Download - 08 Ethics, Law and E-commerce

Transcript
Page 1: 08 Ethics, Law and E-commerce

1

e-commerce

Kenneth C. LaudonCarol Guercio Traver

business. technology. society.

eighth edition

Copyright © 2012 Pearson Education

Chapter 8Ethics, Law and E-commerce

Page 2: 08 Ethics, Law and E-commerce

2

Copyright © 2012 Pearson Education

Why is “mischief” in virtual worlds more difficult to stop? What constitutes mischief in Second Life?

Which behaviors have been banned in Second Life?

Is there a consensus regarding whether or not in-game gambling and other virtual crimes are also actual crimes? What is Second Life’s stance?

How faithfully do you believe the law should be enforced in virtual worlds?

It’s in virtual world; Selling brand-name goods, conducting gambling, sellingsimulated prostitution service

Intolerance, harassment, assault, disclosure of information about other people’s real-world lives, indecency sexual behavior, and disturbing the peace

No. They prohibited all forms of gambling in July 2007

Discovering Law and Ethics in a Virtual WorldClass Discussion

Copyright © 2012 Pearson Education

Copyright © 2006 Pearson Education,

Inc.Slide 8-5

Page 3: 08 Ethics, Law and E-commerce

3

Copyright © 2012 Pearson Education

Learning Objectives Understand why e-commerce raises ethical, social, and political issues Recognize the main ethical, social, and political issues raised by e-

commerce Identify a process for analyzing ethical dilemmas Understand basic concepts related to privacy Identify the practices of e-commerce companies that threaten privacy Describe the different methods used to protect online privacy Understand the various forms of intellectual property and the

challenges involved in protecting it Understand how governance of the Internet has evolved over time Explain why taxation of e-commerce raises governance and

jurisdiction issues Identify major public safety and welfare issues raised by e-commerce

Copyright © 2012 Pearson Education

Understanding Ethical, Social, and Political Issues in E-commerce

Internet, like other technologies, can (see next Fig.):EnablenewcrimesAffectenvironmentThreatensocialvalues

Costs and benefits must be carefully considered, especially when there are no clear-cut legal or cultural guidelines

Slide 8-7

Page 4: 08 Ethics, Law and E-commerce

4

Copyright © 2012 Pearson Education

Copyright © 2010 Pearson Education,

Inc.Slide 8-8

Copyright © 2012 Pearson Education

A Model for Organizing the Issues Issues raised by Internet and e-commerce can be

viewed at individual, social, and political levels (see next Fig.)

Four major categories of issues: Informationrights– individualrightstotheirpersonalinfoinpublicmarketplaceandrightstoaccessinfoaboutbusinessandotherorganizations

Propertyrights– enforcementoftraditionalintellectualpropertyrightsinInternetworldwhereperfectcopiescanbemadeanddistributedworldwidewithinseconds

Governance– publiclawstogovernInternetande-commerce,andthelaw-makingbodies(state,federal,international)whohavejurisdiction

Publicsafetyandwelfare– toensureequitableaccesstoInternetande-commercechannelsbyschoolsandcolleges,ortodetermineifpornographyandgamblingarethreattopublicsafetyandwelfare

Slide 8-9

Page 5: 08 Ethics, Law and E-commerce

5

Copyright © 2012 Pearson Education

The Moral Dimensions of an Internet Society

Figure 8.1, Page 538Slide 8-10

Copyright © 2012 Pearson Education

Basic Ethical Concepts Ethics

Studyofprinciplesusedtodeterminerightandwrongcoursesofaction

Responsibility individuals,organizations,andsocietiesareresponsibleforactionstheytake

Accountability individuals,organizations,andsocietiesshouldbeheldaccountabletoothersfortheconsequencesoftheiractions

Liability Lawspermittingindividualstorecoverdamagesdonetothem

Due process Lawsareknown,understood Abilitytoappealtohigherauthoritiestoensurelawsappliedcorrectly

Slide 8-11

Page 6: 08 Ethics, Law and E-commerce

6

Copyright © 2012 Pearson Education

Analyzing Ethical Dilemmas Dilemma

Asituationwherethereareatleasttwodiametricallyopposedactions,eachofwhichsupportsadesirableoutcome

Process for analyzing ethical dilemmas:1. Identifyandclearlydescribethefacts:Findoutwho

didwhattowhom,andwhere,when,andhow2. Definetheconflictordilemmaandidentifythehigher-

ordervaluesinvolved:E.g.,advertisingnetworks(DoubleClick)increasesmarketefficiencyatthepriceofindividualprivacy

3. Identifythestakeholders4. Identifytheoptionsthatyoucanreasonablytake5. Identifythepotentialconsequencesofyouroptions:

Askyourself“WhatifIchoosethisoptionconsistentlyovertime?”

