The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting
Transcript of The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting
The Photosynthetic Membrane
Rupan_ffirs.indd i 8/29/2012 5:31:53 PM
The Photosynthetic Membrane
Molecular Mechanisms and Biophysics of Light Harvesting
ALEXANDER RUBAN
School of Biological and Chemical Sciences, Queen Mary, University of London, UK
Rupan_ffirs.indd iii 8/29/2012 5:31:53 PM
This edition first published 2013
© 2013 John Wiley & Sons, Ltd.
Registered Office
John Wiley & Sons, Ltd, The Atrium, Southern Gate, Chichester, West Sussex, PO19 8SQ, United Kingdom
For details of our global editorial offices, for customer services and for information about how to apply for
permission to reuse the copyright material in this book please see our website at
www.wiley.com .
The right of the author to be identified as the author of this work has been asserted in accordance with the
Copyright, Designs and Patents Act 1988.
All rights reserved. No part of this publication may be reproduced, stored in a retrieval system, or transmitted, in
any form or by any means, electronic, mechanical, photocopying, recording or otherwise, except as permitted by
the UK Copyright, Designs and Patents Act 1988, without the prior permission of the publisher.
Wiley also publishes its books in a variety of electronic formats. Some content that appears in print may not be
available in electronic books.
Designations used by companies to distinguish their products are often claimed as trademarks. All brand names
and product names used in this book are trade names, service marks, trademarks or registered trademarks of their
respective owners. The publisher is not associated with any product or vendor mentioned in this book. This
publication is designed to provide accurate and authoritative information in regard to the subject matter covered.
It is sold on the understanding that the publisher is not engaged in rendering professional services. If professional
advice or other expert assistance is required, the services of a competent professional should be sought.
The publisher and the author make no representations or warranties with respect to the accuracy or completeness
of the contents of this work and specifically disclaim all warranties, including without limitation any implied
warranties of fitness for a particular purpose. This work is sold with the understanding that the publisher is not
engaged in rendering professional services. The advice and strategies contained herein may not be suitable for
every situation. In view of ongoing research, equipment modifications, changes in governmental regulations, and
the constant flow of information relating to the use of experimental reagents, equipment, and devices, the reader
is urged to review and evaluate the information provided in the package insert or instructions for each chemical,
piece of equipment, reagent, or device for, among other things, any changes in the instructions or indication of
usage and for added warnings and precautions. The fact that an organization or Website is referred to in this work
as a citation and/or a potential source of further information does not mean that the author or the publisher
endorses the information the organization or Website may provide or recommendations it may make. Further,
readers should be aware that Internet Websites listed in this work may have changed or disappeared between
when this work was written and when it is read. No warranty may be created or extended by any promotional
statements for this work. Neither the publisher nor the author shall be liable for any damages arising herefrom.
Library of Congress Cataloguing-in-Publication Data
Ruban, Alexander (Alexander V.)
The photosynthetic membrane : molecular mechanisms and biophysics of light harvesting / Alexander Ruban.
p. cm.
Includes index.
ISBN 978-1-119-96054-6 (cloth) – ISBN 978-1-119-96053-9 (pbk.)
1. Photosynthesis. 2. Photosynthetic pigments. 3. Light absorption. I. Title.
QK882.R83 2013
572′.46–dc23
2012025765
A catalogue record for this book is available from the British Library.
Set in 10/12pt Times by SPi Publisher Services, Pondicherry, India
1 2013
Rupan_ffirs.indd iv 8/29/2012 5:31:53 PM
Dedicated to my family
Rupan_ffirs.indd v 8/29/2012 5:31:53 PM
Contents
Preface xi Acknowledgements xiii
1 Life, Energy and Light 1 1.1 The Definition of Life 1
1.2 The Energy of Matter 2
1.2.1 The Source of Life’s Energy 3
1.3 Energy for the Future 3
1.4 Photosynthesis by Life 4
1.4.1 Photon Energy Transformations 5
Reference 6 Bibliography 6
2 The Space of the Cell 7 2.1 The Cell Concept: Fundamental Nature of Life 7
2.2 Compartmentalization: The Cult of the Membrane 9
2.3 Membrane Components: Fundamentals of Proteins 12
2.4 Functional Classification of Membrane Proteins 15
Reference 16 Bibliography 16
3 The Photosynthetic Membrane: Outlook 17 3.1 Knowledge of the Pre-Atomic Structure Era: Organization
of the Photosynthetic Membrane System 17
3.2 Composition of the Photosynthetic Membrane 21
3.2.1 Lipids 21
3.2.2 Lipid-Related Compounds of the Photosynthetic Membrane 22
3.2.3 Proteins and Protein Complexes 25
3.3 Oligomerization, Interactions and Mobility of the Photosynthetic
Proteins: Enabling Functions and Adaptations 28
3.3.1 Oligomerization and Clustering of Photosynthetic Membrane Proteins 28
3.3.2 Protein Mobility 30
Reference 32 Bibliography 32
Rupan_ftoc.indd vii 8/29/2012 5:26:44 PM
viii Contents
4 Popular Methods and Approaches to Study Composition, Structure and Functions of the Photosynthetic Membrane 33 4.1 Biochemistry and Molecular Biology Approaches 33
4.1.1 Isolation of Chloroplasts and Subchloroplast Particles 33
4.1.2 Isolation of Membrane Protein Complexes 35
4.1.3 Analysis of Lipids and Pigments 37
4.1.4 Protein Expression and Reconstitution In Vitro 38
4.1.5 Reconstitution of Membrane Proteins in Liposomes 39
4.1.6 Mutagenesis and Transgenic Manipulations 40
4.2 Visualization Techniques 41
4.2.1 Optical Microscopy 41
4.2.2 Electron Microscopy (EM) 42
4.2.3 Atomic Force Microscopy (AFM) 45
4.2.4 Crystallography Methods 45
4.3 Function Probing Methods 48
4.3.1 Absorption-Based Approaches 49
4.3.2 Raman Spectroscopy 54
4.3.3 Fluorescence-Based Approaches 55
References 65 Bibliography 65
5 Primary Processes of the Light Phase of Photosynthesis: Principles of Light Harvesting in Antennae 67 5.1 The Nature of Light 67
5.2 Absorption of Light by Molecules 71
5.3 Fate of Absorbed Light Energy 73
5.4 The Need for the Photosynthetic Antenna and the Fifth
Fate of Excitation Energy 75
5.5 Photosynthetic Antenna Pigments 81
5.5.1 Chlorophylls 82
5.5.2 Xanthophylls 87
5.6 Variety and Classification of Photosynthetic Antennae 91
5.7 Principles of Light Harvesting: Summary 93
5.8 Connecting Light Harvesting Antenna to the Photosystems:
Red Energy Traps 96
References 99 Bibliography 99
6 Towards the Atomic Resolution Structure of Light Harvesting Antennae: On the Path of Discoveries 101 6.1 Discovery and Primary Characterization of the Higher
Plant Antenna Complex 102
6.2 Development of Isolation Methods: Intactness,
Purity and Quantity 104
Rupan_ftoc.indd viii 8/29/2012 5:26:45 PM
Contents ix
6.3 LHCII Crystallography: The Beginnings 107
6.4 Revealing the Atomic Resolution Structure of LHCII
Antenna Complexes 111
6.4.1 Key Biochemical and Spectroscopic Advances that Aided the Emergence of the Current Atomic LHCIIb Structure 111
6.4.2 The New Structure of LHCIIb 115
6.5 Structure of a Minor LHCII Complex CP29 126
6.6 Comparison of LHCII Structure with the Structure of a Simpler
Light Harvesting Complex from Purple Bacteria, LH2 129
References 133 Bibliography 134
7 Structural Integration of Antennae within Photosystems 135 7.1 Light Harvesting Complexes Gene Family 136
7.2 Toward the Structure of a Complete Photosystem II Unit:
Supercomplexes 137
7.3 Supramolecular Structure of Photosystem I: LHCI 145
7.4 Photosynthetic Membrane Protein Landscapes 147
7.5 Robustness of the Light Harvesting Antenna Design: Resurrecting
the Structure to Preserve the Function 150
References 156 Bibliography 157
8 Dynamics of Light Harvesting Antenna: Spectroscopic Insights 159 8.1 Steady-State Optical Spectroscopy of LHCII:
Composition and Order 160
8.2 Time-Resolved Spectroscopy of LHCII: Energy Migration 165
8.2.1 Time-Resolved Fluorescence Spectroscopy 165
8.2.2 Time-Resolved Absorption Spectroscopy 167
8.3 Spectral and Structural Identity of LHCII Xanthophylls 170
8.4 Plasticity of Light Harvesting Antenna Design: Tailoring the
Structure to Optimize the Function 176
8.5 LHCII Oligomerization: Dynamics of the ‘Programmed Solvent’ 179
8.5.1 Alterations in the Spectral Properties of LHCII 179
8.5.2 Structural Changes within LHCII 183
8.6 Kinetics of the Collective LHCII Transition into the Dissipative
State: Exploring ‘The Switch’ Control 189
References 194 Bibliography 195
9 Adaptations of the Photosynthetic Membrane to Light 197 9.1 The Need for Light Adaptations and their Various Strategies 198
9.2 Long-Term Regulation of the Photosystem Ratio and their
Antenna Size: Acclimation 201
Rupan_ftoc.indd ix 8/29/2012 5:26:46 PM
x Contents
9.3 Short-Term Adaptations to Light Quality: State Transitions 202
9.3.1 The Phenomenology of State Transitions 202
9.3.2 The Molecular Mechanism of State Transitions 205
9.3.3 Chromatic Adaptations in Plants Lacking the Polypeptides of the Major LHC II Complex 209
9.3.4 Future of State Transitions Research 212
9.4 Short-Term Adaptations to Light Quantity 214
9.4.1 Control of Excess Light Energy in Photosystem II – The Phenomenon of Nonphotochemical Chlorophyll Fluorescence Quenching (NPQ) 214
9.4.2 The Molecular Components and Processes Involved in NPQ 217
9.4.3 Future of qE Research 238
References 238 Bibliography 239
10 What is in it for Plant, Biosphere and Mankind? 241 10.1 Science and Society 241
10.2 Energy Balance of Photosynthesis: A Wasteful Process? 242
10.3 Crops and Light Harvesting 247
10.4 Light Harvesting Principles for Future Applications: Liberation
from Saturation Constraints 249
10.5 Effects of Changing Climate – The Onset of Disorder 253
Bibliography 254
11 Conclusions 257
Index 261
Rupan_ftoc.indd x 8/29/2012 5:26:47 PM
The science of biophysics of light harvesting has accumulated vast amount of knowledge
in the last 20 years about the workings of the photosynthetic membrane of higher plants.
The subject is a manifestation of a grand molecular design of the complex photosynthetic
machinery performing a sequence of primary energy transformation events. Hence, it
represents an excellent example for learning the principles of structure and mechanisms of
functioning of membrane proteins, their interactions with each other and their cofactors,
dynamics in the membrane and in the isolated state and various mechanisms of adaptation
to the environment. The author’s own 30 years’ experience in the field of biophysics of
photosynthesis and work done by his numerous colleagues has been presented in the
context of gradual explanation of complexity, historical development and multidisciplinary
character of the subject, The Photosynthetic Membrane . The need for such a text is long
overdue, since it does not cover the whole photosynthesis but focuses on its light phase
processes, concentrating on the light harvesting: a well-structured and regulated process
that ensures phenomenal flexibility of adaptations of plants to light that are essential for
their survival. The book starts from a general introduction to the essential features of life;
one of the most important is the energy requirement that is fulfilled almost solely by sunlight.
Further, the advantages and peculiar physicochemical features of the nanoscale level of the
photosynthetic membrane organization are described and the general makeup is presented
setting the scene and preparing the reader for the detailed up-to-date description of numer-
ous methods of investigation of the photosynthetic membrane structure and functions,
light harvesting principles, atomic structure of light harvesting antenna complexes, the
macrostructural organization and integration of antennae within photosystem complexes,
dynamic nature of light harvesting proteins studied by various spectroscopies and adaptations
of the light harvesting machinery in the intact membrane to light. This book also contains
a chapter considering the potential of the educational and practical applications of the
knowledge obtained in studies of the photosynthetic membrane organization and light
harvesting processes. The author contemplates the role of the fundamental knowledge in
general and explains possible ways it can be used in crop science, solar energy utilization
by mankind and in solving the problems associated with the global climate change.
The author addresses this book, first of all, to the final year undergraduate students of
various biology specializations. Therefore, he makes all effort to adapt it to different levels
of training in chemistry and physics. The level of complexity gradually increases towards
the end of the book making it relevant to postgraduate students and for a broader audience
of those involved in photosynthesis research as well as bioenergetic membranes in general.
With this book, the author hopes to awake an interest of a broad audience of students,
scientists and those who are attracted to the phenomenon of energy transformation
processes in living nature and welcomes any feedback.
Preface
Rupan_fpref.indd xi 8/29/2012 5:27:34 PM
Welch Schauspiel! Aber ach! Ein Schauspiel nur! Wo fass ich dich, unendliche Natur?
Euch Brüste, wo? Ihr Quellen alles Lebens ,
An denen Himmel und Erde hängt , Dahin die welke Brust sich drängt - Ihr quellt, ihr tränkt, und schmacht ich so vergebens?
(Ah! what a view! Alas and but a view! Where shall I, endless Nature, seize on you?
Ye breasts, and where? Ye sources of all life
On which the heaven, the earth depends ,
Towards which the withered bosom tends —
Ye nourish, flow; yet vain my thirsty strife?) Faust: Der Tragödie erster Teil
by
Johann Wolfgang von Goethe
For undergraduate and postgraduate students and also those with an interest in the molecular engines of life.
