous pomposity prosperous glamour various fury curious delicacy courteous enormity glamorous prosperity pompous variety
3 Use more or most to show comparison. Yourloungeroomis________________________spaciousthanours. Diamondsarethe________________________preciousofallgemstones. Herlifestyleseemsmuch________________________glamorousthanmine. Igrew________________________and________________________curiousaboutthestrangegreenlight. Youmustsurelybethe________________________courteouspersonIknow!
4 Fill in the missing letters. luscious,mouth-watering,scrumptious d____l____________ous huge,massive,immense,vast e________________ous demanding,tough,strenuous a____d____ous lovely,stunning,exquisite g____r________ous apparent,visible,evident,plain o____v________________
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Make a list of ten delicious desserts.
ISBN 978 1 76020 452 5
122 123 TargeTing Spelling Year 6 © blake educaTion 2015
term 4 lesson 25 Spelling Corner 50
Spot the mistake in each sentence.Write the correct words on the lines.
Match these adjectives to a suitable noun.Write the pairs.
term 4 lesson 25 Spelling Corner 49
enormous day
precious climb
arduous people
spacious jewels
delicious answer
curious elephant
previous dessert
obvious grounds
Whenhediscoveredgold,hebecameaprosprusman. ____________________________________________
Wehadsteakandsalad,followedbyadeliciousdesert. ____________________________________________
Sheworeagoldnecklacesetwithprecousstones. ____________________________________________
Heissuchakindandcurteousboy. ____________________________________________
Sheisafamousfilmstar,livingaglamourouslifeinHollywood. ____________________________________________
Wecouldhearsomeoneshoutingfurioslyoutsidethewindow. ____________________________________________
Thehikersarivedbackfromtheirbushwalkfeelingravenous. ____________________________________________
Wepeepedcurioslythroughtheenormousirongates. ____________________________________________
ISBN 978 1 76020 452 5
124 125 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board WorkToday we will look at the prefix dia– and the suffix –ile. The prefix dia– means through or across.
• Give an example: diagonal (across, from corner to corner); diameter (across a circle).
• –ile is a suffix meaning of and often forms adjectives.
• Give an example: juvenile (of or about youth).
• Remind students that comparative adjectives are usually formed by adding –er and –est. (e.g. big, bigger, biggest). However, adjectives that end in a suffix are compared by placing more and most in front of the adjective. e.g. hostile, more hostile, most hostile.
• With the students complete this table of comparative adjectives.
Teaching notes Focus: Prefix dia– (through, across), suffix –ile (of)
Word Warm-ups
Word extra
diaryprofile
lesson 26
term 4
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 10, List 26.
• Point out that some words begin with dia– and some end in –ile. Words ending in –ile are usually nouns or adjectives.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkAsk the students to spell selected words with common endings added, e.g. dialling, dialled (note doubling), diagnosing, diagonally, diagrams, diamonds.
Closed Book Work• Ask students to study the dia– words for two
minutes and then write as many as they can remember.
• Repeat the process with the –ile words.
dialdialectdialoguediagnosediagramdiagonaldiameterdiaphragmdiamond
fertilefutileagiledocilehostilemobilesterilecrocodilejuvenile
docile more docile most docile futile agile
fertile fragile
We learn to spell
with our eyes and ears.
ISBN 978 1 76020 452 5
124 125 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Direct the students to the Warm-ups list of adjectives
ending in –ile. Explain that, for some of these words, nouns are formed by adding the suffix –ity. Demonstrate by drawing a table. Note the e rule. Ask different students to spell the noun form of each word.
• Do some further word building, e.g. diagnose: diagnostic, diagnosis, diagnoses (pl); diameter: diametrical, diametrically; diagram: diagrammatic, diagrammatical; fertile: infertile, fertilise, fertiliser; mobile: mobilise, immobile; sterile: sterilise, sterility.
• Explain the difference in meaning between diagnosis and prognosis.
• Compare these words: diameter and perimeter; diagonal, hexagonal and octagonal.
term 4
lesson 26
■ Pencil WorkThe worksheet focuses on vocabulary and on changing the adjectives ending in –ile to nouns, word meaning and word use.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 51 and 52.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• diaphragm • docile • sterilise • juveniles • facility • diagnosis • dialled • fertiliser
Dictation❥ It was futile to continue our search for the lost diamond mine.❥ Understanding the tribesmen’s dialect, he had an interesting dialogue with them. ❥ He drew a diagram of a truck with diagonal stripes along the side.❥ She glanced at the dial on her watch and reached for her mobile phone.
Word extra• diary • profile
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
–ity
fertilefutileagile hostilemobile
futility
ISBN 978 1 76020 452 5
126 127 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add –ity to form nouns from these adjectives. Note the e rule. Note how the sound of the i vowel changes from long to short.
mobile ______________________________________ sterile ______________________________________
docile ______________________________________ fertile ______________________________________
agile ______________________________________ hostile ______________________________________
futile ______________________________________ senile ______________________________________
2 Add the correct ending to the bold words. diagonalDrawaline______________________________________fromcornertocorner. diamondWhenthesuncaughtthedew,itsparkledlike______________________________________. diagnoseThedoctor______________________________________theillnessandprescribedmedicine. dialect Wehearddifferent______________________________________spokenacrossthecountry. dial I______________________________________hisnumberonmymobilephone.
3 Complete these words by adding the endings. Check your pronunciation. diagnos(e)+is _______________________________________________
diagnos(e)+tic _______________________________________________
diamet(e)r+ic+al _______________________________________________
diagram+mat+ic _______________________________________________
in+fertile _______________________________________________
im+mobile _______________________________________________
4 Fill in the missing letters. musclebetweenchestandabdomen dia________________________
slopingline,cornertocorner dia____________________
conversationbetweentwoormorepeople dia____________________
useless ____________ile large,lizard-likereptile ________________________ile freefromlivinggerms ________________ile
term 4 lesson 26 Pencil Work 26Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Draw a labelled diagram of a sporting facility.
ISBN 978 1 76020 452 5
126 127 TargeTing Spelling Year 6 © blake educaTion 2015
term 4 lesson 26 Spelling Corner 52
Write about one of the following topics.
Join the word parts. Note any rules.
term 4 lesson 26 Spelling Corner 51
agile+ity ________________________________________________
fertile+ity ________________________________________________
futile+ity ________________________________________________
mobile+ity ________________________________________________
hostile+ity ________________________________________________
diagnose+is ________________________________________________
diagnose+tic ________________________________________________
diagram+mat+ic ________________________________________________
diagonal+ly ________________________________________________
diamet(e)r+ic+al ________________________________________________
■Amobilephone ■Adocileanimal■Alostdiamond ■Anentertainmentfacility
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
ISBN 978 1 76020 452 5
128 129 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Explain the difference between
probable and possible (also improbable and impossible).
Teaching notes Focus: Suffixes –able, –ible (the adjective makers); Antonyms
■ Board Work• List the words inflate, adjust, excite, depend
on the board. Ask a student to read the words. Point out that these words are verbs.
• Add the suffix –able to the end of each word (noting the e rule) and ask a student to read the new words. Note the spelling of the suffix.
• –able is a suffix, an adjective maker. • Explain that the suffix –able means able to
be. Thus, inflatable means able to be inflated; adjustable, able to be adjusted.
• List some further words and ask the students to read the words, e.g. considerable, achievable, comparable. Also knowledgeable, manageable (note that here we keep the e to keep the g soft).
• Discuss word meaning.• List the words permissible, visible, horrible,
sensible on the board. Ask a student to read the words.
• Point out that these words end in the suffix –ible, also an adjective maker and also meaning able to be, e.g. visible means able to be seen; permissible, able to be permitted.
• Note carefully the spelling of these two suffixes. Students can easily mistake which one to use. Explain that, as a general rule, you add –able to “whole” or “proper” words (e.g. likeable, agreeable, remarkable) and –ible to words that are not whole words and cannot stand on their own (e.g. possible, edible, visible, sensible).
• List some further adjectives and ask the students to read the words and look carefully at how the two suffixes are used, e.g. invaluable, treatable, eligible, collapsible, moveable, sensible, tangible, divisible, inhabitable, advisable.
Word Warm-ups
Word extra
probablepossible
lesson 27
term 4
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 10, List 27. • Point out that all their words this week end in
the adjective makers –able and –ible.
• Work through the words in the list. Explain unfamiliar words.
• It is important to use both your eyes and your ears to learn to spell these words correctly.
• Chant the words together, keeping a steady pace.
collectabledurablefashionabledesirablereasonablevaluablehospitabletolerablemanageable
invisibleinvincibleinfallibleintelligiblelegibleaudiblecombustibleadmissibleplausible
As a general rule,
add –able to a “whole” word e.g. likeable, agreeable, remarkable.
Add –ible to words that are NOT whole e.g. possible, edible, visible.
When adding the noun maker –ity
change –able to –abil, e.g. durable, durability; reliable, reliability.
Change –ible to –ibil, e.g. possible, possibility; visible, visibility.
ISBN 978 1 76020 452 5
128 129 TargeTing Spelling Year 6 © blake educaTion 2015
Word Work Continued• Explain that nouns can often be formed from adjectives
ending in –able and –ible by adding the noun maker –ity. List the following words on the board: durable, legible, plausible, audible, manageable, visible, infallible. Ask the students to add –ity. Demonstrate how the able and ible become abil and ibil before adding –ity, e.g. reliable, reliability; responsible, responsibility. Share their understandings.
• Explore antonyms through the use of the prefixes in– or im– and their variants ir– (in front of most words beginning with r) and il– (in front of a word beginning
with l), e.g. probable, improbable; possible, impossible; plausible, implausible; manageable, unmanageable; hospitable, inhospitable; audible, inaudible; admissible, inadmissible; legible, illegible; tolerable, intolerable; intelligible, unintelligible; valuable, invaluable; reasonable, unreasonable; visible, invisible; responsible, irresponsible.
