A glimpse into the course material
Topic 1
Course Information
Curricula materials: Structural Bioinformatics, 2nd editionEditors: Gu and BournePublisher: Wiley-BlackwellYear: 2009 ISBN-10: 0470181052
Course website: http://coitweb.uncc.edu/~drlivesa/BINF6202.html
Syllabus: http://coitweb.uncc.edu/~drlivesa/BINF6202/BINF6202_syllabus.pdf
Acknowledgement: Many of the slides used in this class were originally created by Dr. Jun-tao Guo. Thanks for sharing Jun-tao!
Crick, F.H.C. (1958): On Protein Synthesis. Symp. Soc. Exp. Biol. XII, 139-163. Crick, F. (1970): Central Dogma of Molecular Biology. Nature 227, 561-563.
The Central Dogma of Molecular Biology
Protein-DNA
2I1C4TRA
RNA Protein-RNA
Protein Functions
Catalysis: Enzymes
Structural proteins: keratin, actin, tubulin…
Signalling proteins: insulin, growth hormone…
Immunity: antibodies
Transport proteins: ion transport, O2 transport…
…
>1MBN:_ MYOGLOBIN (154 AA) MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKAGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Proteinname Protein
sequence
Protein structure
Oxygen storage
Protein function
Protein and Protein Structure
Molecular modeling with kindergarten supplies
Linus Pauling won the Nobel Prize in Chemistry in 1954 "for his research into the nature of the chemical bond and its application to the elucidation of the structure of complex substances".
Pauling summarized his work on the chemical bond in The Nature of the Chemical Bond, one of the most influential chemistry books ever published.
See: http://www.youtube.com/watch?v=yh9Cr5n21EE
“As a result of Kendrew's and Perutz' contributions it is thus becoming possible to see the principles behind the construction of globular proteins. The goal has been reached after twenty-five years' labour, and initially with only modest results” --Professor Hagg
The 1962 Nobel Prize in Chemistry Goes to…
Max Perutz and John Kendrew "for their studies of the structures of globular proteins”.
The 1962 Nobel Prize in Physiology or Medicine…
The Nobel Prize in Physiology or Medicine 1962 was awarded jointly to Francis Harry Compton Crick, James Dewey Watson and Maurice Hugh Frederick Wilkins "for their discoveries concerning the molecular structure of nucleic acids and its significance for information transfer in living material".
Experimental Methods for Structure Determination
“Protein Structure and Function”, Petsko GA and Ringe D
X-ray crystallography
Nuclear magnetic resonance (NMR)Protein
purification
Protein Data Bank (PDB)
http://www.rcsb.org/pdb/
Yearly Growth of Total Protein Structures
Year
• The first reported structure is myoglobin• PDB was set up in 1971• As of Jan. 5, 2010, there are 57,769 protein structures
Laskowski, RA. Thornton, JM. Nature Review Genetics, 9:141-151
Timeline of Structural Determination of Some Key Bio-molecules
Molecular Machinery: A Tour of the Protein Data Bank
Structure Visualization
Pymol image Gallery: http://www.pymol.org
Protein Structure Classification
Hou et al. PNAS 2005 102:3651-3656
Class (C), Architecture (A), Topology (T) Homologous superfamily (H).
“Evolutionary relationship?”
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKAGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Protein Structure Prediction and CASP
CASP: Critical Assessment of techniques for protein Structure Predictionhttp://predictioncenter.org/
**Modified image from Yang Zhang’s lab at University of Michigan
Disordered region prediction
Transmembrane segment prediction
Solvent accessibility prediction
Residue-residue contact prediction
Side-chain packing prediction
Secondary structure prediction
Loop modeling
Sub-problems of Protein Structure Prediction
**Images from Pondr and Rost, 1998
Pazos and Sternberg, PNAS, 2004, 101:14754-14759
Prediction of Protein Function From Structure
Number of new functions
Hypothetical SCOP domains
Prediction of Protein Function From Structure
Watson et al. J Mol Biol. 2007 Apr 13;367(5):1511-22
Breakdown of prior information for the 282 MCSG structures
Dynamic Personalities of Proteins
Richard Feynman said, “Everything that the living things do can be understood in terms of the jigglings and wigglings of atoms.”
Dynamic Personalities of Proteins
nitrogen regulatory protein C
My lab = Biophysics + Bioinformatics
Protein Design Problems
Annu. Rev. Biochem. 2008, 77:363 & Nature, 2009, 462:182
Protein-protein Docking and CAPRI
**Image from San Diego Supercomputer Center at UC San Diego http://www.sdsc.edu/Gallery/vs_protein_docking.html
CAPRI: Critical Assessment of PRediction of Interactions
Top Related