Download - Intrinsically disordered proteins : drug development and the most interesting examples

Transcript
Page 1: Intrinsically disordered proteins : drug development and the most interesting examples

Intrinsically disordered proteins:

drug development and the most interesting examples

Peter Tompa

Institute of EnzymologyHungarian Academy of Sciences

Budapest, Hungary

Page 2: Intrinsically disordered proteins : drug development and the most interesting examples

• IDPsIDPs:: in vitroin vitro evidence andevidence and in vivoin vivo considerationsconsiderations

• nnotot RC RC, tran, transient ordersient order

• ffuncunctional advantagestional advantages (specifi (specificity without city without excessive excessive binding strengthbinding strength, , fast bindingfast binding, , one-one-to-many to-many signalingsignaling))

• prevalentprevalent, , frequency increases from frequency increases from prokaryotes to prokaryotes to eukareukaryotesyotes

• funfunctional importancectional importance (regulatory, (regulatory, transcription, transcription, cytoskeletalcytoskeletal))

• involvement in diseaseinvolvement in disease (cancer-associated, (cancer-associated, neurodegenerative)neurodegenerative)

IUPs

Page 3: Intrinsically disordered proteins : drug development and the most interesting examples

1)Involvement in disease and drug development

2)Most interesting examples

Page 4: Intrinsically disordered proteins : drug development and the most interesting examples

p53 tumor supressor

Levine (1997) Cell 88, 323

Page 5: Intrinsically disordered proteins : drug development and the most interesting examples

Prediction of disorder: IUPred

http://iupred.enzim.hu

Dosztányi (2005) J. Mol. Biol. 347, 827

TAD DBD TD RD AAPPVAPAPAAPTPAAPAPAP

AAPPVAPAPAAPTPAAPAPAP

p53

Page 6: Intrinsically disordered proteins : drug development and the most interesting examples

p53 binding partners (MoRE, SLM)

Oldfield et al. (2005) Biochemistry 44, 12454

MDM2

DNA

S100B

p53

Page 7: Intrinsically disordered proteins : drug development and the most interesting examples

p53 binding DNA

Page 8: Intrinsically disordered proteins : drug development and the most interesting examples

Breast cancer-associated BRCA1: intrinsic disorder

Mark et al. (2005) JMB 345, 275

Page 9: Intrinsically disordered proteins : drug development and the most interesting examples

BRCA1: intrinsic disorder

Mark et al. (2005) JMB 345, 275

Page 10: Intrinsically disordered proteins : drug development and the most interesting examples
Page 11: Intrinsically disordered proteins : drug development and the most interesting examples

PDBSwissProt

signalinghuman cancer

Page 12: Intrinsically disordered proteins : drug development and the most interesting examples
Page 13: Intrinsically disordered proteins : drug development and the most interesting examples

New molecules approved by FDA

Page 14: Intrinsically disordered proteins : drug development and the most interesting examples

Partners of MoRFs: druggable targets

Page 15: Intrinsically disordered proteins : drug development and the most interesting examples

Inhibition of p53-MDM2 interaction by small-molecule

antagonists

Vassilev et al. (2004) Science 303, 844

Page 16: Intrinsically disordered proteins : drug development and the most interesting examples

In vivo activation of p53 by small-molecule antagonists of

MDM2

Vassilev et al. (2004) Science 303, 844

Page 17: Intrinsically disordered proteins : drug development and the most interesting examples

PEVPPVRVPEVPKEVVPEKKVPAAPPKKPEVTPVKVPEAPKEVVPEKK

Page 18: Intrinsically disordered proteins : drug development and the most interesting examples

PEVK domain of titin: entropic spring

Page 19: Intrinsically disordered proteins : drug development and the most interesting examples

cytoskeleton

MTs

Tubulin dimers

PKA RII

MAP2: entropic bristle

Page 20: Intrinsically disordered proteins : drug development and the most interesting examples

Mukhopadhyay (2001) FEBS Lett 505, 374

MAP2: entropic bristle

Page 21: Intrinsically disordered proteins : drug development and the most interesting examples

“Dynamic” spacing of MTs in axons and dendrites

Page 22: Intrinsically disordered proteins : drug development and the most interesting examples

Ca2+ + PO4

3-

Ca3(PO4)

2

Casein: scavenger in milk

Page 23: Intrinsically disordered proteins : drug development and the most interesting examples

FlgM: disorder in vivo

Plaxco and Gross (1997) Nature, 386, 657

Page 24: Intrinsically disordered proteins : drug development and the most interesting examples