Rupan_fpref.indd xii 8/29/2012 5:27:34 PM
The author likes to thank several of his colleagues, particularly Drs Matthew Johnson and
Christopher Duffy for their engagement in many discussions on various topics of this book
that helped him to shape and improve his ideas and the original outline. He thanks
Dr Matthew Johnson for reading almost all chapters and Dr Christopher Duffy for reading
Chapters 4, 5, 10 and 11, giving him a number of useful comments. Dr Matthew Johnson
is also acknowledged for preparing Figure 2.4. The author thanks Dr Christopher Duffy for
preparing Figures 5.11 and 5.12. The author also thanks Professor Leonas Valkunas for
reading Chapters 5, 8 and 9 and giving him various useful comments. The author is grateful
to Professor Conrad Mullineaux and Dr Tomasz Goral for providing confocal microscopy
material for Figures 3.1(b), 3.2(b), a freeze-fracture electron microscopy image of
Figure 7.1 and the fluorescence recovery after photobleaching results presented on
Figure 9.17. The author thanks Dr Erica Belgio for preparing Figure 4.3 and Dr Erik
Murchie for providing him with the solar radiation spectrum for Figures 5.3, 10.2 and 10.4.
The author would like to thank Dr Rudi Berera, Dr John Kennis and Professor Rienk van
Grondelle for providing with a transient absorption spectrum of isolated LHCII trimer for
Figure 8.6. Dr Gene Carl Feldman is acknowledged for allowing him to use the NASA
satellite image of the global chlorophyll redistribution in the Biosphere. The author finally
thanks Mrs Kateryna Law for providing him with the image used for Figure 10.3.
The author appreciates the encouragement, help and advice received from the Wiley
publishing team; Paul Deards, Sarah Tilley and Rebecca Ralf.
Instructors can access PowerPoint files of the illustrations presented within this text, for
teaching, at: http://booksupport.wiley.com
Acknowledgements
Ruban_flast.indd xiii 8/31/2012 12:20:42 PM
1
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
1.1 The Definition of Life
Since the Big Bang, the Universe went on a path of losing energy density, gaining entropy
and expanding, which causes continuing separation of its elements in space. Life seems to
be engaged in fighting these fundamental developments in the world ’ s fate by:
a. making the universal stuff more ordered , complex and predictable, hence defying the
laws of entropy, and
b. making the universe smaller by enabling the information flow and exchange constitut-
ing the multitude of reflections of matter via living creatures by their multiplication,
proliferation, memory of the makeup (genetic code), condensing matter; creation of
hypermolecules, as if exploring the potential and yet unknown properties of collectives
of the elements of matter.
In order to be successful in its apparently feeble refusal of matter ’ s fate, life is trying to
expand constantly in space and change in time. In spite of extreme environments, it
designs various ways to sustain this expansion process and invents new adaptations in
order to exist and continue to ‘harmonize’ the matter. In ordered and smaller space myri-
ads of choices can be realized, creating zillions of combinations of molecules, nonrepeat-
able events which are often perceived as increasingly deterministic as if there is a clever
plot behind it all. Instead, life is a chain of reflections copying matter, building more
complex matter and reproducing it. In order to do these unorthodox performances life
needs energy: a fundamental means to enable reflection, memorizing, building in its work
and multiplying.
Another feature of life is the ability to recycle biomolecules within the organism,
ecological niche and the entire Biosphere. Mankind generally does it, however, only in
Life, Energy and Light
1
Rupan_c01.indd 1 8/29/2012 5:39:28 PM
2 The Photosynthetic Membrane
extremely confined environments such as travel vessels: ships, submarines or spacecraft.
Life always uses the recycling principle.
Life is difficult to define in one or two simple sentences. Therefore, taking into consid-
eration all arguments provided previously we can present them in the ordered fashion in
form of a number of statements.
● Life is existence of protein and nucleic acid-containing autonomic open systems
exchanging energy and substance with environment in order to maintain their higher
levels of negative entropy (order) and proliferate in time and space. ● Life is largely based on molecular affinity, dialectics of attraction and repulsion forces
of the Universe, replicating itself using simple molecular coding principles, resulting in
constant evolution of dynamic molecular forms. ● In a way, life is a complex and far from equilibrium path towards condensing of matter. It
exists at rather low temperatures on the temperature scale achievable in the Universe.
Therefore whilst the high temperature irreversibly kills life the low temperature has a
tendency to preserve and even stimulate it in some cases (winter crops, Snowball Earth
theory, etc.). ● Currently, life seems to be impossible to create from the non-living substance, apparently
due to a long-term requirement for the evolution and selection of systems working
against the second law of thermodynamics. It is, however, likely that the selection process
which led to the creation of life forms is based upon a nonlinear chain of events and of a
fractal nature, that is can be characterized by sudden emergence of an infinite regularity
from some apparently chaotic and unpredictable trends. It cannot, therefore, be ignored
that tomorrow science would succeed in creating at least a primitive artificial life form. ● An essential prerequisite of life was the incidence of unlimited amount of easily
transferred in space energy (radiation), gradual cooling and condensing matter processes ● Life is a form of ‘revolt’ against the second law of thermodynamics achieved by very
unstable, ‘vulnerable’ (soft matter) systems, a fragile lip of matter towards order and
high organization on the way to the thermodynamic equilibrium and energy drain in the
expanding Universe. ● Life is an inherent property of our Universe and therefore is potentially as old as it is.
It is important to think of life origins from the thermodynamic point of view. In the end,
energy supply is a decisive factor for life in general and mankind, in particular.
1.2 The Energy of Matter
Energy equals matter and matter carries a lot of energy:
= 2E mc (1.1)
And this little formula means a lot for the Universe and life. Of universal energy, life
requires very little. If the energy hidden in a tiny nucleus is about 1 GJ per mole, the
Rupan_c01.indd 2 8/29/2012 5:39:28 PM
Life, Energy and Light 3
energy stored in the most common biological energy carrier, ATP, is 30.5 kJ per mole,
which is nearly 200 000 times smaller than the energy carried by tiny nucleus. Hence, the
question of energy supply to life should not be such a big deal. In a world of forces build-
ing the very blocks of the Universe; nuclei, atoms and molecules, the forces enabling life
are the weakest:
~1 GJ mol –1 ~1 MJ mol –1 500 kJ ------- 2–20 kJ - <1 kJ mol –1
Nuclear Atomic Molecular (covalent) Hydrogen – van der Waals
Forces of life
Fortunately for life, elemental and atomic energy transformations generate one of the by-
products – electromagnetic radiation – a broad range, speed-of-light travelling patches of
energy, capable to interact with matter. This is the best wireless and custom-addressed (not
all matter stuff can get it) form of energy ever known to man. Quanta of electromagnetic
radiation are spanning our Universe. Stars are the major sources of them. We sometimes
look at them at night, just registering small coloured sparkles of light – all energy is left for
us on the path of billions of years of its travel, just barely enough to cause a simple photo-
biological act of the retinal isomerization initiating the chain of the events of vision in our
eyes – all that remains for us from the mighty energy of a star.
1.2.1 The Source of Life ’ s Energy
What if the star can be brought to us a little bit closer, say a few light years or so? The one
we see every morning – the weather permitting – our Sun. People always wondered if they
have to thank it for something a bit more than just daylight, a suntan and warm weather.
Indeed, the Sun is giving to Earth 100 000 TJ of energy every second, a little more than that
required to tan our skins. It is actually enough to boil 100 thousands of billions (10 14 ) of
kettles, roughly 10 thousands per capita of the planet ’ s population. For someone preferring
a Bugatti-Veyron to tea, this is enough to run 20 Bugattis per person; mind you, it has got
to be a car driving on a ‘green’ fuel! But here comes the limited amount of space on our
planet to host not only all those cars but us, mankind with our tendency to scavenge the
nature which brought us into this world.
1.3 Energy for the Future
The point is that the Sun was, is and will be for some time, a very charitable body in the
sky: it gives us all this energy for free, unlike the energy supplying companies. The ques-
tion is how can we use just a tiny fraction of it in order to be alive and happy, driving our
modest vehicles, being curious about the word around us? Let us leave the question of our
lifestyle for a moment and think of how we can use the Sun ’ s generous energy? Naturally,
from solar cells: the devices capable of converting the light energy into electricity, a variety
of photovoltaic gadgets, which use the principles of photon energy conversion into the
Rupan_c01.indd 3 8/29/2012 5:39:30 PM
4 The Photosynthetic Membrane
energy of moving electron or electric current. The industry is growing, in some countries
faster than in the others, and is certainly the way towards the era of recycling, renewal of
goods and energy for the future generations to come. Returning to life we may guess as
well how it has solved the question of energy supply in order to exist in the luxury of the
Biosphere: a carefully settled thin film of organic matter around the globe. Indeed, the key
to fixing all global crises is not just to find a quantity of matter or energy but to find the
ultimate way to live in balance in limited space and conditions. Indeed, the laws of
Biosphere do require the kind of lifestyle that is based not only upon the renewable energy
utilization but also uses a great biological principle of recycling substances. Without
acknowledging these laws one cannot succeed in sustaining life, including our species,
Homo sapiens . We have to find the solutions Nature found some 3 billion years ago. This
solution was building the living matter using the energy of Sun and later its most successful
variety; oxygenic photosynthesis .
1.4 Photosynthesis by Life
Photosynthesis is a process of conversion of energy of light into chemical energy of organic
compounds, carbohydrates. Oxygenic photosynthesis uses water as an electron donor for
redox reactions involved in the primary light energy stabilization.
+ + = +2 2 2 2( )CO H O hv CH O O
(1.2)
Photosynthesis is a process by which organisms capture and store energy of light by a
series of events that converts it into biochemical form of energy. Photosynthesis is a pro-
cess that is directed to increase levels of negative entropy (order) of living forms.
1( ) ,BS K ln
W− ⎛ ⎞= ⎜ ⎟⎝ ⎠
(1.3)
where (– S ) is negative entropy, k B is the Boltzmann constant and W is a number of possible
states the system can exist. W is also proportional to amount of information required to
describe the whole system and its dynamics. The more disorganized is the system, the less
predictable it becomes, and hence, it will require a lot of information in order to describe
all possible states the system can adopt and/or move into in time. Biological matter needs
input of negative entropy in form of energy and substance: hence, it must exist in an open
form. The energy type needs to be an ‘organized’ one, not just thermal or mechanic (lowest
types) but electromagnetic and/or chemical – ‘organized’ forms. The ‘organized’ character
of these forms comes from their specificity: they can be addressed to a specific atom,
molecule or group of molecules and cannot be ‘felt’ by the rest of the cell or organism.
Input of substances brings chemical form of energy as well as the material required for the
organism growth and reproduction.
Rupan_c01.indd 4 8/29/2012 5:39:30 PM
Life, Energy and Light 5
Photosynthesis has emerged on the very early stages of evolution. It remains one of the
most complex biological processes, which is not surprizing, since it holds the key to the
very heart of life: it is the means of fighting the universal entropy. How is the energy of a
tiny particle/wave, photon, used for this? The dualistic nature of something as casual as
light often appeared puzzling to scientists. A photon exhibits properties of both particle and
wave. Sometimes it is capable of propagating through two distant slits on the dark chamber
at the same time. Moreover, it has no rest mass. As Confucius said: ‘The hardest thing of
all is to find a black cat in a dark room, especially if there is no cat.’ Photosynthesis by
living organisms seems to be well-equipped to deal effectively with such an elusive form
of matter as light.
Photosynthesis is, first of all, a sequence of reactions of light energy transformation that
is evolved to solve two major tasks:
a. slowing down the reaction or rather the energy source, photon, and
b. stabilizing the captured energy, so that it cannot escape from the organism.
This looks something like catching a wild cat, making sure it gets calmer, slowing down
and is put safely into a space (cage, etc.) it cannot easily escape from. Catching a photon is
no lesser task for photosynthetic organisms. The principal difficulty here is to catch some-
thing, which has no mass when immobile, meaning that at rest it vanishes and ceases to
exist. How does life manage to slow the photon without killing it? Nature has found a neat
solution by using means of rapid transformation of photon energy.
1.4.1 Photon Energy Transformations
To catch the photon the pigment molecule ’ s optically-active electrons must react very
quickly, within 1 femtosecond (10 –15 s). Excited by light pigments can easily exchange their
energy of excited electron. This occurs via the electromagnetic resonance events, which
cause excitation energy wondering from one pigment to another, exciting without direct
molecular interaction. The energy is kept among the ‘collective’ of pigments and is waiting
for its fate, which can be various. The photon can reappear again, having less energy than
the absorbed one. Alternatively, the energy of a pigment can simply be wasted into heat,
contributing to the rise in the Universe ’ s entropy. Also, the electron spin can change to the
opposite creating so-called tripled excited state. Finally, the energy can be trapped by the
photochemically active pigment of the reaction centre to initiate the chain of electron and
coupled proton transport events leading to the chemical storage of light energy in the two
final products of the light phase of photosynthesis, ATP and NADPH (Figure 1.1 ). Those
can later be used elsewhere and when light is no longer present. These two substances are
the universal biological currency, always in demand for the ‘dark’ photosynthesis to fix
carbon from carbon dioxide of the air or just a synthesis of biological matter. Light harvest-
ing is therefore a staged process of photon-exciton-electron-proton transformations, han-
dling the most elementary and fundamental forms of energy and matter. Light harvesting is
the essence of photosynthesis in our planet. Remarkably, this energy transformations and
stabilization occur in one tiny kind of site, more specifically, surface, called the photosyn-thetic membrane .
Rupan_c01.indd 5 8/29/2012 5:39:31 PM
6 The Photosynthetic Membrane
This book will talk about the composition, structure, variety of functions, adaptations,
assembly, biological importance and ways to study and to understand the photosynthetic membrane as the oldest and, so far, greatest light-harvesting nanostructure ever existed on
our planet that supported and continues to support all its life.
Reference
Confucius ( 1979 ) Analects . Penguin Books .