• Explore base words and word families, e.g. non-durable, durability, enduring, endurance; fashion, fashionably; collect, collection, collector; desire, desirous; reason, reasonable, unreasonable; value, valuation; tolerate, tolerance; manage, manager, management; intelligent, intelligence; combustion, non-combustible.
term 4
lesson 27
■ Pencil WorkThe worksheet focuses on antonyms, comparative adjectives and word building.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 53 and 54.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• durable • legible• valuable • manageable • collectable • admissible • combustible • invincible
Dictation❥ His voice was barely audible nor his words intelligible.❥ She thought the fashionable clothes displayed were most desirable.❥ Have you a plausible reason for your late arrival?❥ The desert was inhospitable and the heat intolerable.
Word extra• possible • probable
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
130 131 TargeTing Spelling Year 6 © blake educaTion 2015
term 4 lesson 27 Pencil Work 27Name:________________________________________________________________________________
❂
❂
❂
❂
1 Write the antonyms by adding a prefix. Choose from un–, in–, il– and im–.
desirable ______________________________________ intelligible ______________________________________
legible ______________________________________ admissible ______________________________________
reasonable ______________________________________ valuable ______________________________________
audible ______________________________________ plausible ______________________________________
hospitable ______________________________________ manageable______________________________________
2 Use an antonym from the list above to complete these sentences correctly.
Herwritingisalmost__________________________________________________. Hisevidencewas__________________________________________________incourt. Thestolenpaintingwas__________________________________________________andcannotbereplaced. Theislanddwellerswerehostileand__________________________________________________. Shrinkingbeforethecoach’sangryquestion,hisanswerwasalmost
__________________________________________________.
3 Add more or most to show comparison. Thediamondisthe______________________valuablegemstoneofall. Thehumidityhereis______________________tolerablethaninDarwin. Theropewouldbe______________________manageableifyoutiedknotsatintervals. Youwillbuythe______________________fashionableclothesinParis. Yourwritingwouldbe______________________legibleifyouformedyourletters
______________________carefully.
4 Match these nouns and adjectives. collection desirable value tolerable fashion reasonable combustion manageable desire collectable tolerance valuable reason fashionable management combustible
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Are you a collector? Write about the things you collect.
ISBN 978 1 76020 452 5
130 131 TargeTing Spelling Year 6 © blake educaTion 2015
term 4 lesson 27 Spelling Corner 54
Fill in the gaps. Use the synonym clues.
Change these adjectives to nouns.Follow the pattern.
term 4 lesson 27 Spelling Corner 53
pl________________ble believable,possible,likely,credible
i____t____l________________ble clear,understandable,comprehensible
h________p____________ble friendly,welcoming,kind
de________r____ble wanted,longedfor,fancied
v____l________ble expensive,pricey,helpful,useful
f____sh________________ble stylish,trendy,modern,invogue
invisible ________________________________________________
audible ________________________________________________
plausible ________________________________________________
legible ________________________________________________
durable ________________________________________________
possible ________________________________________________
probable ________________________________________________
invisibility
ISBN 978 1 76020 452 5
132 133 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Prepare a table of verb tenses. With the
students, complete the words in each column.• Explore word building, e.g. endure:
endurance, endurable, unendurable; mature: maturity, immature; pressure: pressurise, impression, expression; assure: assurance, self-assured; obscure: obscurity; intrude: intruder, intrusion, intrusive (change d to s); conclude: conclusion, conclusive (change d to s); attitude: attitudinal.
• Explain the differences in meaning between assure, insure, ensure; altitude, aptitude, attitude.
Teaching notes Focus: Letter teams –ure, –ude
■ Board WorkToday’s words end in ure or ude. In most words, the stress is on the last syllable. Demonstrate. The words are a mixture of verbs, nouns and adjectives.
Word Warm-ups
Word extra
excludesure
lesson 28
term 4
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
■ Book WorkTell the students to open their Word Warm-ups book to page 11, list 28.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book WorkAsk selected students to spell some of the words from the list with common endings added, e.g. pastures, enduring, matured, demurely, intruder, concluding.
endurematureposturepasturepressureassuredemureobscuretemperature
exudeintrudeconcludepreludealtitudeaptitudeattitudegratitudefortitude
Add s Add ing Add ed
endureintrudeconcludeobscurematureexude
endures enduring endured
ISBN 978 1 76020 452 5
132 133 TargeTing Spelling Year 6 © blake educaTion 2015
Word Work Continued• Explain that fortitude is derived from the Latin root fortis
= strong. Other words in the family include: comfort, discomfort, fort, fortify, fortification, enforce, forceful, reinforce.
• Explain that conclude is derived from the Latin root cludo = I shut. Other words in the family include: include, inclusive, inclusion, exclude, exclusive, exclusion, preclude, preclusion, conclusive, conclusion, reclusive.
• Note that, when words end in ude, the d is changed to an s when adding suffixes, e.g. conclude, conclusion, conclusive; intrude, intrusion, intrusive.
term 4
lesson 28
■ Pencil WorkThe worksheet focuses on vocabulary and on word endings, word meaning and word building.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 55 and 56.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
To words ending inade, ide, ode, ude
add sion to form nounsinvade provide explode includeinvasion provision explosion inclusion
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• assurance • pastures • prelude • exuded • demure • enduring • aptitude • fortitude
Dictation❥ He endured the many hardships with fortitude and courage.❥ At this altitude, the mountain peaks are obscured by cloud.❥ Face each day with an attitude of gratitude.❥ Banana crops mature quickly in high temperatures.
Word extra• exclusive • surely
■ Word ExtraAdd two to five words to the weekly Warm-ups list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
134 135 TargeTing Spelling Year 6 © blake educaTion 2015
1 Add an ending to the word in the box to complete the sentences correctly. exude Shesailedintotheroom,______________________________________warmthandcharm. intrude The______________________________________waslatercapturedbythepolice. prelude Composersoftenwrite______________________________________,shortpiecesofmusic. concludeThemysterywasnotsolveduntilthe______________________________________chapter. assure Thecoach______________________________________methatIwouldplayinthefinal.
2 Write sentences to show the differences in meaning.assureinsureaptitudeattitude
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
3 Build new words using prefixes.
4 Be a word builder. Note: (de) = s. Note the e rule. endure+ance ________________________________________________
assure+ance ________________________________________________
conclu(de)+ive ________________________________________________
conclu(de)+ion ________________________________________________
intru(de)+ive ________________________________________________
intru(de)+ion ________________________________________________
im+mature+ity ________________________________________________
obscure+ity ________________________________________________
term 4 lesson 28 Pencil Work 28Name:________________________________________________________________________________
❂
❂
❂
❂
__________________________________________
__________________________________________
im
premature
__________________________________________
__________________________________________
__________________________________________
conexin
clude
__________________________________________
__________________________________________
__________________________________________
inexpro
trude
Word WorkoutWrite for five minutes.
Do not stop. Do not speak.
Write about your own special aptitude.
ISBN 978 1 76020 452 5
134 135 TargeTing Spelling Year 6 © blake educaTion 2015
A Narrow Escape
•Selectsevralbottlesandjarsofvariousshapes.Encludesomewithwidenecksandsomewithnarrownecks.
•Usingamesuringcup,poorexactlythesameamountofwaterintoeachofyourcontainers.
•Placeyourcontainersinaworm,dryplace.
•Aftertwodayscheckthewaterineachcontainer.
Youwillfindthatthecontainerswillallhavediffrentamountsofwater.Why?
Becauseeachcontainerlostwaterduetoevaporashun.
Bottleswithwideneckswillhavelostmorethanoneswithnarrownecksbecausemorewaterwasexpozedtotheair.
term 4 lesson 28 Spelling Corner 56
Find and fix the eight spelling mistakes. Write the correct words.
Add the word parts to build new words.Note (de) = s. Note the e rule.
term 4 lesson 28 Spelling Corner 55
mature+ation ________________________________________________
conclu(de)+ion ________________________________________________
intru(de)+ion ________________________________________________
conclu(de)+ive ________________________________________________
intru(de)+ive ________________________________________________
mature+ity ________________________________________________
obscure+ity ________________________________________________
attitude+in+al ________________________________________________
im+mature ________________________________________________
assure+ance ________________________________________________
ISBN 978 1 76020 452 5
136 137 TargeTing Spelling Year 6 © blake educaTion 2015
Teaching notes Focus: Letter teams qu, ph; Adding common endings; Affixes
■ Board Work• Write qu on the board, reminding students
that q is always followed by u. Give some examples: queen, quick, quiet, quit.
• The letter team qu has two different sounds: the kwa sound in queen, quick and quiet, and the k sound in queue, quay and mosquito.
• Write ph on the board, reminding students that these two letters have one sound, f. Give some examples: phone, phrase, phase, elephant.
Word Warm-ups
Word extra
equatorelephant
lesson 29
term 4
■ Book WorkTell the students to open their Word Warm-ups book to page 11, List 29.
• Work through the list. Remind the students that q is always followed by u and that ph sounds like f.
• Explain any unfamiliar words.
• Chant the words aloud together.
Open Book WorkAsk the students to refer to their list and spell some words with common endings added. Remind them of any rules that might apply, e.g. bouquets, mosquitoes, conquering, tranquilly, sequencing, sapphires.
Consolidation• Ask the students, working in pairs (A and B),
to prepare a list of ten words beginning with qu (student A) and ten words beginning with ph (student B) They should use a dictionary. When they have finished, the pairs share their words with each other, then with other pairs of students.
rule: You must be able to read your words and know what they mean.