Plaxco and Gross (1997) Nature, 386, 657

FlgM: disorder in vivo

Page 25: Intrinsically disordered proteins : drug development and the most interesting examples

NMR secondary chemical shifts: transient ordering in FlgM

Daughdrill et al. (2004) Biochemistry 37, 1082

Page 26: Intrinsically disordered proteins : drug development and the most interesting examples

FlgM-s28 structure

Sorensen et al. (2004) Mol. Cell 14, 127

Page 27: Intrinsically disordered proteins : drug development and the most interesting examples

C y cA

C d k 2

Inhibition of Cdks in cell-cycle regulation

Page 28: Intrinsically disordered proteins : drug development and the most interesting examples

Structural ensemble of p27 KID (NMR, MD)

Sivakolundu et al. (2005) JMB 353, 1118

Page 29: Intrinsically disordered proteins : drug development and the most interesting examples

Lacy et al. (2005) NSMB 11, 358

P27 KID binding: molecular staple mechanism

Page 30: Intrinsically disordered proteins : drug development and the most interesting examples
Page 31: Intrinsically disordered proteins : drug development and the most interesting examples

Sheaff et al. (2000) Mol. Cell. 5, 403

p21 turnover w/o ubiquitination

Page 32: Intrinsically disordered proteins : drug development and the most interesting examples

Proteasomal degradation requires unstructured

initiation site

Prakash et al. (2000) NSB 11, 830

Page 33: Intrinsically disordered proteins : drug development and the most interesting examples

Endoproteolytic activity of proteasome

Liu et al. (2003) Science 299, 408

Page 34: Intrinsically disordered proteins : drug development and the most interesting examples

Mitosis

Page 35: Intrinsically disordered proteins : drug development and the most interesting examples

The securin The securin storystory

normal chromosome segregation

Inhibition of separase expression

Waizenegger (2002) Curr. Biol. 12, 1368

Page 36: Intrinsically disordered proteins : drug development and the most interesting examples

The securin The securin storystory

Jallepalli (2001) Cell 105, 445

- securin knockout -

Page 37: Intrinsically disordered proteins : drug development and the most interesting examples

Human full-length securin is IDP

Sánchez-Puig et al. (2005) Prot. Sci. 14, 1410

Page 38: Intrinsically disordered proteins : drug development and the most interesting examples

Separase-securin complex by cryoEM

Viadiu et al. (2005) NSMB 12, 552

Page 39: Intrinsically disordered proteins : drug development and the most interesting examples

Separase-securin complex reconstruction

Viadiu et al. (2005) NSMB 12, 552

Page 40: Intrinsically disordered proteins : drug development and the most interesting examples

Entropic gating in nuclear Entropic gating in nuclear porepore

Patel (2007) Cell 129, 83

Page 41: Intrinsically disordered proteins : drug development and the most interesting examples

...SVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSASGGFGSTATSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLASQNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFGSNNSSVQGFGGWRS

350 AAsF: 13% G: 23%S+T: 31%

Page 42: Intrinsically disordered proteins : drug development and the most interesting examples

Long-range repulsion and entropic exclusion

Lim (2006) PNAS 103, 9512

Page 43: Intrinsically disordered proteins : drug development and the most interesting examples

CREB-binding protein (CBP)

Dyson and Wright (2005) Nat. Rev. MCB 6, 197

Histone acetyl

transferase

Transcriptional adaptor

zinc finger 1 Plant homeodom

ain

Nuclear receptor

co-activator binding

Nuclear receptor interactio

nZinc

binding domain

Page 44: Intrinsically disordered proteins : drug development and the most interesting examples

CBP KIX-CREB KID

Dyson and Wright (2005) Nat. Rev. MCB 6, 197

Page 45: Intrinsically disordered proteins : drug development and the most interesting examples

Dyson and Wright (2005) Nat. Rev. MCB 6, 197

CBP TAZ1-HIF1a/CITED2

HIF1: hypoxia factor

Page 46: Intrinsically disordered proteins : drug development and the most interesting examples

Dyson and Wright (2005) Nat. Rev. MCB 6, 197

CBP bromo-p53 AcLys

Page 47: Intrinsically disordered proteins : drug development and the most interesting examples

Dyson and Wright (2005) Nat. Rev. MCB 6, 197

CBP NCBD-ACTR

ACTR: activator for thyroid hormone and retinoid receptor