Bibliography
Barber , J. ( 2007 ) Biological Solar Energy . Phil. Trans. R. Soc. A , 365 , 1007 – 1023 . Blankenship , R. ( 2002 ) Molecular Mechanisms of Photosynthesis . London : Blackwell Science . Clayton , R.K. ( 1980 ) Photosynthesis: Physical Mechanisms and Chemical Patterns . Cambridge :
Cambridge University Press . Gleick , J. ( 1998 ) Chaos: Making a New Science . Vintage . Hall , D.O. and Rao , K.K. ( 1995 ) Photosynthesis . Cambridge : Cambridge University Press . Schrödinger , E. ( 1992 ) What is Life? With Mind and Matter and Autobiographical Sketches .
Cambridge : Cambridge University Press . Vernadsky , V.I. ( 1997 ) The Biosphere: Complete Annotated Edition . Heidelberg : Springer . Walker , D. ( 1992 ) Energy, Plant, Man . Brighton : Oxygraphics .
Light capture
Captured energy transfer tophotochemical converter–reaction centre
Electron transport
NADPH
>102 s
ATP
Proton transport
10–15 S
10–10–10–1 S 10–3–10–1 S
10–10 S
Photon Exciton Electron Proton
(~10 –36 kg) (10 –30 kg) (1.7 ×10 –27 kg)
Chemical storage
Carbonfixation
Light energy accumulation processes: time scales
Figure 1.1 Light energy accumulation processes: a sequence of particle transformation events (a simple scheme).
Rupan_c01.indd 6 8/29/2012 5:39:31 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
Adde parvum parvo magnus acervus erit (Add a little to a little and there will be a great heap)
Ovid
2.1 The Cell Concept: Fundamental Nature of Life
All life forms apart from those very primitive ones, which are dependent upon other life
forms to provide them with homes where they live and proliferate (viruses, etc.), have a
very common building block, the cell. We are not a solid mass of matter (remember the
T-1000 terminator in ‘Terminator 2’ built of liquid metal? Or the planet-brain Solaris: both
apparently a homogenous mass that is alive?). Hence, life forms are represented by one,
several or many cells. The fact reminds us that we have evolved from a unicellular organism.
Cells are usually small, one tenth of a millimetre. Why do they have to be so tiny? The
answers are many. The first is actually, why not? These cells still contain millions of various
molecules organized in dozens of different compartments or organelles. Hence, in spite of
their small size the cell is much larger than the individual biomolecules within it and
therefore can be a complex, heterogeneous and multifunctional structure.
Indeed, there is a lot of space in the microworld. Richard Feynman ( 1960 ) named
his lecture given at an annual meeting of American Physical Society in 1959: There ’ s plenty of room at the bottom . What did he mean? Well, this physicist ’ s jargon refers to the
geometrical scales of matter: ‘bottom’ is the lower limit of special dimension and top, the
higher limits of special dimension. The lower limit is obviously infinitely small,
asymptotically approaching zero. But near it resides the world which is named with the
very frequently used term nowadays, nanoworld . The dimensions there are within nanometres
The Space of the Cell
2
Rupan_c02.indd 7 8/29/2012 5:39:13 PM
8 The Photosynthetic Membrane
range (10 −9 m). The borders are arbitrary and gradually drifting up to the micrometer scale
(10 −6 m) approaching the millimetre border. A border that arbitrarily divides these worlds
of nano and micro from macro: the scale of existence in human dimensions. Basically it is
an invisible versus visible worlds division. Hence, from the lower limit of our macroworld
down the bottom of the nanoworld there are approximately six orders of magnitude of
dimensional space. That is one million! The space scale it covers can be compared to the
space scale between the size of a man and a country like the United Kingdom. There was,
and is a lot going on in the country. Imagine an endless list of institutions such as history,
geography, politics, arts, industry, agriculture, nature, science, religion, family, and so on.
An entire universe of human existence! In the same respect, the cell is an entire universe of
fundamental life on this planet. It is the basis for all Nature ’ s and our activities on it.
Feynman was seriously fascinated by the biological design:
A biological system can be exceedingly small. Many of the cells are very tiny, but they are very active; they manufacture various substances; they walk around; they wiggle; and they do all kinds of marvellous things – all on a very small scale .
But why have all life ’ s engines been evolved on the nanoscale rather than macroscale? Is
there any advantage or even absolute requirement for life processes to be organized on a
tiny invisible scale, as if we are not meant to see and learn what is going on? Hidden from
the eye cellular processes enabling life to take place where some laws of physics are very
different from those of a visible the macroworld. At the nanoscale the forces of surface
tension in the cell prevail over the forces of gravity. Hence, the capillary effects enable trees
to deliver kilograms and tons of water and nutrients upwards against gravity. For humans it
would require the use of powerful pumps: a macroworld solution to the problem.
Another peculiarity of the cell environment is the very high viscosity and high surface
area to volume ratio. These features enable cell robustness and at the same time extremely
high rates of substance exchange with the environment providing cells with power required
for fast growth and division. Another advantage of the nanoscale cell design is the very
high rates of thermal conductance. Indeed, excess thermal energy released as a result of a
multitude of biochemical processes can quickly be removed into the environment without
altering or causing any harm to delicate balance of cellular processes, the vast majority of
which are temperature sensitive.
An additional property of the nanoworld is that electrical charge concentration and
dynamics can be extremely high. Since electricity is utilized by the cell in a number of very
important functions, charge concentration and dynamics are important factors ensuring the
effectiveness and power of such processes as signal transduction, biological movements
and energy generation. And finally, arguably the most important property of the nanoworld
is that in some cases it provides the right space for otherwise entropic processes to become
pseudo-entropic or even organized. The fundamental grounds for this point can be seen
experimentally in the phenomenon of Brownian motion. There, the entropic motion of the
tiny pollen particles is driven by the collisions with a relatively small number of tiny
molecules of water, in the nanoworld the particle motion becomes visible simply because
Rupan_c02.indd 8 8/29/2012 5:39:14 PM
The Space of the Cell 9
of much smaller populations of water molecules are interacting with it. At a first glance,
Brownian motion is a problem for life. However, the entropic energy of spontaneous
molecular movements is utilized by life throughout, simply because it introduces certain
structural restrictions that can be imposed upon apparently stochastic processes. The
energy of molecular vibrations together with the energy of various gradients (that will be
described in the next chapter) is used to drive highly autonomic and directed processes in
the cell. Therefore these processes are subject to nonequilibrium thermodynamics, an
instrument to describe and understand the mechanics of molecular processes of life. Later
this point will become more apparent with the introduction of macromolecules and their
works in the nanoworld of the cell. The first chapter, describing the features of life, stated
that one of the major properties was the lowering levels of entropy in life forms. The
nanoscale seems to be a perfect field for this very fundamental feature of life in the
elementary space of the cell.
2.2 Compartmentalization: The Cult of the Membrane
When the space boundaries are defined like those of the ticket hole of the railway station,
where a crowd of people moves in unpredictable manner, the system looks highly entropic,
disorganized. How to make it more organized? The answer could be to create various spe-
cialized sub-spaces. Then the system would look more organized so that one should be able
to trace the reasons for people ’ s movements and behaviour in those different compartments
of space. The cell is a much compartmentalized structure. The walls of compartments are
made of similar structures to the wall of the cell – the lipid bilayer membrane – a remark-
able example of biological self assembly system. The order starts with establishment of
defined molecular interactions forming condensed states, like a plane made of a double
layer of molecules. Why a double layer? From inorganic chemistry we know that some
reactions lead to formation of water insoluble salts which form sediments of various shapes
or even organized crystals on the bottom of a test tube, a simple self-organizing system.
The property that made salts form those pellets is the stronger interaction between salt
molecules then between salt and water molecules. A simple but remarkable birth of order!
Like honey that attracts flies by making them all fly in one direction, abandoning their
chaotic movements in warm, summer afternoon light. One single property determines the
shape of substance in the water phase.
Molecules that form membranes, lipids, have a higher affinity to each other than to the
water molecules, therefore they form structures. But the 2D shape of the membrane and its
bilayer structure is determined by one additional property of the lipid molecule:
amphiphilicity or possession of both, hydrophobic and hydrophilic properties. Indeed, a
lipid molecule has one or more long hydrocarbon linear tails as well a hydrophilic head
built of oxygen-containing glycerol, alcohols, sugars or simply hydroxyl groups. In
addition, the head is attached to the tail via ester linkages containing ester and carbonyl
oxygen. Some lipids can contain dozens of oxygen atoms. Therefore, during lipid
interactions in the water phase, a bilayer structure is formed as a lowest energy
Rupan_c02.indd 9 8/29/2012 5:39:14 PM
10 The Photosynthetic Membrane
thermodynamic state where hydrophobic fatty acid chains interact with each other via van
der Waals forces and are hidden from water and hydrophilic heads are exposed to water and
interact with it via hydrogen bonds. Hence, specific molecular properties and weak
interaction forces enable the process of biological self assembly based entirely on reaching
the thermodynamic energy minimum in the water system.
Membrane self-assembly process is driven by weakest molecular forces that define
hydrophilicity and hydrophobicity of lipid molecular structures. This is easy to see in the
simple computer stimulation experiment (Figure 2.1 ) that uses a molecular docking
algorithm. Here the van der Waals interactions are driven by the energy drop of a few
kcal mol -1 in the simple associate of two short fatty acid molecules (laurate) enabling
hydrophobic parts of the molecules to align for the maximum interactive configuration.
In the water phase the polar (hydrophilic) oxygen-containing groups (depicted in darker
shading) would in turn interact with water via much stronger then van der Waals hydro-
gen bonds. These interactions would further stabilize lipid associations (Figure 2.2 ) so
that they self-organize into bilayer structures reaching the stable energy minimum of the
whole system carefully dividing the structure and forces defining hydrophobic and
hydrophilic domains.
Because the biological membrane is built of the weakest molecular interaction forces it
is a very dynamic structure. Lipid molecules are free to move laterally relative to each
other, since at ambient temperature the entropy will provide enough energy to break (and
re-establish again and again) van der Waals interactions, making them change all the time
without compromising the overall stability of the membrane structure and keeping the
system at a relatively stable minimum energy. Increasing the ambient temperature will
inevitably lead to the increase in molecular movement within the membrane making it
more dynamic and will eventually exceed the membrane stabilization forces causing
damage and disassembly. Hence, the types and structure of molecules that build the
biological membrane could define its robustness and resilience to the environmental
temperature. One of the adaptive ‘measures’ could be to increase the area of van der Waals
surfaces. This can be achieved by increase in saturation of fatty acids making the ‘tail’
structures more flexible and ready to adopt the very minimum of collective lipid energy. In
addition, this surface could be enhanced by introduction of methyl groups into fatty acids.
Energy drop
2 kcal–1 Mol–1
Figure 2.1 The forces driving biological membrane self-assembly: calculation of energy drop during interaction of two molecules of laurate.
Rupan_c02.indd 10 8/29/2012 5:39:14 PM
The Space of the Cell 11
It is achieved in membranes of Archaea . As a result these organisms can leave at extremely
high environmental temperatures, up to 80 °C and even higher.
The biological membrane is a typical and primary example of molecular antagonism that
leads to the automatic formation of biological structure. Perhaps the emergence of life in
the water environment was preceded by the formation of organic molecules that possessed
amphiphilic properties: amphibious characters, accommodating an inherent antagonism
between hydrophilia and hydrophobia. It will be further revealed, using the examples of
protein structures, that living nature is well designed for exploring thermodynamics in its
use to minimize levels of entropy and hence organize itself. The variety of lipid types offers
the biological membrane some flexibility in properties, such as fluidity, interactions with
environment, permeability, electric potential and accommodation of nonlipid membrane
components, such as sugars and proteins.
The biological membrane is a two-dimensional structure, but its space is very small. It is
a nanoscale structure that inevitably (thermodynamically predetermined) encapsulates a
closed space forming a vesicular structure, a prototype of the cell. The cell is an entire
fortress. Take, for example, The Tower of London. The cell and the Tower have a lot in
common. They have their entities marked and preserved by a barrier, wall or membrane.
The wall of the Tower defended it from invaders, enabled traffic through its gates, served
for observation of exterior environments. The cell membrane performs all of these functions
and in addition, in some cases even more. It can act as a kitchen, a place where new
substances are being synthesized and the biological energy can be produced. Within the
Tower stand a few buildings of various functions. Similarly, the fortress-cell has a variety
Hydrophilic phase
Integral protein
Lipids
Hydrophobic phase
Hydrophilic phase
Hydrophilicdomain
Membrane spanningdomain
Integralnonspanning
Peripheral
Figure 2.2 Protein stabilization in the biological membrane. Atoms in molecules are bound by covalent forces of about 100 kcal mol -1 . Hydrophilic domains of a membrane protein interact with the lipid head groups with electrostatic (10–40 kcal mol -1 ) and hydrogen (1–10 kcal mol −1 ) bonds. The hydrophobic fatty acid tails and protein domains interact via Dynamic van der Waals forces (0.1–1 kcal mol -1 ).
Rupan_c02.indd 11 8/29/2012 5:39:14 PM
12 The Photosynthetic Membrane
of subcellular structures – organelles – surrounded by their own membranes. The cell is
packed with these structures so densely as houses in medieval town (take the Shambles of
York, for example). The crowdie compartmentalized nature of the cell interior is a crucial
feature of life design. Divide et impera or ‘divide and rule’: that was the key strategic
doctrine of the Roman Empire. In other words, segregation makes things better organized
and controlled, hence it allows a certain kind of order to be established.
The way cellular compartments are organized and their work is coordinated is remarkable.
The emperor is obviously the cell nucleus, sending various messages and directives to all
cellular compartments, it holds the information needed to build the cell structures.
Compartmentalization also takes place on the level of individual organelles and their
components. Membranes divide compartments and components and enable formation of
gradients of various substances: molecules, ions, protons, electrons and even electric fields.