• Have a Spelling Bee. Ask the students to stand in a circle. Give them a word. The first student gives the first letter, the next the second letter and so on until the word is spelled. A student sits down when he or she offers an incorrect letter. The person remaining wins. Use the words from the list with or without endings added.
bouquetbanquetantiquemosquemosquitophysiqueconquertranquilsequence
dolphingraphphoneypharmacyphenomenalpharaohsapphireorphantyphoon
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
When you need a q, you will also need a u.
e.g. quick, quaint, quite, queue, quay, mosquito.
ISBN 978 1 76020 452 5
136 137 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word WorkExplore word families. Note any changes to spelling when adding suffixes, e.g. conquer: conqueror; sequence: sequential, sequel; tranquil: tranquillity, tranquillise, tranquiliser; graph: graphic, graphics, photograph, telegraph, autograph, monograph, biography, biographical, autobiography, autobiographical; pharmacy: pharmacist, pharmaceutical; phenomenal: phenomenon; orphan: orphanage.
term 4
lesson 29
■ Pencil WorkThe worksheet focuses on adding endings to make words grammatically correct, on word building and composing sentences.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 57 and 58.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• orphans • tranquil• conqueror • mosquitoes• dolphins • physique• bouquet • antiques
Dictation❥ The pharaoh held a banquet to celebrate his great victory.❥ I bought a can of mosquito repellent at the pharmacy.❥ Upon examination, he found the sapphires to be phoney.❥ His photographs of the typhoon are quite phenomenal.
Word extra• equator • elephant
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
138 139 TargeTing Spelling Year 6 © blake educaTion 2015
term 4 lesson 29 Pencil Work 29Name:________________________________________________________________________________
❂
❂
❂
❂
1 Add the correct endings to the words to complete them correctly. Iaminterestedinstudyingphotograph_____________atTAFE. Theriverflowstranquil_____________throughtheScottishglen. Thereportergaveagraph_____________accountofthehelicopterrescue. KingWilliamwasconquer_____________ofallthelandssouthoftheborder. Mosquito_____________arestinginginsectsthatleaveitchybites.
2 Write sentences around each of these key words. mosquito______________________________________________________________________________________________________________________________
bouquet________________________________________________________________________________________________________________________________
dolphins_______________________________________________________________________________________________________________________________
typhoon_______________________________________________________________________________________________________________________________
3 These words are built from the same root, grapho (I write). Check meanings in a dictionary.
photo+graph______________________________________ auto+graph ______________________________________
tele+graph ______________________________________ auto+bio+graph+y______________________________________
bio+graph+y______________________________________ mono+graph ______________________________________
graph+ic ______________________________________ demo+graph+ic ______________________________________
4 Build new words by adding endings.
tranquilise conquer orphan
–s –s –s
–ed –ed –ed
–ing –ing –age
–er –or
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
List the foods you might serve at a banquet.
ISBN 978 1 76020 452 5
138 139 TargeTing Spelling Year 6 © blake educaTion 2015
Choose one topic to write about.
Slide down the word slides. Write the words and read them to a friend.
term 4 lesson 29 Spelling Corner 57
term 4 lesson 29 Spelling Corner 58
■AnEgyptianpharaoh ■Diggingforsapphires■Themosquitomenace ■Dolphins
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
ban
quet
________________________________________________
tran
quil
________________________________________________
jon
quil
________________________________________________
an
tique
________________________________________________
phys
ique
________________________________________________
tele
phone
________________________________________________
mega
phone
________________________________________________
auto
graph
________________________________________________
photo
graph
________________________________________________
mono
graph
________________________________________________
tele
graph
________________________________________________
bou
quet
________________________________________________
ISBN 978 1 76020 452 5
138 139 TargeTing Spelling Year 6 © blake educaTion 2015
Choose one topic to write about.
Slide down the word slides. Write the words and read them to a friend.
term 4 lesson 29 Spelling Corner 57
term 4 lesson 29 Spelling Corner 58
■AnEgyptianpharaoh ■Diggingforsapphires■Themosquitomenace ■Dolphins
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
______________________________________________________________________________________________________________________________________________________
ban
quet
________________________________________________
tran
quil
________________________________________________
jon
quil
________________________________________________
an
tique
________________________________________________
phys
ique
________________________________________________
tele
phone
________________________________________________
mega
phone
________________________________________________
auto
graph
________________________________________________
photo
graph
________________________________________________
mono
graph
________________________________________________
tele
graph
________________________________________________
bou
quet
________________________________________________
140 141 TargeTing Spelling Year 6 © blake educaTion 2015
■ Board Work• Write the words, music, electric, politics, on
the board. Ask a student to read the words. Add the suffix –ian, to each word and reread.
• –ian is a suffix, meaning one who. One who plays music is a musician, one who does electrical work is an electrician, one who engages in politics is a politician.
• We will also look at the suffix –ial. Words ending in this suffix are usually adjectives used to describe nouns, e.g. crucial information, martial law, special friends.
Teaching notes Focus: Suffixes –ian, –ial
Word Warm-ups
Word extra
socialracial
lesson 30
term 4
■ Book WorkTell the students to open their Word Warm-ups book to page 11, List 30.
• Point out that the words ending in –ian are nouns and the words ending in –ial are adjectives.
• Point out that both ti and ci represent the sh sound in the second list of words.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Ask selected students to spell the plural form
of words in the top set of words.
• Remind students that many adverbs are formed by adding –ly to an adjective. Ask the students to spell selected adverbs, e.g. partially, commercially, essentially, initially, officially.
• Orally spell the base form of the words in the top set, e.g. musician (music), politician (politic), beautician (beauty).
Closed Book Work• Focus on the bottom set of words. Allow
students to view the words for two minutes and then close their books and write as many as they can remember.
• Evaluate the results.
musiciantechnicianelectricianopticianpoliticianbeauticianguardiancomedianlibrarian
martialpartialofficialinitialessentialspatialspecialcrucialcommercial
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
On some days, ask the students to work in pairs and choose a list to
read softly together or to each other.
ISBN 978 1 76020 452 5
140 141 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word WorkMake the links between nouns and/or verbs and adjectives, e.g. musician, musical; technician, technical; electrician, electrical; optician, optical; politician, political, policy; beautician, beautiful, beauty; guard, guardian, guardianship; office, official, officiate; essential, essence; social, society; partial, part; commercial, commerce.
term 4
lesson 30
■ Pencil WorkThe worksheet focuses on exploring different word forms and on word completion.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 59 and 60.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the words
and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• essential • partially • official • librarian• crucial • technician• martial • comedian
Dictation❥ The musicians played a special song for the opening ceremony.❥ The politician wrote his initials on the policy document.❥ It is essential to have an electrician carry out electrical work.❥ The optician advertised inexpensive eyewear on commercial TV.
Word extra• social • racial
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
142 143 TargeTing Spelling Year 6 © blake educaTion 2015
1 Complete this table.
Adjective Noun
musical musician
electrical
optical
political
technical
comical
2 Add –ly to form adverbs from these adjectives. essential ________________________________________ partial ________________________________________
commercial________________________________________ official ________________________________________
initial ________________________________________ social ________________________________________
special ________________________________________ crucial ________________________________________
3 Choose some of those adjectives and adverbs to complete these sentences.
Thenewbridgewas________________________________________openedbythepremier. Thediscoisthebiggest________________________________________eventonourschoolcalendar. Thedoorwas________________________________________open. His________________________________________attemptfailed,sohemusttryagain. Warmclothingis________________________________________forvisitingthesnowfields.
4 Fill in the missing vowels. Advertisementsareseenon___________TV. c____mm____r____________l Wateris___________forlife. ____ss____nt________l Youcanpurchasethisfurnitureata___________price. sp____c________l Judoisoneofthe___________arts. m____rt________l TheRedKnightwasappointed___________ofthetreasure. g________rd________n
term 4 lesson 30 Pencil Work 30Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write an imaginative tale. Begin with: As I was walking down Canterbury Lane …
ISBN 978 1 76020 452 5
142 143 TargeTing Spelling Year 6 © blake educaTion 2015
Spot the mistake in each sentence.Write the correct words.
List the words that belong in the same family.
term 4 lesson 30 Spelling Corner 59
official beauty impartial political societyantisocial officer social partiality beauticianpartial policy beautiful politician officiate
term 4 lesson 30 Spelling Corner 60
Waterandelectricityareconsideredtobeessenshalservices. ________________________________________________
Itiscrucialthatyoutakewaterwithyouintothedessert. ________________________________________________
Thebuildingwasoffishlyopenedin2001. ________________________________________________
Thepolliticiansgatheredforasummitonclimatechange. ________________________________________________
Marshallawwasimposedtoquelltherebelliouscitizens. ________________________________________________
Youwillseeadvertismentsoncommercialtelevision. ________________________________________________
Thetrainwillleaveatthespeshultimeof6.00am. ________________________________________________
Hesignedhisinitalsatthebottomofthepage. ________________________________________________
ISBN 978 1 76020 452 5
144 145 TargeTing Spelling Year 6 © blake educaTion 2015
Teaching notes Focus: Suffixes –ent, –ant
■ Board Work• Explain that the words this week end in the
suffixes –ent or –ant. Many words that end in –ent are adjectives, e.g. a patient person, an obedient dog, an efficient worker. Many words that end in –ant are nouns, e.g. one who assists is an assistant; one who serves is a servant; one who depends on another is a dependant.
• Explain that: Words ending in -ent and –ant are adjectives or nouns. Some words, however, have both endings and are both an adjective and a noun.
Write these words on the board: dependent and dependant; confident and confidant; descendent and descendant and discuss the differences in their meaning.
• With the students complete this table by adding the correct ending to the words.
Word Warm-ups
Word extra
recentdecent
lesson 31
term 4
■ Book WorkTell the students to open their Word Warm-ups book to page 12, List 31.
• Point out that all their words this week end in –ent or –ant.
• Work through the words in the list. Explain unfamiliar words. Note the difference in meaning between dependent and dependant.