Slide 8-12

Copyright © 2012 Pearson Education

Help determine actions when confronted with an ethical dilemma: GoldenRule– Dountoothersasyouwouldhavethemdountoyou. Universalism– Ifanactionisnotrightforallsituations,thenitisnotrightforanycertainsituation.

SlipperySlope– Ifanactioncan’tbetakenrepeatedly,thenitisnotrighttotakeatall.

CollectiveUtilitarianPrinciple– Taketheactionthatachievesthegreatervalueforallofsociety.

RiskAversion– Taketheactionthatproducestheleastharm,ortheleastpotentialcost.

NoFreeLunch– Ifsomethingsomeoneelsehascreatedisusefultoyou,ithasvalueandyoushouldassumethecreatorwantscompensationforthiswork.

TheNewYorkTimes Test(PerfectInformationRule)– Givenyourdecisiononamatter,willthereactionofreadersbepositiveornegative?

TheSocialContractRule– Wouldyouliveinasocietywheretheprincipleyouaresupportingwouldbecomeanorganizingprincipleoftheentiresociety?

Candidate Ethical Principles

Page 7: 08 Ethics, Law and E-commerce

7

Copyright © 2012 Pearson Education

Privacy and Information Rights

PrivacyMoralrightofindividualstobeleftalone,freefromsurveillance,orinterferencefromotherindividualsororganizations

Information privacy Subsetofprivacy Includes:

Theclaimthatcertaininformationshouldnotbecollectedatall

Theclaimofindividualstocontroltheuseofwhateverinformationiscollectedaboutthem

Slide 8-15

Copyright © 2012 Pearson Education

Privacy and Information Rights (cont.)

Major ethical issue related to e-commerce and privacy: Underwhatconditionsshouldweinvadetheprivacyofothers?

Major social issue: Developmentof“expectationsofprivacy”andprivacynorms

Major political issue: Developmentofstatutesthatgovernrelationsbetweenrecordkeepersandindividuals

Slide 8-16

Page 8: 08 Ethics, Law and E-commerce

8

Copyright © 2012 Pearson Education

Information Collected at E-commerce Sites

Data collected includes Personallyidentifiableinformation(PII)- Datathatcanbeusedtoidentify,locate,orcontactanindividual(seenextFig.)

Anonymousinformation- Demographicandbehavioralinformationthatdoesnotincludeanypersonalidentifiers(e.g.,age,occupation,income,zipcode,ethnicity)

Types of data collected Name,address,phone,e-mail,socialsecurity Bankandcreditaccounts,gender,age,occupation,education Preferencedata,transactiondata,clickstreamdata,browsertype

Slide 8-17

Copyright © 2012 Pearson Education Slide 8-18

Page 9: 08 Ethics, Law and E-commerce

9

Copyright © 2012 Pearson Education Slide 8-19

Copyright © 2012 Pearson Education Slide 8-20

Page 10: 08 Ethics, Law and E-commerce

10

Copyright © 2012 Pearson Education

Social Networks and Privacy

Social networksEncouragesharingpersonaldetailsPoseuniquechallengetomaintainingprivacy

Facebook’s facial recognition technology and tagging

Personal control over personal information vs. organization’s desire to monetize social network

Slide 8-21

Copyright © 2012 Pearson Education

Profiling and Behavioral Targeting Profiling

Creationofdigitalimagesthatcharacterizeonlineindividualandgroupbehavior

Anonymousprofiles Identifypeopleasbelongingtoveryspecificandtargetedgroups E.g.,20-30-yr-oldmales,withcollegedegreesandincome>$30,000/yr,andinterestedinhigh-fashionclothing

Personalprofiles Addpersonalidentifiers(email,postaladdress,phonenumber)tobehavioraldata

Advertising networks can TrackconsumerandbrowsingbehavioronWeb Dynamicallyadjustwhatuserseesonscreen Buildandrefreshprofilesofconsumers

Google’s AdWords program

Slide 8-22

Page 11: 08 Ethics, Law and E-commerce

11

Copyright © 2012 Pearson Education

Profiling and Behavioral Targeting (cont.)