The gradients accumulate potential energy, which when transformed into kinetic energy
can produce work and directionality, leading to formation of biological matter and
establishment of those functions characteristic for an organelle or entire cell. Order emerges
as a result. Barriers also serve to separate those types of molecules that otherwise would
interact with each other producing unwanted substances that may harm the cell and create
chaos. But what enables the membrane to possess such a variety of functions supporting
the life of the cell, tissue, organ and organism? The answer is membrane proteins and their
complexes with lipids and other functionally important cofactors, like ions and relatively
small organic molecules.
2.3 Membrane Components: Fundamentals of Proteins
The membrane is not much less complex and, by all means, not less fundamental than the
cell itself. In order to fulfil all those functions described in the previous paragraph it must
possess some specialized features. These features first of all, are represented by membrane-
associated proteins. Proteins in the membrane play a central role in enabling the biological
functions on a molecular level. Membrane proteins are a special class of proteins, which
are amongst the most difficult to study, mostly because the membrane is their natural
environment from which they cannot be harmlessly liberated without consequences for
their intactness. The membrane protein environment is amphiphilic (see Figure 2.2 ).
The presence of proteins in the membrane not only defines its functions but also
significantly changes its physicochemical properties, including temperature stability and
permeability to various molecules. Different biological membranes contain various
amounts of proteins. Myelin, a membrane that insulates nerve fibres has low protein content
(~18%). Relatively pure lipids are good insulators. In contrast, the plasma membranes of
most other cells are much more metabolically active and hence require more specialized
molecular apparatus. These membranes contain many pumps, channels, receptors and
enzymes: all proteins. The protein content of some plasma membranes is typically 50%.
However, biological energy-transduction membranes, such as the internal membranes of
mitochondria and indeed photosynthetic membranes have the highest content of protein,
Rupan_c02.indd 12 8/29/2012 5:39:15 PM
The Space of the Cell 13
typically 75% and even more in some cases. Figure 2.3 displays electron microscopy
pictures of the fragments of photosynthetic membrane from higher plants containing two
types of proteins or rather protein complexes, photosystem II (PSII) and light harvesting
complex II (LHCII). It shows that proteins of different type and function can have different
density in the membrane. Whilst PSII particles positioned relatively far one from other
(more then a particle diameter), the LHCII particles look like a crowd of proteins, tightly
interacting with each other. This simple observation could be indicative of the different
functional roles of the two types of membrane proteins.
Whilst membranes of specialized cells often contain only a few types of proteins,
membranes of metabolically active cells and organelles normally contain a large variety of
protein types, structures and sizes. These proteins can also vary in the way they interact
with or are positioned within the membrane. Typically membrane proteins span the whole
width of the membrane having a hydrophobic membrane-spanning (transmembrane)
domain and two hydrophilic domains protruding into water phase (see Figure 2.2 ). These
proteins are called integral membrane-spanning proteins. There are, however, proteins, that
are integral but do not span the whole membrane depth. They are called integral non-spanning membrane proteins. The other type of proteins does not even interact with the
hydrophobic lipid interior of the membrane. They are simply bound to the hydrophilic
domain of other membrane proteins via most commonly ionic interactive forces and
hydrogen bonds. This type of interaction is relatively strong and normally these proteins
are fixed permanently in their binding site and do not move around, whilst integral
membrane proteins display a certain degree of mobility (this will be discussed in detail
later). The ability of membrane proteins to move in the membrane plain allows them to
interact with each other, regroup, oligomerize and form domains, thus giving the membrane
a heterogeneous character. All this enables a broad range of adaptations of the membrane
structure and function suited to various metabolic and environmental changes and
requirements.
Figure 2.3 Different densities of two types of membrane proteins. Freeze-fracture electron microscopy image of the photosystem II (left) and LHCII particles.
Rupan_c02.indd 13 8/29/2012 5:39:15 PM
14 The Photosynthetic Membrane
One important feature of membrane proteins is that they very often form relatively
stable superstructures: complexes of several subunits (sometimes dozens of subunits). The
molecular weight of these complexes can reach hundreds of thousands and even a few
millions of Daltons. Those who work on the evolutionary aspects of membrane protein
functions are often puzzled by the question of how at all such complex, cooperatively built
and functioning molecular machinery could evolve? What is even more intriguing is that
whilst some of these structures took a relatively short time to evolve, they have been then
preserved in nature for hundreds of millions of years.
Another interesting aspect of the superstructural character of many membrane proteins
is that since they are very large (sometimes 10 or even 30 nm in diameter) there are not so
many of them in the biological membranes of organelles, in particular, to treat their
behaviour (movements and interactions) with random statistics, there are simply too few of
them and they do not behave any more as billions of small molecules obeying the laws of
classical molecular thermodynamics. There only are about 200 PSII complexes in the area
of 400 × 700 nm of the photosynthetic membrane presented in Figure 2.4 . Hence, it is not
surprising to see otherwise improbable, nearly perfect transient ordering of membrane
supercomplexes as displayed here. The behaviour of such system cannot be correctly
described by statistical molecular physics. It would require N-body modelling approaches
used in the studies of dynamics of stellar clusters in the Universe, a totally unexpected turn
in the research of a nanoworld of the biological membrane. Indeed, for such a large structure
as the PSII complex factors like symmetry (or indeed asymmetry), sensitivity to
environment, ability to interact via various types of weak forces (see the Figure 2.2 caption)
could be major determinants of 2D diffusion and, hence, positioning. Therefore, the
conventional statistics of molecular behaviour are replaced in the membrane by a more
deterministic control resulting in predictable collective dynamics and simple control over
function, and in this way establishing order in the nanoworld of cell processes, an ultimate
goal of life.
Figure 2.4 Order versus disorder of membrane protein assemblies. Freeze-fracture electron microscopy image of the photosystem II-containing membrane. Courtesy of Matt Johnson.
Rupan_c02.indd 14 8/29/2012 5:39:15 PM
The Space of the Cell 15
2.4 Functional Classification of Membrane Proteins
Proteins in the membrane play a number of vital cellular and organellar functions. These
functions can be divided into the three major groups: transport , signalling (reception) and
metabolism (enzymes).
Transport proteins are the largest and the most versatile in functions and structure group
(Figure 2.5 ). It consists of photosynthetic light harvesting antenna complexes , which ‘deal’
with the tiniest particle, the ‘photon’ that carries the energy needed to drive the photosyn-
thetic reactions. The second group of transport proteins is light driven proton pumps . The
typical example of this group is bacteriorhodopsin, a protein that captures light energy and
converts it into the energy of a proton gradient across the membrane it is located in. Hence,
this is a complex transporter that deals not only with photons but also much larger particles,
protons. The next group of transporters are light-driven electron transport complexes .
These are represented by reaction centre complexes of various photosystems of prokary-
otes to eukaryotes. The role of these complexes of proteins is to convert the energy of
excited by light electrons into the energy of moving electrons that are donated into the
chain of reactions of reduction and oxidation that supply the cell with NADPH and ATP.
Another group of transporters is electrochemical potential transporters . Typical represent-
atives are proton-drive ATPases that transform energy of the proton gradient across the
1 Light harvesting complexes
Antennae of all photosysthetic organisms
Bacteriorhodopsin-like proteins
Photosynthetic reaction centres
Cytochrome b6f complex
Proton-driven ATPases
Calcium ATPase
Voltage-gated ion channels
Drug/Metabolite transporters
GPCRs (Rhodopsin), GABA receptors (gamma-aminobutyric acid)
Prostaglandin H synthase, Protoporphyrinogen IX oxidase
2 Light absorption-driven pumps
3 Light-driven electron transfer complexes
4 Electron transfer complexes
5 Electrochemical potential transporters
6 Phosphate bond hydrolysis-driven transporters
7 Ion channels
8 Porters (uniporters, symporters, antiporters) and porins
9 Receptor proteins
10 Enzymes
TR
AN
SP
OR
TE
RS
LHCII Photosystem II PRIMARY ENERGY
PRIMARY & METABOLICENERGY
WORK
COMMUNICATIONS
METABOLISM
SIGNALLING
METABOLISM
Bacteriorhodopsin
Cytochrome b6f H+-ATPase
PHOTOSYNTHESIS
PHOTOSYNTHESIS& RESPIRATION
Figure 2.5 Functional classification of membrane proteins.
Rupan_c02.indd 15 8/29/2012 5:39:15 PM
16 The Photosynthetic Membrane
membrane they are inserted in to synthesize ATP from ADP. Relative to them is a group of
transporters that work in reverse, hydrolysing ATP in order to transport various ions across
the membrane (calcium ATPase). The other group of transporters is essential for channel-
ling ions ( ion channels ). Next group of transporters is capable of transporting molecules of
various sizes actively ( porters ) or passively ( porins ).
Functions of transport membrane proteins span from primary to metabolic energy gen-
eration, from work, communications to cellular homeostasis. A remarkable feature of
transport proteins is that they are capable of handling the particles of matter that vary in
sizes by more than 10 orders of magnitude (mass of a moving photon is ~ 10 −33 g, mass of
electron is ~ 10 −27 whilst the mass of glucose is ~ 3 . 10 −22 g). This is yet another feature and
advantage of a nanoscale design of life.
The second class of membrane proteins are various receptors that form systems of
cellular communication and signalling (G-protein coupled receptors (GPCRs), gamma-
aminobutyric acid (GABA) receptors). Here, we see a very similar feature to transporter
proteins: ability of receptor proteins to ‘handle’ particles of nature from photon of light and
ions to large organic molecules and even proteins.
The third class of membrane proteins are enzymes . A typical example is prostagandin H2
synthase that catalyses the first step in prostaglandin synthesis. The enzyme is an integral
but nonspanning membrane protein. Its active centre must be located within the hydropho-
bic environment, since the substrate is a fatty acid (arachidonate). The hydrophobicity of
the substrate simply dictates the design and location of the metabolic enzyme, not in the
water phase but in the 2D space of the membrane interior.
Reference
Feynman , R. ( 1960 ) There ’ s Plenty of Room at the Bottom . Caltech Engineering and Science , 23 , 22 – 36 .
Bibliography
Berg , J.M. , Tymoczko , J.L. and Stryer , L. ( 2012 ) Biochemistry . Basingstoke : W.H. Freeman and Company .
Branden , C. and Tooze , J. ( 1991 ) Introduction to Protein Structure . New York and London : Garland Publishing .
Luckey , M. ( 2008 ) Membrane Structural Biology (With Biochemical and Biophysical Foundations) . Cambridge : Cambridge University Press .
Nicholls , D. and Ferguson , S.J. ( 2002 ) Bioenergetics . London : Academic Press .
Rupan_c02.indd 16 8/29/2012 5:39:15 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
‘ In thy house or my house is half the world ’ s hoard …’ Rudyard Kipling
3.1 Knowledge of the Pre-Atomic Structure Era: Organization of the Photosynthetic Membrane System
Let us consider the photosynthetic membrane of the higher plants. Figure 3.1 (a) shows typical
evenly green young spinach plants. Spinach has been a model plant for research in photosyn-
thesis spanning from studies of primary processes to experiments on carbon assimilation in
isolated chloroplasts. They can be visualized even without preparation in the intact cell using
the modern confocal scanning fluorescence microscopy (see the next chapter for details).
Figure 3.1 (b) shows a confocal fluorescence microscopy image of round spinach chloroplasts,
a very high resolution optical microscopy, whilst Figure 3.1 (c) displays an image of isolated
chloroplasts obtained by conventional optical microscopy. It is easy to detect the intact chlo-
roplasts, which show much better contrast to the broken organelles, which loose their shape
and appear rather flat. Both images, however, reveal the presence of grained structures with
higher intensity of absorption/fluorescence inside of the chloroplast. They can be numerous
and are called granae. The medium they are embedded into is called stroma. The granum is a
The Photosynthetic Membrane: Outlook
3
Rupan_c03.indd 17 8/29/2012 5:38:57 PM
18 The Photosynthetic Membrane
(a) (b)
(c) (d)
(e) (f)
(g) (h)
Chloroplast
Granae
Granae
Granal thylakoid
PSII
LHCII
PSII
Rupan_c03.indd 18 8/29/2012 5:38:58 PM
The Photosynthetic Membrane: Outlook 19
very structured particle that can be explored in detail only by a higher resolution microscopy,
like transmission electron microscopy (EM). EM images in Figure 3.1 (d) and (f) display
numerous grana in the chloroplast and a single granum that exhibits a clear lamellar structure.
Figure 3.1 (e) shows a schematic simplified presentation of the structure of granum. It is basi-
cally a stack of flattened often round vesicles called thylakoids. Vesicles are surrounded by
membranes, which, in fact, are the photosynthetic membranes of higher plants. The volume
insight the thylakoid is called the lumen. Its space is very narrow, only about 10 nm wide. The
physiological reasons for the existence of the lumen space, that is, a closed volume surrounded
by the photosynthetic membrane, will be explained later.
Stacking of thylakoids into granae is known to depend upon the presence of divalent
cations of magnesium, Mg 2+ . Monovalent cations of potassium, K + , are also effective
though at higher concentrations than Mg 2+ (100 mM of K + vs 5 mM for Mg 2+ ). It is generally
accepted that positively charged cations bind to negatively charged groups exposed on the
membrane surface therefore compensating electrostatically the screening repulsive forces
between membranes assisting thylakoid stacking. As will be shown later, membrane
proteins play crucial role in this process undergoing a radical lateral cooperative regrouping
in the thylakoid membrane system. Still, there are also thylakoids in chloroplasts that are
not involved in formation of granae called intergranal or unstacked thylakoids. Together
with granae they form the chloroplast thylakoids, a site where the whole light phase of
photosynthesis takes place. Thylakoids can be isolated relatively easy from chloroplasts
and have been the subject of studies for a number of decades. Some of them will be
mentioned later in this book. However, first of all it must be said that the thylakoid system
is the site in chloroplasts that plays a direct part in the absorption of sunlight and, hence,
the trapping photons. What is interesting is that the area of these photosynthetic membranes
is extremely large. Let us do a simple rough calculation.