• Chant the words together, keeping a steady pace.
Open Book Work• Remind students that many adverbs are
formed by adding –ly to adjectives. Ask the students to spell selected adverbs, e.g. confidently, efficiently, insolently, magnificently.
• Focus on the second set of words. Explore base words orally, e.g. assist(ant), attend(ant), depend(ant), serve(ant).
Closed Book WorkWrite two words from each list on the board. Allow a minute for the students to study the words. Rub the words off the board and ask them to write the four words. Evaluate the results. Repeat with four more words.
dependentdespondentconfidentefficientdifferentinsolentevidentobedientmagnificent
assistantattendantdependantdefendantconsonantconfidantservantdominantrelevant
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
-ent or -antcontestpersistimportservediffer
consultconsist
We learn to spell
with our eyes and ears.
ISBN 978 1 76020 452 5
144 145 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Explain that nouns are formed by adding different
suffixes. Demonstrate by drawing a table. With the students, complete the table.
• Explore antonyms, e.g. decent, indecent; dependent, independent; confident, unconfident; efficient, inefficient; obedient, disobedient; relevant, irrelevant.
term 4
lesson 31
■ Pencil WorkThe worksheet focuses on different word forms, antonyms, base words and word meaning.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 61 and 62.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• magnificent • relevant• difference • consonants• insolent • assistant • despondent • dominant
Dictation❥ The obedient dog sat patiently waiting for his master.❥ The doctor dealt with her patients confidently and efficiently.❥ She was not just a servant, but a friend and confidant.❥ Before judging the defendant, they heard all the evidence against him.
Word extra• recent • decent
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
–ce –cy
decentdependentdespondentconfidentefficientpatientinsolentevidentobedientmagnificentdifferent
dependence
confidence
patienceinsolenceevidenceobedience magnificence difference
decencydependency despondency
efficiency
ISBN 978 1 76020 452 5
146 147 TargeTing Spelling Year 6 © blake educaTion 2015
term 4 lesson 31 Pencil Work 31Name:________________________________________________________________________________
❂
❂
❂
❂
1 Complete this table by adding the correct suffix.Adverb Noun
patient
obedient
different
insolent
magnificent
evident
2 Use prefixes to write antonyms. Choose from dis–, in–, im– and un–. patient ________________________________________ obedient ________________________________________
efficient ________________________________________ dependent ________________________________________
confident ________________________________________ decent ________________________________________
3 Write the base word of each word listed. From the base word build another word.
Base word New word
informant inform information
servant
defendant
assistant
attendant
confident
4 Write sentences to clearly show the difference in meaning between each pair of words. dependentdependant,confidentconfidant
_________________________________________________________________________________________________
_________________________________________________________________________________________________
_________________________________________________________________________________________________
_________________________________________________________________________________________________
_________________________________________________________________________________________________
_________________________________________________________________________________________________
Word WorkoutWrite for five minutes.
Do not stop. Do not speak.
Write about a magnificent fireworks
display.
ISBN 978 1 76020 452 5
146 147 TargeTing Spelling Year 6 © blake educaTion 2015
Add suffixes to these words.
Write these words in noun form.
term 4 lesson 31 Spelling Corner 61
term 4 lesson 31 Spelling Corner 62
confident ________________________________________________
patient ________________________________________________
obedient ________________________________________________
magnificent ________________________________________________
evident ________________________________________________
insolent ________________________________________________
decent ________________________________________________
despondent ________________________________________________
dependent ________________________________________________
proficient ________________________________________________
sufficient ________________________________________________
efficient ________________________________________________
Add –ent Add –ence
reside reside
provide confer
preside confide
differ occur
ISBN 978 1 76020 452 5
148 149 TARGETING SPELLING YEAR 6 © BLAKE EDUCATION 2015
Teaching notes Focus: Suffixes –ence, –ance (the noun makers)
■ Board WorkExplain that the words this week end in the suffixes –ence or –ance. These suffixes are nouns makers, e.g. patient (adjective) becomes patience (noun); prominent (adjective) becomes prominence (noun); occur (verb) becomes occurrence (noun).
Word Warm-ups
Word Extra
fencechance
LESSON 32
TERM 4
■ Book Work• Tell the students to open their Word Warm-
ups book to page 12, list 32.
• Point out that all their words this week end in –ence or –ance.
• Work through the words in the list. Explain unfamiliar words.
• Chant the words together, keeping a steady pace.
Open Book Work• Explain that some words have a plural form,
e.g. occurrences, conferences, experiences, and some don’t, e.g. reliance, radiance, prominence.
• Select some words and ask students if they have a plural form.
Closed Book Work• Write three to five words on the board.
• Tell the students they have one minute to view the words.
• Rub the words off the board and ask the students to write what they can remember.
• Evaluate the results.
• Repeat with different words.
defenceinfluenceincidenceimpudenceconferencereferenceoccurrenceprominenceexperience
balanceambulanceapplianceradiancerelianceeleganceextravagancecompliancemaintenance
Start the first teaching session of the week with a Word Warm-up
using a previous list. For the rest of the week, use the current list.
Use your eyes especially to spell the end part of
words correctly.
Y6-TS-Lessons.indd 148 16/02/2017 12:19 PM
ISBN 978 1 76020 452 5
148 149 TargeTing Spelling Year 6 © blake educaTion 2015
■ Word Work• Explore the differences in spelling between nouns
and adjectives, e.g. defence, defensive; influence, influential; incidence, incidental; influence, influential; prominence, prominent; experience, experiential; radiance, radiant; reliance, reliant, reliable; elegance, elegant; extravagance, extravagant; compliance, compliant.
• Explore words that can be used as both nouns and verbs, e.g. influence, experience, balance.
• Explore antonyms, e.g. balance, imbalance; compliance, non-compliance.
term 4
lesson 32
■ Pencil WorkThe worksheet focuses on different word forms, word building, word use and discriminating between suffixes.
Word WorkoutAsk the students to write about the set topic for five minutes. Writing should be uninterrupted. Students must not ask for advice or help. Thinking needs to be spontaneous. Share only at the end. This is a time for students to show what they know about spelling.
Spelling CornerLearning is reinforced by Spelling Corner activities 63 and 64.
Practice WorkUse word games and other activities to build skills and strategies (see Introduction, pages 6, 7, 9 and 10 for ideas).
■ Assessment Use the assessment items to check the progress of your students. Dictate the
words and sentences, and use the results to diagnose problems, intervening if necessary. Choose all items or make a selection to suit the needs of your class.
Focus Words• extravagance • prominence• compliance • occurrence• elegance • references• reliance • impudence
Dictation❥ An experienced climber knows how to maintain her balance.❥ Many ambulance officers attended the conference.❥ Regular maintenance of household appliances is important.❥ The captain of the defence force has been a strong influence on his men.
Word extra• fence • chance
■ Word ExtraAdd two to five words to the weekly list. These words may be selected from curriculum content, from the sight word or international word lists in the Word Warm-ups book or revisionary words from previous spelling programs. Two revisionary words are offered here.
ISBN 978 1 76020 452 5
150 151 TargeTing Spelling Year 6 © blake educaTion 2015
1 Write the adjective form of these nouns. impudence ________________________________________ reliance ________________________________________
extravagance ________________________________________ compliance ________________________________________
prominence ________________________________________ negligence ________________________________________
elegance ________________________________________ radiance ________________________________________
2 Write sentences using each word, first as a noun and then as a verb. experiencebalanceinfluence _______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
_______________________________________________________________________________________________________________________________________________
3 Build these words. relycomplyrefer
4 Add the correct suffix, –ence or –ance. Sheenteredtheroomwithpoiseandeleg_____________________.
Theirneglig_____________________tocarryoutmainten_____________________resultedinbrokenmachinery.
Borrowrefer_____________________booksfromthelibrarytohelpyouwithyourresearch.
Hewaspunishedforhisimpud_____________________andnon-compli_____________________.
Theincid_____________________ofcholerarosesteeplyaftertheflood.
__________________________________________
__________________________________________
enceee
__________________________________________
__________________________________________
anceable
__________________________________________
__________________________________________
anceant
term 4 lesson 32 Pencil Work 32Name:________________________________________________________________________________
❂
❂
❂
❂
Word WorkoutWrite for five minutes. Do not stop. Do not speak.
Write about a frightening experience in a hot-air balloon.
impudent
ISBN 978 1 76020 452 5
150 151 TargeTing Spelling Year 6 © blake educaTion 2015
Write the verb form of the following words.