Deep packet inspection RecordseverykeystrokeatISPlevelofeveryoneandusesinformationtomakesuggestionsandtargetads

Business perspective: Increaseseffectivenessofadvertising,subsidizingfreecontent Enablessensingofdemandfornewproductsandservices

Critics’ perspective: Underminesexpectationofanonymityandprivacy

Consumers showsignificantoppositiontounregulatedcollectionofpersonalinformation

Slide 8-23

Copyright © 2012 Pearson Education

The Internet and Government Invasions of Privacy

Various laws strengthen ability of law enforcement agencies to monitor Internet users without knowledge and sometimes without judicial oversight

CALEA,USAPATRIOTAct,CyberSecurityEnhancementAct,HomelandSecurityAct

Government agencies are largest users of private sector commercial data brokers, e.g., Experian and TransUnion

Retention of individual’s online behavior data by ISPs raises privacy concern

Slide 8-24

Page 12: 08 Ethics, Law and E-commerce

12

Copyright © 2012 Pearson Education

Legal Protections In United States, privacy rights explicitly

granted or derived from:Constitution

FirstAmendment—guaranteesfreedomofspeechandassociation

FourthAmendment—protectsagainstunreasonablesearchandseizureofone’spersonaldocumentsorhome

FourteenthAmendment—guaranteesdueprocessSpecificstatutesandregulations(federalandstate)

Commonlaw– courtdecisionsinvolvingwrongfulactsorpersonalinjuries

Slide 8-25

Copyright © 2012 Pearson Education

Page 13: 08 Ethics, Law and E-commerce

13

Copyright © 2012 Pearson Education

Copyright © 2012 Pearson Education

Page 14: 08 Ethics, Law and E-commerce

14

Copyright © 2012 Pearson Education

Informed Consent U.S. firms can gather and redistribute

transaction information without individual’s informed consent IllegalinEurope

Informed consent: Opt-in– requiresaffirmativeactionbyconsumertoallowcollectionanduseofinformation

Opt-out– defaulttocollectinformationunlessconsumertakesaffirmativeactiontopreventcollectionofdatabycheckingaboxorfillingoutform

ManyU.S.e-commercefirmsmerelypublishinformationpracticesaspartofprivacypolicywithoutprovidingforanyformofinformedconsent

Slide 8-29

Copyright © 2012 Pearson Education

The FTC’s Evolving Privacy Approach Fair Information Practice principles (1998)

Notice Choice Access Security Enforcement Restrictedcollection

New privacy framework (2010) Privacybydesign Simplifiedchoice Greatertransparency

Slide 8-30

Page 15: 08 Ethics, Law and E-commerce

15

Copyright © 2012 Pearson Education Slide 8-31

Copyright © 2012 Pearson Education Slide 8-32

Stre

ngth

en t

he F

IP’s

N

otifi

catio

n an

d Ch

oice

Adde

d to

th

e FI

P’s

Page 16: 08 Ethics, Law and E-commerce

16

Copyright © 2012 Pearson Education Slide 8-33

Copyright © 2012 Pearson Education Slide 8-34

Page 17: 08 Ethics, Law and E-commerce

17

Copyright © 2012 Pearson Education

The European Data Protection Directive

Privacy protection much stronger in Europe than United States

European approach: Comprehensiveandregulatoryinnature

European Commission’s Directive on Data Protection (1998): StandardizesandbroadensprivacyprotectioninEuropeanUnioncountries

Department of Commerce safe harbor program: ForU.S.firmsthatwishtocomplywithdirective

Slide 8-35

Copyright © 2012 Pearson Education

Private Industry Self-Regulation Safe harbor programs:

Private,self-regulatingpolicymechanismtomeetobjectivesofgovernmentregulationswithoutgovernmentinvolvement

e.g.,Privacysealprograms Industry associations include:

OnlinePrivacyAlliance(OPA) Encouragesself-regulationasareactiontogrowingpublicconcerns

Developedonline“seals”thatattesttoprivacypoliciesonasite E.g.,privacysealprograms(TRUSTe,BBBReliabilitySeal)

NetworkAdvertisingInitiative(NAI) Formedbyadvertisingnetworkindustry DevelopedprivacyprinciplesinconjunctionwithFTC MembersincludeDoubleClick,Advertising.com,and24/7RealMedia

CLEARAdNoticeTechnicalSpecificationsSlide 8-36

Page 18: 08 Ethics, Law and E-commerce

18

Copyright © 2012 Pearson Education

Private Industry Self-RegulationPrivacy advocacy groupsMonitordevelopmentsinprivacy

Emerging privacy protection businessE.g.,reputation.com,SocialShield,Abine

Slide 8-37

Copyright © 2012 Pearson Education

Technological Solutions Spyware blockers Pop-up blockers Secure e-mail Anonymous remailers, surfing Cookie managers Disk/file erasing programs Policy generators Privacy Policy Reader/P3P Public key encryption

(see next Fig.)Slide 8-39

Page 19: 08 Ethics, Law and E-commerce

19

Copyright © 2012 Pearson Education Slide 8-40

Copyright © 2012 Pearson Education

How P3P Works

Figure 8.2(A), Page 522 SOURCE: W3C Platform for Privacy Preferences Initiative, 2003.

Page 20: 08 Ethics, Law and E-commerce

20

Copyright © 2012 Pearson Education

Intellectual Property Rights

Intellectual property: Encompassesalltangibleandintangibleproductsofhumanmind

Major ethical issue: Howshouldwetreatpropertythatbelongstoothers?

Major social issue: IstherecontinuedvalueinprotectingintellectualpropertyintheInternetage?

Major political issue: HowcanInternetande-commerceberegulatedorgovernedtoprotectintellectualproperty?

Slide 8-43

Copyright © 2012 Pearson Education

Intellectual Property Protection

Three main types of protection: Copyright Patent Trademarklaw

Goal of intellectual property law: Balancetwocompetinginterests—publicandprivate

Maintaining this balance of interests is always challenged by the invention of new technologies

Slide 8-44

Page 21: 08 Ethics, Law and E-commerce

21

Copyright © 2012 Pearson Education

Copyright Protects original forms of expression (but not ideas) from

being copied by others for a period of time E.g., writings, art, drawings, and music 95-year protection for corporate-owned works, or life + 70-

year protection of individual’s works “Look and feel” copyright infringement lawsuits involve

distinction between an idea and its expression E.g.,ApplesuedMicrosoftandHPforinfringingApple’scopyrightonMacintoshinterface

Fair use doctrine : Under certain circumstances, permits use of copyrighted materials without permission (see next Fig.)

Digital Millennium Copyright Act, 1998 FirstmajorefforttoadjustcopyrightlawstoInternetage ImplementsWIPOtreatythatmakesitillegaltomake,distribute,orusedevicesthatcircumventtechnology-basedprotectionsofcopyrightedmaterials

Slide 8-45

Copyright © 2012 Pearson Education Slide 8-46

Page 22: 08 Ethics, Law and E-commerce

22

Copyright © 2012 Pearson Education Slide 8-47

Copyright © 2012 Pearson Education

Patents Grant owner 20-year monopoly on ideas behind an

invention Differentfromcopyrightssincepatentsprotectideaandnotjustexpressionofidea

Fourtypesofinventions: Machines,Man-madeproducts,Compositionsofmatter,Processingmethods

Inventionmustbenew,non-obvious,novel

Benefits Encouragesinventors Promotesdisseminationofnewtechniquesthroughlicensing

Danger Stiflescompetitionbyraisingbarrierstoentry

Slide 8-48

Page 23: 08 Ethics, Law and E-commerce

23

Copyright © 2012 Pearson Education

E-commerce Patents 1998 State Street Bank & Trust vs. Signature Financial

Group Businessmethodpatents

U.S. Patent Office, European Patent Convention hold different standards

Most European patent laws do not recognize business methods unless based on technology

Patent reform Patenttrolls:companiesthatbuypatentsonaspeculativebasisandthenusethemtothreatenothercompaniesviolatingthepatent

2011AmericaInventsActs Switchfrom“first-to-invent”to“first-to-file”system Newwaystochallengepatentsoutofcourt Allowstartupfirmstogetfast-trackconsiderationoftheirpatentapplications,within12months,ratherthan30-plusmonths

Slide 8-49

Copyright © 2012 Pearson Education

Internet and E-commerce Business Method Patents

Figure 8.2, Page 576 SOURCE: Based on data from United States Patent and Trademark Office, 2010.