Take 1 cm 2 of the average spinach leaf. Its area in micrometres would be 10 8 μm 2 . The
average cell size is about 20 × 40 μm, therefore the area is 800 μm 2 . Hence, one cell layer of
the 1 cm 2 of leaf will contain 125 000 cells. Each cell can carry ~ 50 chloroplasts (in
shade-grown plants). Each chloroplast can easily contain 100 granae with around seven
stacked thylakoids, each having two membrane surfaces. The average thylakoid diameter is
0.5 μm, which corresponds to ~0.2 μm 2 . Using these numbers we can calculate the total area
Figure 3.1 Origin and organization of the photosynthetic membrane of higher plants. (a) Spinach plants – a common model for mechanistic photosynthesis research. (b) Fluorescence confocal image of chloroplasts in the intact leaf showing clearly separated fluorescing dots – granae. Bar is 5 μm (courtesy of Tomasz Goral and Conrad Mullineaux). (c) Isolated chloroplasts in the incubation medium. Bar is 10 μm. (d) Electron micrograph of a single chloroplast showing dark elongated granae and large white starch granulae (centre). Bar is 1 mm. (e) Schematic presentation of thylakoid system structure of the chloroplast. (f) Electron micrograph of a single grana stack (centre). Bar is 200 nm. (g) Freeze-fracture electron micrograph of a single thylakoid membrane from grana showing photosystem II particles. Bar is 100 nm. (h) Freeze-fracture electron micrograph of grana thylakoid membranes displaying photosystem II as well as light harvesting complex particles (LHCII). Bar is 200 nm. (See Plate 3.1 in colour plate section.)
Rupan_c03.indd 19 8/29/2012 5:38:59 PM
20 The Photosynthetic Membrane
of only granae membranes in the one layer of cells of 1 cm 2 leaf area. It yields approx.
20 cm 2 , more than an order of magnitude higher than the leaf area itself. Remarkably, this
is achieved despite the total chloroplast volume is being only ~1/10 of the cell volume. Taking
into account that the average leaf can contain around 20 cell layers we can see that the total
grana membrane of the leaf of 1 cm 2 can be about 400 cm 2 , that is, 20 × 20 cm. For a leaf with
10 cm 2 area, this will be 4000 cm 2 or nearly a half of a square metre! This is a truly remarkable
achievement of a compact character of the nanoscale organization of the chloroplast cell
compartment reflecting Feynman’s famous remark about the significant amount of space the
nanoworld potentially possesses (see the previous chapter). By making light harvesting take
place in a very thin two-dimensional system, the membrane, it is possible to compact a large
membrane area into a relatively small three-dimensional space. This space in the case of the
photosynthetic membrane area is well-utilized in the processes of adaptation to the light
environment that involve alterations in leaf, cell and chloroplast morphology. This is a well-
documented fact that plants acclimated to low light accumulate more chloroplasts per cell,
grana per chloroplasts and thylakoids per grana. This type of acclimation results in a one or
even two orders of magnitude increase in the light interception and photosynthetic capacity
of the plant, overall. The changes in the ‘macroworld’ of the plant also take place during light
acclimation manifesting in alterations in the leaf area, and so on. However, those occur on
much smaller scale than the changes in the structure on the level of organelles.
Another interesting feature of the efficiency in light interception by the leaf cell is that
chloroplasts can move and adopt positions to maximize or indeed minimize light
interception. The elements of structure such as cell walls and vacuoles scatter light
effectively in the leaf so that it can propagate virtually in any direction reaching optimal
numbers of chloroplasts and their thylakoids. Figure 3.2 , left , displays even redistribution
of chloroplasts in the spinach cell grown under low light environment. Figure 3.2 , right , shows the effectiveness of oak leaves absorption of sunlight. The second layer of leaves
Figure 3.2 Scattering and absorption of light by oak leaves. Left : 1, 2 and 3 order of leaves facing light. Right : chlorophyll fluorescence confocal image of the leaf cell showing even redistribution of chloroplasts. Bar is 5 micrometers (Photo on the right is courtesy of Tomasz Goral and Conrad Mullineaux). (See Plate 3.2 in colour plate section.)
Rupan_c03.indd 20 8/29/2012 5:38:59 PM
The Photosynthetic Membrane: Outlook 21
shaded by the first layer still receives some light, whilst the third remains in very shaded
environment. As it will be shown in a later chapter, filtration of light by leaves in diverse
and stratified ecosystems alters significantly spectral quality of light available for plants
that live under canopy of others and therefore demands and, indeed, results in development
of important light adaptation strategies by the photosynthetic membrane.
3.2 Composition of the Photosynthetic Membrane
3.2.1 Lipids
Lipids are essential components in the photosynthetic membrane. First, their amphipathic
properties direct the self assembly process leading to the formation of biological membranes
(see Chapter 2). Thylakoid lipids make up to 50% of a total membrane mass. Also, this
figure depends on the plant growth conditions and the stage of chloroplast development
and can often be rather smaller. Second, they are essential components of the membrane
protein complexes, helping to shape protein structure and function (see the next section).
There are four major classes of lipids present in the thylakoid membrane of plants. These
include two classes of galactolipids, mono- and digalactosyldiacylglycerides (MGDG and
DGDG, respectively). They are the major lipids in the thylakiod membrane, occurring at
the ratio of MGDG to DGDG ~2 : 1 and constituting up to 75% of the total lipid content
in spinach membranes. The remaining lipids of the thylakoid membrane are made up
of phosphatidylglycerol and sulfolipids, occurring in approx. 2 : 1 ratio. Structure of all
thylakoid membrane lipids is based upon glycerol, esterified by two fatty acids to carbons
1 and 2 (Figure 3.3 ). The most common fatty acid is linolenic, 18 : 3, which is nonsaturated
CH2OH
CH2OH
CH2SO3
HO
H
HOH
OH
OHHOH
H
HO
H
HOH
OH
OH
H
H O
O
O
OP O
OH
OHO
HO
H
OH
HOH
OH
OH
H
H
HO
DGDG
MGDG
SQDG
PG
O
O
Figure 3.3 Structure of the photosynthetic membrane lipids. MGDG, monogalactosil-diacylglyserol; DGDG, digalactosildiacylglycerol, PG, phosphatidylglycerol; SQDG, sulfoquinovosyldiacylglycerol.
Rupan_c03.indd 21 8/29/2012 5:39:00 PM
22 The Photosynthetic Membrane
and can represent up to 95% of all types of fatty acids in particularly in galactolipoids of
spinach thyalakoid membranes. In addition, a bit shorter, hexadecatrienoic (16 : 3) and
hexadecatetraenoic (16 : 4) acids were found along with less saturated linolic (18 : 2) and
saturated, palmitic (16 : 0) acids can also be found in spinach thylakoid membranes. High
levels of nonsaturated fatty acid residues enhance greatly membrane fluidity. Regulation in
the ratio between saturated and nonsaturated fatty acids is a fundamental mechanism that
alters membrane fluidity and sensitivity of membrane functions to the environmental
temperature. In addition, the sheer diversity of fatty acid composition has been noticed
among various groups of photosynthetic organisms. The hydrogen atom of the third
glycerol carbon is replaced by the galactose (in MGDG), di-galactose (in DGDG),
sulfoquinovose (in SQDG) or glycerophosphate (in PG) (see Figure 3.3 ). There is a clear
asymmetry in redistribution of these four classes of lipids in the thylakoid membrane.
Galactolipids prefer to face the outer, stromal side of the membrane (up to 60% of
MGDG + DGDG). Phospho- and sulfolipids are mainly localized in the other half of the
bilayer with hydrophilic head groups facing lumen. It is likely that such asymmetry as well
as interactions with protein complexes hold the keys to the diversity and functions of the
photosynthetic membrane lipids.
3.2.2 Lipid-Related Compounds of the Photosynthetic Membrane
There exist a number of other lipid-like molecules in the thylakoid membrane of plants
(Figure 3.4 ). Most common and functionally sound are chlorophylls, the green pigments of
photosynthesis. Their concentration in the membrane is only approximately 2.5 times lower
then that of all lipids. Chlorophylls possess hydrophobic mostly saturated hydrocarbon tail,
phytol. Similarly to the hydrophobic tails of lipids from Archaea (see Chapter 2) the phytol
tail is methylated: this feature enhances the strength of hydrophobic interaction between
chlorophyll and other membrane components and therefore enhances structurally their
stability. The latter fact is important, as will be described later for the essential functions of
this pigment. The hydrophilic component of the chlorophyll molecule is the large macrocycle, chlorine ring. The functional reasons for this will be detailed later. As far as the
structure of the chlorine ring is concerned, it contains five oxygen atoms that mostly deter-
mine its polar nature and interactivity with the membrane components, mostly via hydrogen
bonds which are much stronger then van der Waals forces (see Chapter 1). Another key
structural feature of chlorophyll is the presence of magnesium atom in the centre of chlorine
ring coordinated by nitrogens of the pyrrole rings. Magnesium coordination number in vivo ,
as will be shown later, is normally five or even six due to additional interactions formed by
the atom and the groups in the environment. Since the coordination interactions are even
stronger than hydrogen bonds, magnesium plays a dominating role in determining
interactions of chlorophylls within the photosynthetic membrane.
The next class of lipid-like compounds is tocopherols. Their concentration is much
smaller than that of chlorophylls. The hydrophobic component is similar to saturated
methylated structures of phytol or fatty acid residues of Archaea . The hydrophobic part is
formed by a derivative of chromene – a heterocycle of benzene and pyrane rings. The
Rupan_c03.indd 22 8/29/2012 5:39:00 PM
The Photosynthetic Membrane: Outlook 23
hydroxyl group on benzene cycle is a functional group that can interact with free radicals
neutralizing them. Hence, tocopherols are essential membrane-associated radical
scavengers. The production of radical compounds is inevitable, particularly under various
stress conditions, in the photosynthetic membrane due to the numerous processes of redox
chemistry that are crucial for the light phase of photosynthesis (see the next paragraph).
There are several types of tocopherols ( α , β , γ and δ ). They differ by the types of residues
(methyl group or hydrogen) attached to the benzene part of chromanol.
Another functionally important class of lipid-like compounds is represented by quinones.
Their hydrophobic component is highly nonsaturated hydrocarbon structure made of
numerous isoprenoid residues. Basically, it can be seen as phytol or tocopherol tails that
acquired periodic double bonds. The presence of nonsaturated bonds within the hydrocarbon
tail of lipids normally leads to disruption in their interactions with environment and makes
Fatty acids
Chloroplylls
Tocopherols
Quinones
Xanthophylls
Detergents
C.O C16 16:1
Phytol
Plastoquinone
α-tocopherol
O O
O
O
O
HHH
H
H
O
HO
O
OH3C
CH3
H3CO
Lutein
b-D-glucoside n-octyl -β-D-glucoside
9
H
13 5
7 9 11 13 15
15′ 13′ 11′ 9′ 7′1′
5′ 3′OH
HO
O
O
b-D-glucosideRhodopin glucoside
Figure 3.4 Comparison of the structures of various lipid-related molecules.
Rupan_c03.indd 23 8/29/2012 5:39:00 PM
24 The Photosynthetic Membrane
the structure more rigid, since the rotation around a double bond is very restricted in
comparison to that of a single C—C bond. This feature of a hydrophobic quinine tail
could be a key in enabling high rates of diffusion of this molecule, the essential feature of
plastoquinone function, since it works as a shuttle carrying electrons and protons between
different electron transport components of the thylakoid membrane (see the next paragraph).
The hydrophilic part is represented by the twice methylated p-benzoquinone derivative
(Figure 3.4 ). Benzoquinone carbonyls are functional groups involved in redox reactions of
electron transport of relatively low potential that receive two electrons and two protons and
carrying them to the electron acceptor. The concentration of plastoquinones is relatively
low, only 5–10% of the total lipid content.
Finally, oxygenated carotenoids, xanthophylls, form a group of accessory to
chlorophylls pigments in the photosynthetic membrane. In higher plant membranes
they are largely symmetric, containing two polar compounds attached to opposite ends
of the hydrophobic hydrocarbon structure derivative of polyenes that are methylated in
a similar fashion to phytol, tocopherols and plastoquinones defining their terpenoid
nature. However, the key difference of this structure is that as in all polyenes they con-
tain conjugated double bonds, unlike plastoquinones. The importance of conjugation in
xanthophylls and indeed chlorophylls will be explained in detail in a later chapter. The
structure of higher plant xanthophylls is rigid and can undergo various types of trans-cis isomerization. The polar end groups of xanthophylls are various derivatives of
cyclohexene that contains hydroxyl or epoxy groups. The symmetric nature of xantho-
phylls is often central in the orientation of these molecules within the membrane. They
can span the whole membrane depth with their polar groups oriented towards hydro-
philic residues of membrane components.
Variety of xanthophylls in photosynthetic organisms of different classes is impressive.
In lower organisms as photosynthetic purple bacteria xanthophyll structure can be very
similar to the structure of mild detergents glucosides. Figure 3.4 shows structures of
n-octyl- β - D-glucoside and carotenoid from Rodopseudomonas sphaeroides , rhodopin glu-
coside. Remarkably their polar groups are represented by the same structure, β -D-glucoside
residue. Both structures are asymmetric. The ‘tails’ are different, though. Whilst the
detergent possesses short saturated hydrocarbon chain (C8), the xanthophyll contains long
conjugated structure, typical for carotenoids. This structure is more rigid than that of the
detergent or indeed saturated fatty acids. Hence, Figure 3.4 displays various types of
amphiphilic molecules that reside in the photosynthetic membrane. Combination of both,
hydrophobic and hydrophilic properties ensures their affinity and orientation within the
lipid bilayer, whilst the hydrophilic groups carry important functions. Figure 3.5 shows an
example of interactions between three key types of described photosynthetic membrane
compounds, lipid, chlorophyll and xanthophyll. All three molecules interact mainly via
van der Waals forces, bringing their hydrocarbon tails in close almost orbital contact.