Collect the words that belong in the same family.
term 4 lesson 32 Spelling Corner 63
application compliance defence refer incidental appliance
comply referee compliant incidence defendant incident
reliance reliable defend apply reference rely
term 4 lesson 32 Spelling Corner 64
maintenance ________________________________________________
reference ________________________________________________
negligence ________________________________________________
occurrence ________________________________________________
reliance ________________________________________________
compliance ________________________________________________
appliance ________________________________________________
conference ________________________________________________
defence ________________________________________________
radiance ________________________________________________
maintain
ISBN 978 1 76020 452 5
152 153 TargeTing Spelling Year 6 © 2015 blake educaTion
Lesson 11 indirect, incorrect, indifferent, incapable, insane
impatient, impure, impossible, imperfect, immobile
2 incurred, impulsive; inhabitants, immunised; indicates, inhaling; invading, imposed
3 inhabit, inhabitant; indicate, indicator; invade, invasion; indulge, indulgence; inhale, inhalation; imagine, imagination; impress, impression; impair, impairment; immunise, immunisation; impose, imposition
4 inhabitants, individually, indicating, immensely, uninhabited
spelling Corner 1impulsivity, immunisation, inferiority, improvement, uninhabitable, unimportant, indulgence, immortality, imitation, impressionablespelling Corner 2impatient, invalid, informal, imperfect, incorrect, impersonal, improper, incapable, impassable, insignificantLesson 21 disgrace, disconnect, disloyal, discard, disallow,
displease, disobedient, disqualify, disbelieve, disagree, disadvantage, disorganised
2 disagree, disallowed, disconnected, disbelieve, discarded
3 disposal, discussion, disappointment, disgraceful, dismissal
4 dispenses, dispensing, dispensed; discharges, discharging, discharged; disperses, dispersing, dispersed; dislocates, dislocating, dislocated; dissolves, dissolving, dissolved
spelling Corner 3disposal, disastrous, discussion, dislocation, disembarkation, disagreeable, dispersal, dismissal, disfigurement, discouragementspelling Corner 4answers will vary.Lesson 31 wrestling, gnats, writhing, knowledgeable,
gnawing2 answers will vary.3 wristwatch, wrongdoing, kneecap, penknife,
doorknob, swordfight, topknot, knockout, doorknock, shipwreck, kneepads, wristband
4 wrestles, wrestling, wrestled; kneads, kneading, kneaded; writhes, writhing, writhed; gnaws, gnawing, gnawed; wrangles, wrangling, wrangled
spelling Corner 5wrapper, knotty, knowledgeable, knighthood, answerable, wretchedness, wrongfully, wreckage, knives, knittingspelling Corner 6kitchen, carefully, science, about, though, because, evaporated, shrivel
Lesson 41 perspiration, obtained, performance, observant,
persistence2 perfumery, performance, perspiration,
personality, persuasiveness, objectionable, observant, obscurity, obtainable, observatory
3 persuade – coax, convince, induce, talk into persist – continue steadily, endure obvious – apparent, plain, evident, visible obscure – cover, screen, hide obstruct – block, bar, resist, barricade, hinder obstacle – barrier, hitch
4 persuade, personnel, obscured, obtain, persist, perfume
spelling Corner 7objection, obstruction, perfection, perspiration, observation, persuasionspelling Corner 8perfect, defect, infect; obtain, retain, contain; perceive, receive, conceive; obstruct, instruct, construct; persist, insist, resist; observe, reserve, preserveLesson 51 demonstration, devastation, desperation,
deprivation, desolation, detonation, delegation, definition
2 deprived, definitely, devising, demonstrators, devastating
3 destructive, delicatessen, description, delicate, destruction
4 despise, definite, device, describe, desolate spelling Corner 9descends, descending, descended, descendant; delegates, delegating, delegated, delegation; detonating, detonated, detonator, detonation; demonstrates, demonstrating, demonstrated, demonstration, demonstrativespelling Corner 10devote, detour, depressed, deport, deformed, deface, devoid, delay, devalue, deserve, depart, decode, decent, decrease, defeat, defrost, deliver, delight, debrief, derailLesson 61 intercept, concept, except, precept;
interject, project, inject, reject2 rejected, except, project, intercepted, injection3 interruption, interjection, intersection,
transaction, intervention, transition, translation, interaction
4 interactive, transformed, translated, interrupted, transmitted
spelling Corner 11translator, transference, transfusion, transferable, transmitter, transformation, intermittent, interviewee, internally, interchangeable, interference, interactivespelling Corner 12intervenes, intervening, intervened; transmits, transmitting, transmitted; interrupts, interrupting, interrupted; translates, translating, translated; transfers, transferring, transferred; interferes, interfering, interfered
Lesson 71 confiscated, comic; complete, convalescence;
compliant, considerate; conference, computer; concede, complicated
2 confirms, confirmed, confirmation; considers, considered, consideration; combines, combined, combination; conserves, conserved, conservation
3 conference, community, complexity, recommendation, conservation, compliance, incomplete, inconsiderate, unconditional, reconditioned
4 completed, compere, computer, conserve, unconscious
spelling Corner 13compute, complex, comply, complete, commit, congratulate, continue, consider, condition, conscious, commend, continue, consist, completespelling Corner 14consideration, confrontation, commendation, confirmation, conversation, consultation, conservation, continuation, completion, confiscation, construction, communication, congregation, companion, complication, contemplationLesson 81 intermittently, dismissed, pedalled, permitted,
missiles, admittance, committee 2 answers will vary.3 centipede, intermission, stampeded, expedition,
pedestrian4 admit, admittance, admission;
committee, committal, commitment; mission, missionary, intermission; dismiss, dismissal, dismissive
spelling Corner 15admits, admitting, admitted; commits, committing, committed; permits, permitting, permitted; emits, emitting, emitted; transmits, transmitting, transmitted; stampedes, stampeding, stampeded; dismisses, dismissing, dismissedspelling Corner 16admit, remit, permit, emit, transmit; admission, remission, permission, emission, transmissionLesson 91 investigating, investigation;
excavating, excavation; irritating, irritation; separating, separation
2 apology, advertisement, operation, criticism, terrorist
3 analyse, critical, population, apologise, popular4 organise, organist, organism;
minimise, minimal, minimum; terrorise, terrorist, terrorism; criticise, critical, criticism
Answers
ISBN 978 1 76020 452 5
152 153 TargeTing Spelling Year 6 © 2015 blake educaTion
spelling Corner 17operates, operated, operating, operation, operational; terrorist, terrorism, terrorise, terrorising; advertisement, advertising, advertiser, advertised; organist, organism, organic, organise, organisationspelling Corner 18nomination, operation, generation, elevation, excavation, regulation, filtration, illustration, irrigation, interrogation, population, separation, renovation, innovation, demonstration, educationLesson 101 photos, volcanoes (volcanos), cargoes (cargos),
studios, echoes, potatoes, heroes, cellos, tomatoes, silos
2 heroism, pianist, cellist, heroine, soloist, stereophonic
3 cello, silo, avocado, volcano, radio, tornado, piano, tomato
4 solo, embargo, potato, tomato, radio, volcano, tornado
spelling Corner 19answers will vary.spelling Corner 20keyboard, struck, move, metal, produce, different, great, usually Lesson 111 identifying, identified, identification;
modifying, modified, modification; qualifying, qualified, qualification; verifying, verified, verification
2 modify: alter, adjust, vary, adapt mystify: baffle, confuse, perplex, confound classify: sort, order, list, arrange, file magnify: boost, enlarge, exaggerate, amplify notify: tell, advise, instruct, inform
3 disqualify, defiant, significant, declassify, unjustified, defiance, significance, magnificent
4 signature, signal, sigificant, signatory; unidentified, identity, identifiable, identification; injustice, unjustly, justifiable, justification
spelling Corner 21clarification, verification, identification, notification, qualification, modification, magnificationspelling Corner 22defiant, defiance; verifiable, verified; terrific, terrifying; justified, justifiable; horrific, horrified; magnificent, magnificence; pacific, pacifierLesson 121 successful, policies, engineer, regional,
arranging2 accident, century, arranged, emergency, cereals3 successes, cereals, policies, accidents,
emergencies, centuries, incidents, terraces, legends, regions
4 celebration, celebratory; arrangement, arranger; obligation, obligatory; legends, legendary
spelling Corner 23terraces, facilities, engines, policies; arranging, inciting, obliging, policing; digitally, regionally, accidentally, incidentally
spelling Corner 24accident, urgent, police, victims, emergency, hospital, engine, incident, digitalLesson 131 tenor, solicitor, governor, liar, nectar2 regular, survivor, similar, vendor, commentator3 nectarine – type of peach
dissimilar – not alike irregular – outside of a pattern governess – woman who directs in-home education of children scholarship – financial assistance with education censorship – restriction on a form of communication
4 surviving, survived, survivor; sculpting, sculpted, sculptor; governing, governed, governor; sensing, sensed, sensor; commentating, commentated, commentator
spelling Corner 25ace, acorn, acre, actor, amen, an, ant, ante, arc, arm, art, at, ate, atom, came, can, cane, cant, canter, car, care, caret, cart, carton, cat, cater, cent, coat, coma, come, comet, comma, comment, cone, core, corn, cot, cotton, cram, crane, crate, cream, creator, crone, ear, earn, eat, mace, man, mane, manor, mar, maroon, mare, mart, mate, mat, matt, matter, me, mean, meant, meat, memo, men, mentor, met, moan, moat, moe, moment, moon, moot, moor, more, morn, moron, mote, motor, name, near, neat, nett, norm, not, note, oat, oaten, omen, on, once, onto, or, orate, orca, ornate, race, ran, rant, rat, rate, react, ream, recant, rent, roam, roan, rot, rote, room, root, rot, rota, tame, tan, tar, tart, tea, team, tear, teat, ten, tent, to, toe, tomato, tome, ton, tone, toner, too, toot, tore, torment, torn, tote, trace, tram, treat, trotspelling Corner 26exercise, essential, senators, hospitals, view, carries, binoculars, bought, similar, regularly, skateboards, governor, officiallyLesson 141 unattractive, inexpensive, unimpressive,
unproductive, insensitive2 monotonous, microscopic, productivity,
expressiveness, sensitivity, bisection, attractiveness, activity