Slide 8-50

Page 24: 08 Ethics, Law and E-commerce

24

Copyright © 2012 Pearson Education Slide 8-51

Copyright © 2012 Pearson Education Slide 8-52

Page 25: 08 Ethics, Law and E-commerce

25

Copyright © 2012 Pearson Education

Trademarks Identify, distinguish goods, and indicate their source Purpose

Ensureconsumergetswhatispaidfor/expectedtoreceive Protectowneragainstpiracyandmisappropriation

Infringement Marketconfusion:creatingconfusionwithexistingmarks,causesconsumerstomakemarketmistakes

Badfaith:intentionalmisuseofwordsandsymbolstoextortrevenuefromlegitimatetrademarkowners

Dilution Behaviorthatweakensconnectionbetweentrademarkandproduct Blurring– weakeningconnectionbetweentrademarkandgoods Tarnishment – usingtrademarkinawaythatmakesunderlyingproductsappearunsavoryorunwholesome

Slide 8-53

Copyright © 2012 Pearson Education

Trademarks and the Internet

Cybersquatting AnticybersquattingConsumerProtectionAct(ACPA)

Cyberpiracy Typosquatting

Metatagging Keywording Deep linking Framing

Slide 8-54

Page 26: 08 Ethics, Law and E-commerce

26

Copyright © 2012 Pearson Education Slide 8-55

Copyright © 2012 Pearson Education

Governance

Primary questionsWhowillcontrolInternetande-commerce?Whatelementswillbecontrolledandhow?

Stages of governance and e-commerceGovernmentControlPeriod(1970–1994)Privatization(1995–1998)Self-Regulation(1995–present)GovernmentRegulation(1998–present)

Slide 8-56

Page 27: 08 Ethics, Law and E-commerce

27

Copyright © 2012 Pearson Education Slide 8-57

Copyright © 2012 Pearson Education

Who Governs E-commerceand the Internet?

Currently: Mixed mode environment Self-regulation,throughvarietyofInternetpolicyandtechnicalbodies,co-existswithlimitedgovernmentregulation

ICANN : Domain Name System Internet could be easily controlled,

monitored, and regulated from a central location , e.g., network access points, routers, and servers (e.g., China, Singapore, Thailand etc.)

Slide 8-58

Page 28: 08 Ethics, Law and E-commerce

28

Copyright © 2012 Pearson Education

Taxation E-commerce taxation illustrates complexity of

governance and jurisdiction issues U.S. sales taxed by states and local government MOTO retailing E-commerce benefits from tax “subsidy” October 2007: Congress extends tax moratorium for

an additional seven years Unlikely that comprehensive, integrated rational

approach to taxation issue will be determined for some time to come

Slide 8-59

Copyright © 2012 Pearson Education

Net Neutrality Neutrality: All Internet traffic treated

equally—all activities charged the same rate, no preferential assignment of bandwidth

Backbone providers vs. content providers December 2010 FCC approved “compromise” net

neutrality rules; prohibit ISPs from blocking traffic such as Skype on wired networks, and prohibit “unreasonable” discrimination on such networks

Telecom providers adopting compromise position between wired and mobile wireless access: maintain existing rules for land lines, but implement differential pricing for mobile wireless networks, e.g., $15/month for 200MB of data to $45/month for 4GB

Slide 8-60

Page 29: 08 Ethics, Law and E-commerce

29

Copyright © 2012 Pearson Education

Public Safety and Welfare

Protection of children and strong sentiments against pornographyPassinglegislationthatwillsurvivecourtchallengeshasproveddifficult

Efforts to control gambling and restrict sales of drugs and cigarettesCurrently,mostlyregulatedbystatelawUnlawfulInternetGamblingEnforcementAct

Slide 8-61

Copyright © 2012 Pearson Education Slide 8-63