Whilst the carotenoid structure is in all- trans configuration rigidly spanning the hydropho-
bic environment, chlorophyll and in particular lipid residues are more freely bend embrac-
ing each other in less linear fashion. As it will be seen later, all three are accommodated by
a most crucial component of the photosynthetic membrane, a membrane protein.
Rupan_c03.indd 24 8/29/2012 5:39:00 PM
The Photosynthetic Membrane: Outlook 25
3.2.3 Proteins and Protein Complexes
Proteins are by far one of the most versatile and dominating group of molecules in the pho-
tosynthetic membrane. Certain membranes developed under particular conditions can be
built of up to 80% or even more of protein. According to the membrane protein classification
displayed in Figure 2.5 they all belong to the group of transporters. The process of photo-
synthesis starts with the antenna that is represented by a family of light harvesting com-
plexes; proteins that bind and organize pigments, chlorophylls and carotenoids as well as
lipids. These complexes absorb photons of light, the tiniest particle in nature; convert its
energy into the energy of excited electrons that can be transported via exciton energy trans-
fer into the second group of photosynthetic membrane complexes, reaction centres. The
latter donate electrons ‘charged’ with the energy of light into the chain of redox reactions
that transport electrons and protons along and across the membrane, correspondingly.
Proton gradient energy can be used by ATPase, another transport-enzyme complex that
synthesizes ATP from ADP and phosphate. Figure 3.6 shows a sequence of particle trans-
port events that takes place in the thylakoid membrane of plants. The sheer range of particle
masses that these proteins handle can be understood by comparing the sizes in the macrow-
orld. Assuming that the photon corresponds to the size of an ant, electron would correspond
to the size of a rabbit, whilst proton would be as large as a car. The average size of a mem-
brane protein would be as big as the largest excavator (Bagger 288) or a train that weighs
more than 10 thousand tons. Hence, the membrane proteins must be built with such a preci-
sion that they can handle accurately much smaller, albeit, highly energized forms of matter,
transporting them between each other and converting its energy into the chemical energy of
primary photosynthetic products, NADPH and ATP. It is amazing that there is enough room
in the biological membrane nanoworld to accommodate structures that handle particles
with high precision that are smaller than themselves by 13 orders of magnitude!
Chlorophyll
Lipid
Xanthophyll
Figure 3.5 An example of close van der Waals interactions between a fatty acid residue of phospholipid, chlorophyll phytol tail and xanthophyll. The coordinates were taken from the structure of the LHCII complex (for details see Chapter 6). (See Plate 3.5 in colour plate section.)
Rupan_c03.indd 25 8/29/2012 5:39:00 PM
26 The Photosynthetic Membrane
Figure 3.7 displays a scheme of organization and functional interactions between
the thylakoid membrane complexes. There are basically five major photosynthetic
complexes:
1. Light harvesting antennae;
2. Photosystem II (PSII);
3. Cytochrome b6/f complex;
4. Photosystem I (PSI);
5. ATPase.
In the early days of photosynthesis research it was believed that chlorophyll was freely
located in the membrane among lipids. However, later it was shown that all chlorophyll is
attached to three major classes of membrane protein; light harvesting antenna, PSI and
PSII. Later, each photosystem was found to possess its own antenna in a form of a several
related pigment-protein complexes. Photosystem I contains at least four types of LHCI
antenna polypeptides, called Lhca1-4. Photosystem II has at least six types; Lhcb1-6.
These polypeptides form light harvesting antenna or outer antenna. They assemble into the
major, trimeric complex, LHCIIb (Lhcb1-3) and three minor monomeric complexes
LHCIIa (CP29), LHCIc (CP26) and LHCIId (CP24) (for more details see Chapters 6 and 7).
They are organized around core complexes of photosystems. These complexes are built
with a large number of subunits. The PSII core complex contains at least 23 polypeptides,
whilst complete with LHCI PSI complex contains 17 polypeptides. The subunit sizes of
photosystems vary from a few kD to 50-70 kD. Core complexes contain inner antenna
polypeptides, CP43 (PsbC) and CP47 (PsbB) in PSII and PsaA and PsaB in PSI. They carry
only one type of chlorophyll, chlorophyll a , whilst LHC complexes carry also chlorophyll b .
Once light energy is delivered to PSI and PSII by means of a resonance energy transfer, it
is passed to the reaction centre chlorophyll via their inner antenna. The inner antenna chlo-
rophyll is supposed to focus the excitation energy onto the reaction centre. The reaction
centre of photosystem II (P680) is organized as a chlorophyll dimer, the spatial pair, located
Photon
~10–33 g 1·10–27g 1.7·10–24g
Exciton Electron Proton
Light harvestingantenna
Electron transferproteins
ATPase
1 mgant
1 kgrabbit
Membrane protein: >10 Kton(train or Excavator 288)
1.7 toncar
Figure 3.6 Classes of photosynthetic transporter proteins handling various particles of matter.
Rupan_c03.indd 26 8/29/2012 5:39:01 PM
The Photosynthetic Membrane: Outlook 27
on D1 (PsbA) and D2 (PsbB) polypeptides. Upon excitation RCII is capable of donating an
electron into the electron transfer chain first to pheophytin, then to bound plastoquinone
(QA-site on D2 protein) and finally dissociable plastoquinone (QB-site on D1 protein). For
dissociation from the QB-site it requires two electrons and two protons to bind to
plastoquinone that diffuses in the membrane to be bound to the cytochrome b6/f complex.
After electron donation, P680 + is acting as a very strong oxidant (oxidation potential ~1.17 V),
capable to remove an electron from water, via the oxygen evolving complex (OEC) that is
represented by a group of three extrinsic membrane proteins, PsbO-Q. The electron transfer
in PSII is linked to a proton discharge into the thylakoid lumen in a sequence of water-
splitting reactions in OEC.
The other site of the proton release into the lumen is cytochrome b 6/ f complex. This
complex is built at least of eight proteins. Four of them play defined functions. When
doubly reduced plastoquinone binds to this complex, near to the lumen (Q-site), it gives
Terminal thylakoids
MarginStroma
NADP
2H+
2H+2H+ FNR
Fde–
e–
e–
e–
2e–
2e–
PQPQ
RC
PC
FeSRC
OEC
H2O 4H+ 2H+O2
PQH2
PQ
NADPHADP+Pi
ATP
PSII
Lumen
Lumen
LHCIIb LHCIIba,c,d
PSII Cytb6/f PSI LHCI ATPase
Figure 3.7 Complexes of the photosynthetic membrane. Energy transformation chain of the light phase of photosynthesis: photophysical, photochemical, redox chemical, coupled proton transport, synthesis (ATP) reactions. Nuclear-encoded proteins are presented in grey whilst the chloroplast genome-encoded in white. Abbreviations: RC, reaction centre, OEC, oxygen-evolving complex; e − , electron; PQ, plastoquinone; H + , proton; FeS, iron-sulfur cluster; Fd, feridoxin; FNR, feridoxin-NADP-reductase.
Rupan_c03.indd 27 8/29/2012 5:39:01 PM
28 The Photosynthetic Membrane
the first electron to the plastocyanin (PC) through the Rieske iron-sulfur protein and
cytochrome f. The second electron is passed through the cytochrome b 6 across the mem-
brane back to the stroma surface to reduce another oxidized plastoquinone. This peculiar
electron exchange, called the Q-cycle, increases the efficiency of proton translocation by
moving two additional H + for every two electrons, donated by water. Excitation of the PSI
reaction centre chlorophyll, P700, supports the continuation of the electron transfer chain
from PC to ferredoxin (Fd). From Fd, an electron can be donated either back to the
cytochrome b6/f complex, forming cyclic electron transfer to increase the amount of pro-
tons, translocated into lumen or to NADP reductase (FNR) to reduce NADP and finish the
linear electron transfer chain by forming NADPH. The accumulation of protons in lumen
leads to formation of a delta-pH across the membrane and an electrochemical potential,
which is used by ATP-synthase (ATPase) to form ATP from ADP and phosphate. ATPase
is another multisubunit complex that contains at least 20 polypeptides. In summary, of five
major types of photosynthetic membrane complexes only three carry pigments, light har-
vesting complexes, Photosystem I and Photosystem II core complexes. The structure and
functions, adaptations and assembly of these complexes will be a major focus of the chap-
ters that follow.
The reasons for grana formation, segregation of photosystems and their significance for
photosynthetic performance were always a focus of photosynthesis research. Stacked
thylakoids contain mainly photosystem II and its light harvesting antenna (LHCII) (see
also Figure 3.1 g and h). Unstacked membranes contain photosystem I with its own antenna,
LHCI, and ATPase. Cytochrome b6/f complexes tend to be located closer to the areas
where thylakoids begin to stack. Cytochrome b 6/ f and ATPase were also found in terminal
thylakoids of grana and ATPase was identified on the grana margins. To expect the high
efficiency of light energy utilization along the whole sequence of reactions one may look
for an existence of key forces or factors designed to integrate, conduct and make coherent
light absorption, excitation energy redistribution between photosystems, electron transfer
and proton translocation at conditions of special segregation between these components in
the photosynthetic membrane. It will later become evident that the central role in this
regulation is being played by the light harvesting antenna, the redox-state of the electron
transfer carriers and the delta-pH ( Δ pH) across the thylakoid membrane.
3.3 Oligomerization, Interactions and Mobility of the Photosynthetic Proteins: Enabling Functions and Adaptations
3.3.1 Oligomerization and Clustering of Photosynthetic Membrane Proteins
Although all five complexes of the photosynthetic membrane are built from relatively
light polypeptides, with the heaviest not exceeding 70 kDa (PsaA and PsaB), they them-
selves are very impressive nanoparticles. Photosystem II exists as dimer of reaction cen-
tre core complexes complemented by their own antenna complexes. Altogether they
form a stable so-called supercomplex structure of Photosytem II that can be isolated
biochemically or visualized using various electron microscopy approaches (see Chapter
Rupan_c03.indd 28 8/29/2012 5:39:01 PM
The Photosynthetic Membrane: Outlook 29
5 for details). The size of the dimeric PSII core is 430 kDa, whilst the size of the super-
complex is up to 1000 kDa and the area of ~300 nm 2 . However, PSII with full light har-
vesting complement could be almost twice larger. Full Phosystem I with its LHCI
antenna is a smaller particle with the molecular weight of about 600 kDa and area of
~200 nm 2 . Cytochrome b/f complex weighs approximately 220 kDa and has an area of
about 60 nm 2 . ATPase has molecular weight of ~400 kDa and its broadest part (CF 1 )
occupies area of ~80 nm 2 .
The reasons behind such macro-organization of the photosynthetic membrane complexes
are several. As was described earlier, the processes of photon energy transformation are
sequential and require a variety of cofactors and redox carriers organized in a particular
order that the events of light phase would flow in optimized way. At the start of the electron
transport, in PSII, a series of coordinated processes should take place including light
harvesting, focused transfer of trapped energy to the reaction centre, primary charge separation and stabilization, hence involving several electron carriers gradually remote
from the reaction centre to avoid back reaction. At the same time, the system of donation
of electrons to the PSII reaction centre that lost an electron is vitally important. This is a
number of interacting polypeptides that organize the water-splitting complex. The complex
must be associated with the reaction centre complex in order to deliver efficiently and
rhythmically electrons needed to maintain the electron transport through PSII. The RCII
electron donation-regaining cycle is called the turnover. The rate of this turnover is
important parameter that determines the productivity of the whole light phase of
photosynthesis. Naturally, the frequency of electron production from reaction centres will
determine the rate of NADP + reduction and proton translocation across the membrane
that will be used for ATP synthesis. PSII turnover rate is variable, depending on the
structural, environmental and metabolic factors. Maximum rate can be as high as 100
cycles per second, that is, 10 ms per cycle of electron removal from RCII and its re-reduction
by the donor side. The integration of light harvesting antenna within the PSII complex is
as important as its donor and acceptor side structures, since the antenna should supply and
as will emerge later regulate the photon energy supply to the reaction centre in a
sophisticated well-controlled manner. The latter is very important in order to maintain the
RCII in the optimal ‘working regime’, so to speak, its ‘rpm’ is within the reasonable safe
boundaries. Similar considerations apply to PSI.
The cytochrome b/f complex deals only with electrons and protons and ATPase with
protons and ADP, phosphate and ATP. Reduction and oxidation of plastoquinones, reduction
of mobile electron carrier plastocyanine in cytochrome b 6/ f complex are specially sepa-
rated processes that reside on different subunits. For ATPase a complex of proteins is
required to build the proton pumping engine, converting the gradient energy into the con-
formational energy of its subunits bringing ADP and phosphate together to form a high
energy phosphate bond of ATP. Only a multisubunit structure can carry such a task. Again,
the tight coordinated binding of polypeptides within these complexes is central for preci-
sion and directionality of carried reactions.
In supercomplexes of proteins, entropy is reduced and thermal energy can be utilized in a
more directional fashion to support and control reactions of the photon energy transformation.
Rupan_c03.indd 29 8/29/2012 5:39:02 PM
30 The Photosynthetic Membrane
Hence, the protein environment can direct functions of various cofactors that are actually
involved in these processes. Summarizing the role of macrostructural organization of photo-
synthetic membrane complexes it is important to conclude that the key advantages of such
structure are:
a. lowering entropy;
b. binding and stabilizing the cofactors;
c. requirement for concerted and precize performance of the energy transformation reactions;
d. multifunctional performance of superstructures; and
e. fulfilment of the regulation requirement.
3.3.2 Protein Mobility
The photosynthetic membrane is a dynamic structure. The lipid phase is laterally mobile
despite of very high protein content. The five major photosynthetic membrane complexes
are not entirely stationary either. Figure 3.8 shows the results of the experiment which was
based on the bleaching of the probe fluorescence and observation of recovery (fluorescence
recovery after photobleaching, FRAP, see the next chapter for details). The bleaching is not
reversible, that can easily be tested on frozen or fixed with glutaraldehyde membranes. The
reason why fluorescence recovers is due to the lateral mobility of molecules of the probe.