3 biennial – once every two years biannual – twice a year monologue – a long talk by one person dialogue – conversation between people bisect – cut into two equal parts dissect – cut into pieces to examine the parts
4 most, more, more, most, morespelling Corner 27attractively, sensitively, pensively, productively, impulsively, impressively, intensively, expressivelyspelling Corner 28procedure, discover, surface, carefully, easily, therefore, pillars, becauseLesson 151 election, expiry, elimination, exclusion, elevator2 elevate – lift or raise up
explicit – very clearly and fully set out elongate – stretch out to a greater length expire – come to an end eliminate – remove or get rid of
3 exact, expert, explain, excited, exterminate, expose, example, export, exchange, exit
4
spelling Corner 29electorate, expiry, elasticity, elementary, elevator, elimination, extinction, extinguisher, explicitness, exposurespelling Corner 30extinct, distinct, instinct; exclude, preclude, include; expel, repel, dispel; extend, pretend, distend; expire, umpire, transpire; exclaim, reclaim, disclaimLesson 161 enlarges, enlarging, enlargement;
enforces, enforcing, enforcement; entertains, entertaining, entertainment; endorses, endorsing, endorsement; enchants, enchanting, enchantment
2 envisage – picture something in your mind endorse – support or approve of enchant – delight, charm, cast a spell over endeavour – try or attempt something entire – whole, complete, unbroken
3 entangled, enforcement, enlarge, endangered, endured
4 entreat, mistreat, retreat; entail, retail, detail; enquire, require, acquire
spelling Corner 31entanglement, entitlement, entertainment, enlargement, enchantment, enticement, encouragement, endorsement, enforcement, enrichment, enjoyment, enhancementspelling Corner 32answers will vary.Lesson 171 replete, complete, deplete;
refuse, defuse, confuse; resemble, assemble, dissemble; repute, dispute, compute
2 complete, computer, depleted, dispute, assembled
3 refrigeration, remuneration, renovation, regulation, recollection, restriction
4 resonated (or resounded), refrigerator, relatives, registered, replenished
spelling Corner 33resembles, resembled, resembling, resemblance; reminisced, reminiscing, reminiscent, reminiscence; retrieves, retrieved, retriever, retrieval; restricts, restricted, restrictive, restriction
Answers
d e X p i r Y T n Ve X T i n c T H e gY p c S l e b H l Mr e u n Z d e p e WJ r k e d o l r c ec i T S a l e o T XF e b p i p M l i iT n e a n X e g o Ti c W l p e n Q n VS e l e V a T i o n
ISBN 978 1 76020 452 5
154 155 TargeTing Spelling Year 6 © 2015 blake educaTion
spelling Corner 34reduction, respectful, reversal, resistance, requirement, reference, representative, remarkable, rejection, refugeeLesson 181 reduction – reduce; inclusion – include;
decision – decide; explosion – explode; decoration – decorate; demolition – demolish; collision – collide; pollution – pollute; conclusion – conclude; division – divide
2 decorative, inclusive, decisive, impressive, explosive, conclusive, divisive, expressive
3 instructions, occasionally, caption, decorations, demolition
4 unemotional, cautionary, impressionable, occasional, instructional, precaution
spelling Corner 35instruct, resolve, construct, impress, decorate, include, reduce, conclude, express, demolishspelling Corner 36answers will vary.Lesson 191 previous, envious, devious;
proclaim, reclaim, disclaim; process, access, recess; prescribe, describe, inscribe
2 proclaimed, prescribed, procession, propeller, protection
3 provoke, provocation – make angry, irritate, goad, annoy precise, precision – exact, correct, specific proficient, proficiency – skilled, expert, accomplished prescribe, prescription – order for use as treatment propel, propeller – drive forward, push, shove
4 unpredictable, previously, proficiency, imprecise, progressive, precedent, prohibitive, protective, proclamation, procession
spelling Corner 37provisional, propeller, imprecise, unprovoked, protective, precariously, precision, previouslyspelling Corner 38progressive, progression; processor, procession; prohibition, prohibitive; prediction, predictable; protection, protector; precedent, precedence; production, productiveLesson 201 incessantly, reduction, conductor, receding,
excessive2 production, introduction, procession, deduction,
accession, reduction, education, succession, induction, recession
3 excess, preceded, produce, abduct, process4 deduct, product, induct, abduct, conduct;
process, recess, access, success, excess; reduce, induce, produce, deduce, introduce
spelling Corner 39introductory, excessive, proceedings, precedent, inducement, deductible, productivity, successful, successive, educational, abduction, accessiblespelling Corner 40recent, learning, instrument, focus, experience, attention, environment, including
Lesson 211 gradually, personally, centrally, manually,
naturally, originally, medically, actually, individually, nationally
2 personality, originality, individuality, locality, punctuality, triviality, nationality, finality
3 punctuate, punctuation; medicate, medication; integrate, integration; graduate, graduation; federate, federation
4 natural, feral, trivial, manual, gradualspelling Corner 41federal government, natural resources, terminal illness, manual labour, medical doctor, frugal person, gradual decline, central character, feral animal, personal achievementspelling Corner 42originally, originality; naturally, naturalist; personally, personality; fatally, fatality; nationally, nationalist; casually, casualty; individually, individualityLesson 221 mysterious, hysterical, temporarily, physically,
cymbals2 mutinous, ordinary, mysteries, motley, fallacy3 industries, lullabies, fallacies, journeys,
mysteries, canaries, mutinies, libraries4 temporarily, mutinous, ordinarily, industrial,
fallacious, industrious, hysterical, cylindricalspelling Corner 43answers will vary.spelling Corner 44industries, lullabies, mysteries, monkeys, valleys, trolleys, fallacies, cities, keys, donkeys, canaries, hobbies, ponies, enemies, duties, jockeys, libraries, journeysLesson 231 symptom – indicator of illness or disease
syrup – thick, sweet liquid symbol – emblem, token, sign synopsis – outline, plan, summary symphony – musical composition for an orchestra sympathy – compassion, tenderness of feeling
2 hygienic, systematic, symphonic, symbolic, hyphenated, sympathised, systematise, symbolise
3 hyphenated, symbolic, hygienic, systematic, sympathised
4
spelling Corner 45ache, act, aim, aitch, am, ape, as, ash, asp, at, ate, came, camp, cap, cape, cast, caste, cat, catty, chai, chat, champ, chap, chase, chasm, chaste, cheap, cheat, chimp, chip, chit, cite, each, easy, eat, empathic, empathy, epic, ethics, etch, ham, hasp, hat, hate, he, heap, heat, hemp, him, hype, ice, icy, imp, it, itch, item, its, mace, map, mash, mast, mat, matt, match, mate, maths, may, me, meat, mesh, met, mica, mice, mist, mite, mitt, my, myth, mythic, pace, past, paste, pat, patch, patchy, pate, path, pathetic, pay, pea, peach, peat, pet, pica, pie, pit, pita, pitch, pith, pithy, same, sat, sate, say, scam, scamp, scape, scat, scythe, seam, seat, septic, set, sham, shame, shape, she, ship, shy, sit, site, space, spam, spat, spate, spice, spit, spite, spy, stamp, static, stay, steam, step, sty, stye, tame, tamp, tap, tape, taste, tasty, tat, tea, teach, team, teat, test, testy, that, the, them, they, this, thy, thyme, tic, tie, time, type, tythe, yam, yap, yeast, yes, yet, yetispelling Corner 46often, also, divide, won’t, examples, newspaperLesson 241 accurately, absently, abruptly,
absolutely, absurdly, abundantly2 abbreviated, abbreviating, abbreviation;
accelerated, accelerating, acceleration; accommodated, accommodating, accommodation; accessed, accessing, accession; abducted, abducting, abduction; accumulated, accumulating, accumulation
3 answers will vary.4 acceptance, acceptable; accountant,
accountable; abundantly, abundancy spelling Corner 47accountant, accomplishment, absenteeism, accelerator, acceptable, accuracy, abruptness, abductor, accountable, absurdity, accompaniment, accompanist spelling Corner 48absent, abbreviate, accept, accelerator, abdomen, absorbed, account, absoluteLesson 251 furiously, graciously, obviously, curiously,
courteously, enormously, ravenously, pompously2 delicious, delicacy; spacious, space; prosperous,
prosperity; curious, curiosity; glamorous glamour; furious, fury; enormous, enormity; various, variety; courteous, courtesy; pompous, pomposity
3 more, most, more, more, more, most4 delicious, enormous, arduous, gorgeous,
obviousspelling Corner 49enormous elephant, precious jewels, arduous climb, spacious grounds, delicious dessert, curious people, previous day, obvious answerspelling Corner 50prosperous, dessert, precious, courteous, glamorous, furiously, arrived, curiously
Answers
Y n o H p M Y S n Sg S Y r u p T H e YH Y p H e n i b g Mr M S Y M b o l o pJ p u g d F Z T r ac T T i a l e o d TF o b e l n e p Y HS M Y n c X r d H Yi S r e p e n Q n VH Y p o d e r M i c
ISBN 978 1 76020 452 5
154 155 TargeTing Spelling Year 6 © 2015 blake educaTion
Lesson 261 mobility, docility, agility, futility,
sterility, fertility, hostility, senility2 diagonally, diamonds, diagnosed, dialects,
dialled3 diagnosis, diagnostic, diametrical,
diagrammatic, infertile, immobile4 diaphragm, diagonal, dialogue, futile, crocodile,
sterilespelling Corner 51agility, fertility, futility, mobility, hostility, diagnosis, diagnostic, diagrammatic, diagonally, diametricalspelling Corner 52answers will vary.Lesson 271 undesirable, illegible, unreasonable, inaudible,
inhospitable, unintelligible, inadmissible, invaluable, implausible, unmanageable
2 illegible, inadmissible, invaluable, inhospitable, inaudible
3 most, more, more, most, more, more4 collection, collectable; fashion, fashionable;
desire, desirable; reason, reasonable; value, valuable; combustion, combustible; tolerance, tolerable; management, manageable
spelling Corner 53audibility, plausibility, legibility, durability, possibility, probabilityspelling Corner 54plausible, intelligible, hospitable, desirable, valuable, fashionableLesson 281 exuding, intruder, preludes, concluding, assured2 answers will vary.3 immature, premature;
conclude, exclude, include; intrude, extrude, protrude
4 endurance, assurance, conclusive, conclusion, intrusive, intrusion, immaturity, obscurity
spelling Corner 55maturation, conclusion, intrusion, conclusive, intrusive, maturity, obscurity, attitudinal, immature, assurancespelling Corner 56several, include, measuring, pour, warm, different, evaporation, exposedLesson 291 photography, tranquilly, graphic, conqueror,
mosquitoes2 answers will vary.3 photograph, telegraph, biography, graphic,
autograph, autobiography, monograph, demographic
4 tranquillises, tranquillised, tranquillising, tranquilliser; conquers, conquered, conquering, conqueror; orphans, orphaned, orphanage
spelling Corner 57bouquet, banquet, tranquil, jonquil, antique, physique, telephone, megaphone, autograph, photograph, monograph, telegraphspelling Corner 58answers will vary.
Lesson 301 electrician, optician, politician, technician,
comedian2 essentially, commercially, initially, specially,
partially, officially, socially, crucially3 officially, social, partially, initial, essential4 commercial, essential, special, martial, guardianspelling Corner 59official, officer, officiate; beauty, beautician, beautiful; impartial, partiality, partial; society, antisocial, social; political, politician, policy spelling Corner 60essential, desert, officially, politicians, Martial, advertisements, special, initialsLesson 311 patiently, patience; obediently, obedience;
differently, difference; insolently, insolence; magnificently, magnificence; evidently, evidence
2 impatient, inefficient, unconfident, disobedient, independent, indecent
3 serve (service, disservice, servile); defend (defender, defence, defensive); assist (assistance, assisting); attend (attendance, attention, attentive); confide (confidence, confidential, confidant)
4 answers will vary.spelling Corner 61confidence, patience, obedience, magnificence, evidence, insolence, decency, despondency, dependency, proficiency, sufficiency, efficiencyspelling Corner 62resident, provident, president, different, residence, conference, confidence, occurrenceLesson 321 extravagant, prominent, elegant,
reliant (reliable), compliant, negligent, radiant2 answers will vary.3 reliance, reliable; compliance, compliant;
reference, referee4 elegance, negligence, maintenance, reference,
impudence, non-compliance, incidencespelling Corner 63application, apply, appliance; compliance, compliant, comply; defence, defendant, defend; refer, referee, reference; incidental, incidence, incidentspelling Corner 64refer, neglect, occur, rely, comply, apply, confer, defend, radiate
Year 6 term assessment (Proofreading)term 1permitted, dismissed interval, compere desperate, devastating congratulated, completion impatient, expeditionterm 2advertisements, regularly photos, accident endangered, environment cereal, region policies, simplifyterm 3temporarily, renovations excessively, collision regulations, registered conductor, Symphony receded, retrieveterm 4patiently, pedestrian maintenance, essential temperature, intolerable antique, diamond enormous, visible
Answerst
ISBN 978 1 76020 452 5
156 PB TargeTing Spelling Year 6 © 2015 blake educaTion
The Word Warm-ups book is the starting point and focus of each spelling lesson and all students will need their own copy. The following pages can be photocopied to create the 16-page Year 6 Word Warm-ups book or you can use the file on the CD. Students will use this book throughout the year as you use the Targeting Spelling program.Through the Word Warm-ups, students will be introduced to a number of important phonic and structural elements with an emphasis on prefixes and suffixes, and Latin and Greek roots. The lists provide the springboard for teaching students how to apply rules and make generalisations
about spelling. They will also learn how to make the subtle adjustments needed in spelling (and often in pronunciation), particularly when adding suffixes. Students will soon be able to spell a wide range of words within the context of their writing and within the limits of their speaking and reading vocabulary. The Warm-ups book also includes a list of international words and a sight word checker that can be used to gather valuable diagnostic information on incoming or graduating students. it also lists the basic spelling rules as a reference for students.
Word Warm-ups book
Creating the Word Warm-ups books
The following pages can be photocopied (double-sided) to create the 16-page
Word Warm-ups book. These pages are also supplied on the cd if you prefer to print from there. There is an optional
colour cover on the cd. otherwise students should be encouraged to colour their own covers
to create their own unique booklet. To print a single copy from the cd do the following:1 Select and open the Word Warm-ups PDF file.
2 load at least four clean a4 pages on your printer.
3 Select odd pages only.
4 Set page Scaling to none.
5 collect the printed pages, noting which edge is the top of the page.
6 load the printed pages, without changing their order, and with the blank sides to be printed next and the top at the correct edge.
7 Select even pages only.
8 Fold in half and staple in the centre.
ISBN 978 1 76020 452 5
Spelling RulesThe doubling rule
When a one-syllable word has a short vowel followed by one consonant, double that consonant before adding –ing, –ed, –er, –est, –y, e.g. run, running; hop, hopped; mud, muddy; big, bigger; tall, tallest.Do not double if there are two consonants after the short vowel, e.g. jump, jumping; send, sender; milk, milked; mist, misty; fond, fondest.
❂The e ruleWhen a word ends in e, drop the e before adding an ending that begins with a vowel or y, e.g. ride, riding; hope, hoped; shine, shiny; fame, famous; safe, safer.When a word ends in e, do not drop the e before adding an ending that begins with a consonant, e.g. use, useful; price, priceless; close, closely; safe, safety; like, likeness.
❂The y ruleWhen a word ends in y, change the y to i before adding an ending, e.g. baby, babies; busy, busily; dry, drier; lazy, laziest.Do not change the y before adding ing, e.g. dry, drying; carry, carrying. Do not change the y if the letter before the y is a vowel, e.g. boy, boys; day, days; employ, employed; play, player.
16
Targeting Spelling Year 6 © 2015 Blake Education
❂The f ruleWhen a word ends in f,
change the f to v and add es to form the plural (you will hear the sound you need to
write), e.g. leaf, leaves; wolf, wolves; half, halves. Two exceptions are:
roofs, chiefs.
The c rule❂ Write ei after c when c sounds like s, e.g. ceiling, receipt, conceit, deceive. Write ei when those letters sound like a, e.g. weigh, vein, reign, beige.
Most of the time, write i before e except after c, e.g. piece, field, chief, shield (some exceptions are seize, their, weird).
Targeting Spelling
Targeting Spelling Year 6 © 2015 Blake Education
Year 6
Name: ________________________________________________________________
Word Warm ups
Word Warm ups
ISBN 978 1 76020 452 5
2 15Word Warm-upsours
ourselves
out
over
past
quite
ready
said
saw
shall
she’s
she’d
she’ll
should
should’ve
since
some
somebody
someone
somehow
something
sometimes
somewhat
somewhere
still
than
that’ll
that’s
that’d
their
theirs
themselves
then
there
there’d
there’ll
there’s
therefore
these
they
they’d
they’ll
they’re
they’ve
those
though
thorough
through
till
too
took
towards
two
under
unless
until
upon
upwards
very
was
wasn’t
we’d
we’ll
we’re
we’ve
well
went
were
weren’t
what
what’s
whatever
when
whenever
where
where’d
where’ll
where’s
wherever
whether
which
while
who
who’d
who’ll
who’s
whom
whose
why
why’s
with
without
won’t
would
would’ve
wrong
yes
yet
you
you’d
you’ll
your
you’re
yours
Sight word checker 1 in– 2 dis– 3 Silent k
incur
indicate
individual
inferior
inflict
inhale
inhabit
indulge
invade
im–
implore
impulse
impress
impatient
impose
imitate
immaculate
immense
immunise
disease
disaster
discuss
discredit
discharge
discount
disembark
disfigure
disguise
disgust
dispose
dispatch
dispense
disperse
dispute
dismiss
dislocate
dissolve
knack
knead
knobbly
knapsack
knick–knack
knowledge
Silent g
gnaw
gnash
gnome
gnat
gnarled
Silent w
writhe
wreath
wretched
wrangle
wrestle
Word Extraimpossible inaccurate
disapprove disturb
knuckles written
Targeting Spelling Year 6 © 2015 Blake Education Targeting Spelling Year 6 © 2015 Blake Education
ISBN 978 1 76020 452 5
14 3
aboard
about
above
across
after
afterwards
again
against
ago
almost
along
alright
also
although
always
among
another
any
aren’t
around
away
because
been
before
behind
below
beneath
beside
between
beyond
both
busy
came
can’t
could
couldn’t
despite
didn’t
done
don’t
does
doesn’t
down
during
each
either
else
ever
every
everybody
everyone
everything
everywhere
for
forever
forthwith
forward
from
gave
goes
gone
good
great
hasn’t
hadn’t
haven’t
he’s
he’d
he’ll
herself
here
himself
how
I’d
I’ll
I’m
I’ve
made
many
maybe
meanwhile
might
mine
more
moreover
much
must
myself
neither
never
nevertheless
next
none
nothing
nowhere
off
often
once
one
only
other
otherwise
ought
our
Sight word checker Word Warm-ups4 ob– 5 de– 6 inter–
object
obstruct
obtain
obscure
obsolete
observe
obstacle
obnoxious
obvious
per–
perfect
perform
perfume
persevere
persuade
persist
perspire
perceive
personnel
despise
devise
device
destroy
deprive
describe
descend
devour
detergent
decade
delegate
detonate
devastate
delicate
definite
desperate
desolate
destitute
interact
interfere
intercept
interrupt
interject
intersect
intervene
interview
interval
trans–
transact
transfer
transform
transport
translate
transit
transmit
transmission
transparent
Word Extra
symbol system develop delete outburst outbreak
Targeting Spelling Year 6 © 2015 Blake Education Targeting Spelling Year 6 © 2015 Blake Education