In case of lipids, BODIPY (boron-dipyrromethene) probe has been used. This probe is
soluble in the lipid phase and therefore its diffusion is comparable with the diffusion rate
of lipids, that is indicative of how fluid the membrane is. As can be seen from the figure
mobility of BODIPY is rapid, takes place within seconds. It is important that even though
the membrane is crowded with proteins its lipid phase still remains very mobile. For the
photosynthetic membrane it is crucial, since the three of its complexes, PSII, Cyt b/f and
00 2 4 6 8 10
0
5
10
% recovery of protein%
rec
over
y of
lipi
d
15
20
25
50
75
100
125
Protein
Time, min
Lipid
Figure 3.8 Mobility of lipids and proteins in the photosynthetic membrane probed by the Fluorescence Recovery After Photobleaching (FRAP) method (for details see Chapter 4). Reproduced with permission from Johnson et al . © 2011 The American Society of Plant Biologists.
Rupan_c03.indd 30 8/29/2012 5:39:02 PM
The Photosynthetic Membrane: Outlook 31
PSI have to be connected to support the electron transport. PSII must be able to donate
electrons into the Cyt b/f complex. Plastoquinones are these freely diffusible transporters
in the photosynthetic membrane that maintain noncyclic as well as cyclic electron transport.
Plastoquinone diffusion rate is often a limiting step, a ‘bottleneck’ of the electron transport,
since, as was discussed earlier electron transport reactions which take place on the
complexes of photosystems and Cyt b/f complex are not limited by diffusion but occur
between cofactors rigidly positioned close to each other within those complexes. Proteins
in the photosynthetic membrane display much slower mobility. For example, Photosystem
II and LHCII antenna chlorophylls can be used as natural, intrinsic fluorescence probe in
the FRAP experiment (see Figure 3.8 ). It takes minutes for the fluorescence to recover.
Unlike in the case of BODIPY, the recovery is largely incomplete, meaning that some
components of PSII and LHCII are mobile within much slower time scale then 10 min or
not mobile at all. The protein concentration and associations into large oligomeric clusters
is likely to cause this. Examples of mobility of PSII and clustering of LHCII antenna will
be discussed in details a later chapter dealing with adaptations (Chapter 9). Indeed, protein
mobility in the photosynthetic membrane is essential not only for its functions but to enable
repair and replacement of proteins and their complexes essential for more long-term
changes involved in pant acclimation.
Lateral heterogeneity of the photosynthetic membrane is yet another feature that
illustrates that membrane is dynamic and the complexes are mobile. As shown in Figure 3.7 ,
PSII and LHCII antenna prefer grana stacks whilst PSI is located mainly in stromal,
unstacked thylakoids. It is simply impossible for ATPase, for example, to be localized in
the stacked grana regions simply because of the large structure of CF 1 component protruding
into the stroma. Such lateral redistribution is a process governed by charges on Photosystem
II and LHCII proteins. Indeed, as was mentioned above, magnesium and potassium cations
can compensate for the negative charges of stroma-exposed aminoacids of these complexes.
As a result, thermodynamically-driven regrouping of complexes would take place allowing
them to interact with each other as well as with the complexes positioned on different
thylakoids forming grana stacks. This is a well-reversible event in which LHCII is
particularly involved, since it is by far the major membrane complex accounting up to 50%
and even more of total photosynthetic membrane protein. It is important to point out that
the concentration of cations in stroma is a vital factor that controls grana formation.
Therefore, the metabolic homeostasis of stroma can be central in governing structure of
photosynthetic membranes and interactions between its complexes in vivo revealing the
way of regulation of the primary photosynthetic events by the chloroplast.
We have learned some basic principles of design of the photosynthetic membrane and
its proteins. It seems that the arrangement in two dimensions, on the surface, formation
of robust oligomeric states, crowdedness and interactions with lipids and essential
lipid-like molecules are important features that increase order, efficiency and enables
adaptations, hence flexibility of the membrane proteins. Therefore, the structural fea-
tures of the photosynthetic membrane allow running efficiently its multiple functions in
energy conversion, a remarkable example of vector chemistry that is typical for the
biological system.
Rupan_c03.indd 31 8/29/2012 5:39:02 PM
32 The Photosynthetic Membrane
Reference
Johnson , M.P. , Goral , C.D.P. , Duffy , T.K. , et al . ( 2011 ) Photoprotective energy dissipation involves the reorganization of photosystem II light harvesting complexes in the grana membranes of higher plant chloroplasts . Plant Cell , 23 , 1468 – 1479 .
Bibliography
Anderson , J.M. , Chow , W.S. and Goodchild , D.J. ( 1988 ) Thylakoid membrane organisation in sun/shade acclimation . Australian Journal of Plant Physiology , 15 , 11 – 26 .
Barber , J. ( 1982 ) Influence of surface charges on thylakoid structure and function . Ann. Rev. Plant Physiol. , 33 , 261 – 295 .
Blankenship , R. ( 2002 ) Molecular Mechanisms of Photosynthesis . London : Blackwell Science . Clayton , R.K. ( 1980 ) Photosynthesis. Physical Mechanisms and Chemical Patterns . Cambridge :
Cambridge University Press . Dekker , J.P. and Boekema , E.J. ( 2005 ) Supramolecular organization of thylakoid membrane proteins
in green plants , Biochim. Biophys. Acta , 1706 , 12 – 39 . Hall , D.O. and Rao , K.K. ( 1995 ) Photosynthesis . Cambridge : Cambridge University Press . Hankamer , B. , Nield , J. , Zheleva , D. , et al . ( 1997 ) Isolation and biochemical characterisation of
monomeric and dimeric PSI1 complexes from spinach and their relevance to the organisation of photosystem II in vivo . Eur. J. Biochem ., 243 , 422 – 429 .
Heldt , H.-W. ( 2005 ) Plant Biochemistry . Burlington : Elsevier Academic Press . Walker , D. ( 1992 ) Energy, Plant, Man . Brighton : Oxygraphics .
Rupan_c03.indd 32 8/29/2012 5:39:02 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
‘ By three methods we may learn wisdom: first, by reflection, which is noblest; second, by imitation, which is easiest; and third by experience, which is the bitterest .’
Confucius
There are far too many methods and approaches used in the research of the photosynthetic
membrane that we could cover in this book, or even several books. Here we aim to discuss the
major classes of the most popular methods that have been successfully applied in studies of the
photosynthetic membrane for a long time. All these can arbitrarily be divided into three groups:
1. Methods to analyse and manipulate composition of membrane components (biochemis-
try and molecular biology);
2. Methods to visualize membrane structures (structural biology);
3. Methods that study various functions of the photosynthetic membrane (analytical
approaches).
4.1 Biochemistry and Molecular Biology Approaches
4.1.1 Isolation of Chloroplasts and Subchloroplast Particles
Majority of biochemical approaches start from isolation of chloroplasts from leaves
(Figure 4.1 ). One of the challenges is to prepare intact chloroplasts that possess an
Popular Methods and Approaches to Study Composition, Structure
and Functions of the Photosynthetic Membrane
4
Rupan_c04.indd 33 8/29/2012 5:38:18 PM
34 The Photosynthetic Membrane
unruptured envelope. Pioneering work of Robert Hill and later David Walker enabled
isolation of chloroplasts that were able to evolve oxygen and fix CO 2 to almost the same
rate as intact leaves. The advantage of using chloroplasts instead of leaves is that it is
easy to manipulate their functions with various inhibitors, uncouplers and cofactors that
can be added into the incubation cell. In addition the cell can be equipped with various
probes to test light harvesting, electron transfer and oxygen evolution functions (see
Section 4.3). The key factor in the preparation is time – the procedure must be per-
formed as quickly as possible. All is carried out at +4°C. Leaves are first ground within
a few seconds with a powerful blender, the homogenate filtered and centrifuged for less
than 1 min to pellet debris and then the second centrifugation step (~3000 g) is per-
formed through a density media, percoll, to separate more dense intact chloroplasts
from less dense broken chloroplasts and other components. Intact chloroplasts will
LeavesChloroplasts
Membranes
LHCII
Separated complexes
LHCIIb
LHCIIdLHCIIcLHCIIa
0.4
pH
4.2
4.6
0.7
Sucrose,M
PSII
PSI
Membrane fragments andsolubilised complexes
Grinding ¢rifugation
Osmotic shock ¢rifugation
+ Detergent ¢rifugation
Ultracentrifugation onsucrose gradient
Isoelectric focusing(IEF)
Figure 4.1 Basic steps of isolation of the photosynthetic membrane complexes. (See Plate 4.1 in colour plate section.)
Rupan_c04.indd 34 8/29/2012 5:38:19 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 35
appear as a pellet, which after washing and resuspending can be promptly used for
experiments. Good chloroplast prep from spinach can retain functions for up to 12 h,
sometimes even more.
The yield of intact chloroplasts is normally relatively low, therefore in order to get
more material for various functional and biochemical experiments a slightly different
procedure is used. It incorporates osmotic shock to break all chloroplasts and the second
centrifugation cycle time and rate are increased in order to pellet more ‘green’ material:
thylakoids. Naturally, the density media, percoll, is not required here. Thylakoids has
been a popular initial material for various biochemical preparations of the photosynthetic
membrane components. First, it aimed to isolate membranes enriched in photosystem
I or II, using the fact that they are located in spatially-separated thylakoids domains,
stroma and grana membranes, respectively. Jan Anderson first developed the procedure
that used detergent digitonin to gently remove stromal thylakoids from grana and sepa-
rate those by using several steps of ultracentrifugation, with a range of centrifugation
forces varying from 20 000 to 144 000 g. At lower speed larger particles, grana, are being
pelleted, whilst at the top rate, light membrane fragments, containing photosystem I will
be sedimented. The advantage of this procedure is that photosystems are embedded into
their natural environment, the thylakoid membrane. The disadvantage is that their sepa-
ration is not absolute. Grana fragments, in particular, were found to be contaminated
with photosystem I.
4.1.2 Isolation of Membrane Protein Complexes
In order to get better purification of photosystem II without compromising its functions, in
particular oxygen evolution Berthold, Babcock and Yocum ( 1981 ) developed widely used
procedure of preparation of so-called BBY particles. The procedure is based on isolation of
thylakoids, their incubation in the stacking medium to ensure maximum grana stacking
followed by treatment with non-ionic detergent Triton X100 on ice and subsequent cycles
of washing and centrifugation at ~30 000 g. As a result, membrane fragments containing
highly active photosystem II can be obtained with high yield.
Photosystem I digitonin particles contain significantly pure photosystem. However, fur-
ther isolation can be obtained by either solubilization of thylakoids of PSI fragments
by non-ionic detergents like n-dodecyl-β-D-maltoside or n-octyl-β-D-glucoside (see
Figure 3.4). Solubilized material can be applied to sucrose gradient of 0.2–1M and centri-
fuged overnight at 200 000 g. Photosystem I is a relatively stable complex and will appear
as a dense band at approx. 0.7 M of sucrose. In case of the solubilization of the whole thy-
lakoids, it is preferred to use unstacked membranes by incubation in the medium free from
cations (see Chapter 3). In this way not only photosystem I but photosystem II complexes
could be isolated on the sucrose gradient (Figure 4.1 ). All the LHCII antenna is completely
separated from photosystem II and the latter is represented as a reaction centre core dimer,
containing inner antenna complexes, CP43 and CP47. Solubilized thylakoid membranes of
membrane fragments could be also separated by gel filtration using, for example, Superdex
200 column (GE Healthcare) on a FPLC (Fast Protein Liquid Chromatography) system.
Gel filtration uses the principle of selection by molecular sizes. In fact it is filtration ‘in
Rupan_c04.indd 35 8/29/2012 5:38:20 PM
36 The Photosynthetic Membrane
reverse’, since the fastest migrating are large particles and the slowest are small ones. The
advantage of this separation is that PSII supercomplexes and even PSII membrane frag-
ments containing highly ordered arrays of supercomplexes can be isolated. For this it is
required to use stacked thylakoids. Apparently magnesium is important not only for
stacking and segregation of photosystems but also to a full assembly of PSII with the
light harvesting antenna. Another way to prepare complexes of photosystems is to use
anion exchange chromatography. Here nonionic detergents must also be used. A linear
gradient of MgSO 4 is applied (5–25 mM) to run the separation of the DEAE
(Diethylaminoethyl cellulose) column. Molecular charges here are the key property that the
separation procedure is based upon.
An effective method that can be used to prepare various components of photosystems,
particularly antenna complexes, in their native state is isoelectric focusing ( IEF) (see
Figure 4.1 ). The principle of the method is based upon isoelectric point, pI. The soft IEF
gel contains ampholines. They are mixtures of amphoteric electrolytes or buffers that pro-
vide a continuous range of pH in an electric field. Proteins migrate in the field until their
charge is totally compensated at pH = pI. After that they stop migrating and narrow bands
of homogenous complexes can be visualized either by their green colour – all chlorophyll
binding proteins – or by using staining media in case of nonchlorophyll binding proteins.
For IEF it takes an overnight run and bands can be collected by spatula (since the IEF gel
is slurry) and eluted using special elution columns. This method proved to be effective,
preparative and of a high resolution (<0.1 pH units). Often to prepare photosystem com-
plexes of high purity a combination of isolation procedures is used. IEF often is followed
by additional purification step on the sucrose gradient, gel filtration or ion exchange chro-
matography. Naturally, the more purification steps are applied the lower the yield of
undamaged complexes.