ISBN 978 1 76020 452 5
4 13International words
abacus
alias
alibi
average
ballet
bazaar
bizarre
bistro
bolero
bonsai
boulevard
broccoli
canyon
colonel
coupon
croissant
dachshund
debris
dollop
futon
galore
gherkin
glacier
hooligan
jamboree
javelin
karate
kebab
kimono
knapsack
lasagne
leisure
maestro
magazine
margarine
marmalade
marriage
matinee
memoirs
monarch
mortgage
mosque
museum
mystery
omelette
origami
pagoda
panorama
parachute
parliament
pedigree
pretzel
pyjamas
question
quiche
rodeo
rucksack
sachet
salvage
sari
spaghetti
sporran
stimulus
sushi
syllable
tarantula
tornado
tycoon
typhoon
unique
vacuum
veneer
Word Warm-ups7 com– 8 mito, missus, I send 9 –ate
comply
complex
complete
compute
compere
commend
communicate
complicate
compulsory
con–
confer
confirm
conserve
consider
condition
conscious
confiscate
congratulate
convalesce
commit
permit
remit
remiss
dismiss
missile
mission
intermission
intermittent
pes, pedis, foot
pedal
pedestal
pedlar
pedestrian
expedition
impede
centipede
millipede
stampede
operate
investigate
irritate
estimate
excavate
navigate
separate
populate
nominate
–ise
advertise
apologise
criticise
organise
recognise
minimise
exercise
terrorise
analyse
Word Extra
compare construct emit transmit energy chemist
Targeting Spelling Year 6 © 2015 Blake Education Targeting Spelling Year 6 © 2015 Blake Education
ISBN 978 1 76020 452 5
12 5Word Warm-ups31 –ent 32 –ence Troublesome words
dependent
despondent
confident
efficient
different
insolent
evident
obedient
magnificent
–ant
assistant
attendant
dependant
defendant
consonant
confidant
servant
dominant
relevant
defence
influence
incidence
impudence
conference
reference
occurrence
prominence
experience
–ance
balance
ambulance
appliance
radiance
reliance
elegance
extravagance
compliance
maintenance
Word Extrarecent decent fence chance
Word Warm-ups10 –o 11 –fy 12 Soft g
solo
silo
cello
photo
piano
radio
studio
stereo
cappuccino
hero
echo
potato
tomato
embargo
cargo
tornado
avocado
volcano
signify
simplify
magnify
modify
notify
qualify
justify
identify
terrify
defy
intensify
horrify
mystify
verify
pacify
testify
clarify
classify
arrange
agenda
digital
urgent
engine
region
oblige
emerge
legend
Soft c
accident
incident
police
policy
facility
terrace
cereal
celebrate
century
Word Extra
search worst fulfil seldom centre general
Targeting Spelling Year 6 © 2015 Blake Education Targeting Spelling Year 6 © 2015 Blake Education
ISBN 978 1 76020 452 5
6 11Word Warm-ups Word Warm-ups28 –ure 29 qu 30 –ian
endure
mature
posture
pasture
pressure
assure
demure
obscure
temperature
–ude
exude
intrude
conclude
prelude
altitude
aptitude
attitude
gratitude
fortitude
bouquet
banquet
antique
mosque
mosquito
physique
conquer
tranquil
sequence
ph
dolphin
graph
phoney
pharmacy
phenomenal
pharaoh
sapphire
orphan
typhoon
musician
technician
electrician
optician
politician
beautician
guardian
comedian
librarian
–ial
martial
partial
official
initial
essential
spatial
special
crucial
commercial
Word Extra
exclude sure equator elephant social racial
13 –or 14 –ive 15 ex–tenorvendorsensorcensorsculptorsolicitorsurvivorgovernorcommentator
–ar
liar
scholar
nectar
regular
singular
similar
spectacular
perpendicular
binoculars
attractivesensitiveintensiveimpressiveimperativeexpressivepensiveexpensiveproductive
mono–
monopolymonotonemonologue
bi–
bicyclebiennialbilingual
micro–
microscopemicrophonemicrowave
expelexpireexplicitexhaleextinctexcludeexperienceextinguishextravagant
e–
elect
elapse
elastic
elaborate
eliminate
elongate
elevate
element
eligible
Word Extra
author dollar active selective exhibit examine
Targeting Spelling Year 6 © 2015 Blake Education Targeting Spelling Year 6 © 2015 Blake Education
ISBN 978 1 76020 452 5
10 7Word Warm-ups16 en– 17 re– 18 –ion
endure
endanger
entice
enchant
endorse
engrossed
enlarge
enquire
enslave
entire
entitle
ensue
entreat
entangle
entertain
endeavour
envisage
environment
retrieve
reprieve
replenish
religion
resemble
restrict
reluctant
recuperate
remunerate
recollect
recommend
regulate
register
relative
reminisce
remedy
renovate
resonate
caution
caption
commotion
pollution
decoration
demolition
instruction
reduction
resolution
inclusion
exclusion
explosion
occasion
decision
division
collision
impression
conclusion
Word Extra
enforce enthral recede refrigerate emotion exception
25 –ious 26 dia– 27 –able
curious
furious
devious
obvious
various
delicious
precious
spacious
gracious
–ous
courteous
glamorous
gorgeous
porous
pompous
prosperous
arduous
enormous
ravenous
dial
dialect
dialogue
diagnose
diagram
diagonal
diameter
diaphragm
diamond
–ile
fertile
futile
agile
docile
hostile
mobile
sterile
crocodile
juvenile
collectable
durable
fashionable
desirable
reasonable
valuable
hospitable
tolerable
manageable
–ible
invisible
invincible
infallible
intelligible
legible
audible
combustible
admissible
plausible
Word Extra
dangerous generous diary profile probable possible
Word Warm-ups
Targeting Spelling Year 6 © 2015 Blake Education Targeting Spelling Year 6 © 2015 Blake Education
ISBN 978 1 76020 452 5
8 9Word Warm-ups19 pre– 20 duco, ductus, I lead 21 –al
precede
precise
preclude
predict
prescribe
precarious
predicament
preliminary
previous
pro–
protect
process
progress
provoke
provide
propel
proclaim
prohibit
proficient
conduct
deduct
induct
product
produce
reduce
induce
introduce
educate
cedo, cessus, I go
access
excess
success
process
proceed
succeed
recede
concede
incessant
central
natural
national
frugal
personal
punctual
medical
integral
actual
federal
feral
trivial
manual
gradual
several
original
Aboriginal
individual
Word Extra
preserve propose recess exceed rural casual
Word Warm-ups22 y 23 hy– 24 ab–
mutiny
motley
gaudy
industry
ordinary
temporary
ferry
fallacy
canary
cymbal
cylinder
hysteria
mystery
pyramid
pyjamas
physical
gymnasium
lullaby
hyena
hygiene
hype
hybrid
hyphen
hydrogen
hydrant
hydroponic
hypodermic
sy–
syrup
syringe
system
symbol
symptom
sympathy
symphony
synopsis
synthetic
abduct
absurd
absorb
absent
absolute
abdomen
abrupt
abundant
abbreviate
acc–
accept
accent
accelerate
account
accurate
accomplish
accompany
accommodate
accumulate
Word Extra
journey library liquid squalid accident accrue
Targeting Spelling Year 6 © 2015 Blake Education Targeting Spelling Year 6 © 2015 Blake Education
ISBN 978 1 76020 452 5
Also available:
Del M
errickTargeting Spelling
The ultimate resource for teaching spelling
Del Merrick
Student disk:
10 fun spelling
games for Year 6
students written to
support this program
Teacher disk:
hands-on activity cards,
assessment records,
Word Warm-Ups booklet
and all worksheets
Blake’s
10 fun games suitable for PC & Mac
© 2010 PASCAL PRESS. ALL RIGHTS RESERVED. www.pascalpresss.com.au
disk
6ages11–12
To open PC : will run automatically. MAC : click on disk icon. Installation instructions are on the disk.
SpellingspellingGamesGames
photocopiable
spelling reference
for each student
© 2015 BLAKE EDUCATION. ALL RIGHTS RESERVED. PENALTIES fOR UNAUTHORIzED COPyING IN
CLUDE A
$50,
000
fINE
INSTALLATION WINDOWS 1. Put disk in CD-ROM drive and it should begin automatically.
2. If it does not run then open Windows Explorer, navigate to the CD-ROM and double click the TGT_Spell_Yr_6 icon.
MAC Put disk in CD-ROM drive and double click TGT_Spell_Yr_6 icon.
SOFTWARE REQUIREMENTS WINDOWS & MAC Adobe Acrobat Reader, Microsoft Office Excel,
Microsoft Office Word.
Targeting
YEAR
6TeACher
DISk
★ Acomprehensiveintroductionfromtheauthorexplaininghowtousetheprogramanditsvariouselementstoachieveoutstandingresults
★ 32weeklylesson planswithteachingnotesandphotocopiableworksheets
★ AphotocopiableWord Warm-Ups bookletforusebyeachstudentthroughouttheyear
★ ABlake’s Spelling Games CD-ROMwith10spellinggameswrittentosupporttheprogram
★ ATargeting Spelling CD-ROM–withphotocopiablewordcardsforhands-onactivities,games,assessmentrecordkeeping,PencilWorkandSpellingCornercards.
★ BOARD WORk—developingconceptsthroughexplicitteachinganddemonstration
★ BOOk WORk—usingthewordlistsintheWordWarm-Upsbookletasafocusforlearning
★ WORD WORk —exploringworduse,wordbuildingandassociatedrules
★ MeMORy WORk —providinghelptostudentstomemorisesightwords
★ PenCil WORk —photocopiableworksheetsandSpellingCornercardstoenablestudentstoapplytheskillsandstrategiestheyhavebeenlearning
★ PRACTiCe WORk —usinghands-onmaterialsandspellinggamestoconsolidateandbuildskills
★ ASSeSSMenT —dictationofwordsandsentencesusingtheweek’sfocuslist.
This book contains:
each weekly lesson plan contains the following elements:
includesAustralian Curriculum correlations
is a whole-school spelling program that has been developed and trialled
in classrooms over many years with outstanding results. It can be used equally successfully by individual teachers and will provide students
with a solid foundation in spelling.
Targeting Spelling
Targetingyear 6
yea
r 6
ISBN 978-1-76020-452-5
9 7 8 1 7 6 0 2 0 4 5 2 5
Top Related