An analytical way to separate thylakoid membrane complexes is to run nondenaturing
polyacrylamide gel (PAAG) electrophoresis. Sodium dodecyl sulfate (SDS), cholate or
n-dodecyl-β-D-maltoside were used for this method. It provides with relatively rapid (a
few hours) way to separate and analyse PSI, PSII and LHCII complexes and sometimes
called green electrophoresis, that was pioneered in Philip Thornber’s and Jan Anderson’s
laboratories. The disadvantage of this method is that the amounts of isolated complexes are
small and therefore it is hard to use them for further characterization work. Another disad-
vantage is that the gel media, polyacrylamide, and ionic detergents, SDS and cholate, often
affect the intactness of separated complexes stripping lipids and pigments from them.
Whilst photosystem II is relatively easy to disassemble with non-ionic detergents into
separate polypeptides, photosystem I is proved to be more resilient for such treatment.
Therefore, stronger nonionic detergents like Triton X100 or ionic detergents have to be
applied. Among the latter are SDS, cholate or zwitterionic detergents, that carry a positive
and a negative electrical charges at different locations within their molecule. Hence, for some
reason, PSI is a more robust structure then PSII. Non-pigmented complexes, like cytochrome
b6/f, plastocyanin and components of ATPase can also be prepared similarly to the three
‘green’ complexes typically using centrifugation and ion exchange chromatography.
Rupan_c04.indd 36 8/29/2012 5:38:20 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 37
After the complexes of the thylakoid membrane are prepared, their polypeptide compo-
sition is normally analysed by classical SDS PAAG denaturing electrophoresis. For this
method procedures of removal of pigments and lipids are normally employed using organic
solvents like chloroform and ethanol, and proteins are broken into separate polypeptides
and undergo denaturing by special agents such as urea (used in molar concentrations) along
with a high temperature before running on a gel electrophoresis system. The polypeptides
molecular weight is estimated using standards: proteins of known molecular mass. However,
for certainty, the identity of proteins is estimated using Western blot procedure that is based
upon application of antibodies specific for polypeptides under analysis. Furthermore, in
some cases, the polypeptides of interest could be extracted from gel and subjected to
sequencing procedures for ultimate protein identification.
4.1.3 Analysis of Lipids and Pigments
Photosynthetic complexes ligands, lipids and pigments, can be analysed using various
chromatographic techniques, most notably analytical HPLC or high performance liquid
chromatography combined with the UV-Vis absorption detection. The introduction of
diode array detection enabled parallel collection of pigment spectra which greatly aids
quantification and localization of unknown compounds. Coupling HPLC with the mass-
spectrometer significantly enhances the system sensitivity and analysis of structural iso-
mers. The optical spectroscopic analysis of pigments is based on the fact that they normally
have specific absorption spectra. Chlorophylls and carotenoids of the photosynthetic mem-
brane can be first extracted from it with organic solvents (most typically acetone). Different
affinities of pigments to the column medium, determined by their hydrophobicity, is a key
factor that governs mobility of their molecules through the column or retention time in
often used reversed phase HPLC. There, the more polar pigments are eluted first, with the
shortest retention time; the more hydrophobic molecules will be eluted later since their
mobility will be reduced by their stronger tendency to interact with the column. A mix of
several solvents is usually used to gradually alter the mobile medium polarity (acetonitrile,
methanol, hexane) in order to achieve maximum resolution of individual pigments on col-
umn. Figure 4.2 displays a typical HPLC profile of all thylakoid membrane pigments. Each
pigment band corresponds to its maximum in absorption spectrum. The more oxygenated
and polar xanthophylls like neoxanthin and violaxanthin elute much faster than the less
polar lutein and zeaxanthin. In spite of the identical molecular mass, the latter two have
slightly different mobility because of configuration differences in the end-group orienta-
tion leading to the differences in the molecular polarity (will be explained in further chap-
ters). Isomerization of xanthophylls or partial chemical modification (oxidation) also alters
their mobility and is normally a sign of sample degradation induced by exposure to high
temperature, light, oxygen or chemical agents (for example, acids). The most hydrophobic
and less mobile is β-carotene, a true carotenoid that possesses no polar groups at all. The
HLPC system is normally calibrated using pigments of known concentration. This enables
to accurately quantify the molar amount of each pigments per leaf area, and so on. When
preparative amounts of pure pigments are required, thin layer chromatography (TLC) can
be used. This method does not require specialized equipment like HPLC, is relatively
Rupan_c04.indd 37 8/29/2012 5:38:20 PM
38 The Photosynthetic Membrane
simple and inexpensive. It is often used to separate thylakoid membrane lipids, extracted
from chloroplasts using methanol/chloroform phase separation procedure. Since lipids do
not possess colour, their visualization on TLC plates is enabled using reagents like primu-
lin in combination with UV light illumination.
4.1.4 Protein Expression and Reconstitution In Vitro
The natural ability of proteins to refold under certain conditions from denatured state to
nearly native structure is utilized for production of large quantities of pure membrane
complexes, like LHCII, for example (Figure 4.3 ). Another advantage of using recombi-
nant proteins is that the point mutations can be easily introduced in order to probe func-
tions of particular aminoacids or even protein domains; for example, those involved in
cofactor binding, and so on. This procedure starts from expression of Lhcb genes of
LHCII apoprotein in E. coli : a popular bacterial model in molecular genetics. Expressed
protein is deposited in bacterial cell into the inclusion bodies. The latter are dissolved
using the buffer containing a strong ionic detergent lithium dodecylsulfate (LDS) and
eventually mixed with the pigment ethanolic extract at room temperature. The ionic deter-
gent is gradually replaced by milder, nonionic detergent, octylglucoside. After several
freeze-thaw cycles reconstituted complexes are separated from free pigments and proteins
Lut
0.035
0.030
0.025
0.020
0.015
Abs
orpt
ion,
rel
.
0.010
0.005
0.000
2.87
0
4.37
0
5.80
3
8.77
0
20.1
0320
.603
4.83
7
20.8
70
24.6
03
18.9
03
8.00
3
3.87
0
11.1
37
Neo
Vio
Zea
10.00
Time, minutes
20.00
Ant
Chl b
Chl a
β Car
Figure 4.2 HPLC analysis of the thylakoid membrane pigments. Neo, neoxanthin; Vio, violaxanthin; Ant, antheraxanthin; Lut, lutein; Zea, zeaxanthin; Chl b and a, chlorophylls b and a; b Car, b-carotene.
Rupan_c04.indd 38 8/29/2012 5:38:20 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 39
using centrifugation. In case of LHCII that exists in trimeric form His-tagged protein is
used to enable immobilization onto a Ni-chelating column. There, the lipid, phosphatidyl-
glycerol, essential for trimerization is applied following release of LHCII from the column
with imidazol-containing buffer. Trimeric LHCII is separate from monomers using the
sucrose gradient centrifugation procedure described in Section 4.1.2 . The procedure can
yield a complex that is virtually identical to the isolated purified LHCII using IEF with
subsequent centrifugation or gel filtration. The intactness can be promptly tested using
absorption and circular dichroism spectroscopies (see Chapter 8 ).
4.1.5 Reconstitution of Membrane Proteins in Liposomes
Since the bilayer lipid membrane is a natural environment of the membrane protein it is
important to be able to incorporate isolated or reconstituted protein complexes into
liposomes: artificial membrane vesicles. Purified thylakoid lipids at composition and ratios
close to those of the native photosynthetic membrane (see Chapter 3) dissolved in chloro-
form are normally used for the procedure. The extract is dried under nitrogen to a thin film
in the reconstitution tube. Then a certain amount of buffer is added and the tube is sonicated
to form liposomes. A purified membrane complex, for example LHCII, is added to the
Plasmidmutagenesis
Expression vector:
pET-32b(5900bp)
E. colitransformation
Apoprotein
Pigments
Freeze-thaw
Reconstitutedcomplexes
Figure 4.3 Light harvesting protein expression and reconstitution with pigments. (Courtesy of Erica Belgio.)
Rupan_c04.indd 39 8/29/2012 5:38:20 PM
40 The Photosynthetic Membrane
liposomes and mixed at certain protein/lipid ratio. Detergent needs to be removed by dialy-
sis or other relevant procedure followed by freeze and thaw cycles to induce formation of
the proteoliposomes that contain incorporated complexes. The latter are separated from the
rest by centrifugation on a ficoll gradient (a density medium used to separate cell orga-
nelles, etc.). The green band close to the top of gradient contains incorporated LHCII com-
plex that can be collected and concentrated using ultracentrifugation.
4.1.6 Mutagenesis and Transgenic Manipulations
Identification and expression of genes that encode various polypeptides as well as enzymes
engaged in biosynthesis of pigments, lipids and related photosynthetic membrane com-
pounds have become a popular pool of approaches aimed at identifying their functions in
the chain of energy transformation of primary photosynthesis. The traditional ‘forward
genetics’ approach is based upon the generation of mutations in a very large number of
seeds using radiation (neutron bombardment) or chemical agents like ethyl methanesul-
fonate, dimethyl sulfate or diethyl sulfate that modify DNA nucleotides. In many cases
mutations are not lethal and phenotypes can be screened in order to relate the lack of func-
tion to a modified/missing protein and identify a gene. Genetic mapping is done using PCR
(polymerase chain reaction), cDNA hybridization, sequencing and map-based cloning
tools. It is often possible to reach the saturation state, when all genes can be potentially
mutated in order to reveal a phenotype of interest. Whilst the traditional mutagenesis
begins with making mutants, the more recent approach, called ‘reverse genetics’ is based
on manipulation of a gene of interest in order to reveal a protein and function. This
approach is more incisive than ‘forward genetics’ since it allows the analyses of families
of genes with often redundant functions and performing combinations of mutations of
interest. One approach is based on the method of cosuppression (antisense) that introduces
RNA fragments that bind to mRNA blocking the translation process. However, the most
reliable and popular way to manipulate genes is based on T-DNA insertional mutagenesis.
It is based upon insertion of foreign DNA into the plant genome, hence a manipulation on
the transcription level. In Arabidopsis T-DNA of 5−25 kilobases can induce a significant
sometimes absolute and sustained gene disruption in almost all genes ( knock-out : KO).
Particular mutations can be identified using PCR. Both antisense and T-DNA manipula-
tions require application of the transformation procedure that uses Agrobacterium tumefa-ciens as a carrier of foreign gene constructs. This is a natural transformation model that
infects plant tissues and transfers a tumour-inducing (Ti) plasmid into the cell for integra-
tion into the nuclear genome and expression of bacterial genes that induce formation of
tumours in plant. For insertion mutagenesis, the T-DNA along with the genetic marker (for
example, kanamycin-resistance gene) is introduced into Ti plasmid replacing bacterial
genes using E.coli plasmid. The produced Agrobacterium strain is introduced into plant
using root or leaf dipping or vacuum infiltration techniques that deliver the bacterium into
plant tissues. A random way of T-DNA insertion into the plant genome as well as easily
identifiable tagging made it a very popular genetic approach of ‘reversed genetics’. On the
other hand, transformation system using Agrobacterium can also be used to ‘restore’ muta-
tions by supplementing plant with ‘working’ genes that have been corrupt by mutagenesis
Rupan_c04.indd 40 8/29/2012 5:38:21 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 41
or manipulations. This method is useful not only to study gene functions but also to intro-
duce point-mutations in order to reveal the role of specific aminoacids in the produced
protein structure and functions in vivo .
Genetic manipulations described previously applied to photosystem I and II compo-
nents, pigments and proteins, significantly advanced and continue to further our knowledge
on their structure, functions in light harvesting, photoprotection and electron transport (see
the following chapters).
4.2 Visualization Techniques
4.2.1 Optical Microscopy
Optical microscopy was one of the first techniques that opened up a microworld of biology
and triggered great developments in microbiological sciences. It used light and a system of
optical lenses, that enabled the magnification of images of cells and their compartments
(see Figure 3.1c). It can work in light transmission as well as reflection modes. Figure 3.1(c)
shows an image of isolated chloroplasts with just visible dots of granae that are about
400 nm long and 300 nm thick. The image was taking with the highest aperture enabled by
application of emersion oil possessing high refraction index to increase the observation
angle. The resolution of optical microscopy is defined as:
,
2*d
NA
λ=
(4.1)
where d is resolution in nanometres; λ is the average wavelength of light used in micro-
scope (often 500 nm) and NA – numerical aperture ( NA = n sin( q ) ), where n is a medium
refraction index and q is one-half of the observation angle. In case of application of emer-
sion oil numerical amplitude is about 1.5. Therefore the maximum resolution at these con-
ditions can be less than 200 nm. Hence the granum size is at the limit of the conventional
optical microscopy resolution. Use of light with shorter wavelength or recently employed
lenses made of gallium phosphide enabling a nanosized focus enable to resolve objects the
size of ~100 nm.
Another way to increase optical resolution is to use fluorescence microscopy that is
based on observation of fluorescence light induced by laser and emitted from various
components of sample. Most common is confocal fluorescence microscopy, based upon
the use of very narrow illumination and eliminates the light which is not in focus and
undermines resolution. This microscopy just detects light from the parts of sample very
near the focal plane, ignoring the rest. Another advantage of the method is that specific
cell components can be visualized using fluorescence dyes or natural fluorescing (auto-
fluorescence) components. Figure 3.1(b) and Figure 3.2 display confocal images of leaf
cells that contain chloroplasts (in red). Here, the natural chlorophyll fluorescence was
used to produce an image. No other components of the cell are visualized, producing a
Rupan_c04.indd 41 8/29/2012 5:38:21 PM
42 The Photosynthetic Membrane
clear unobstructed view of the chloroplast redistribution and even grana density in the
plant cell. Advanced fluorescence laser microscopies such as stimulated emission deple-
tion (STED) and total internal reflection (TIRF), have been employed recently to break the
optical resolution limit. STED uses the confocal scanning laser microscope with the sup-
plemental ‘fluorescence damping’ laser light to quickly switch-off the dye fluorescence
coming from the periphery of the excitation beam in order to narrow it to up to 10 nm
diameter, hence to decrease the optical resolution to this value. In TIRF microscope a very
thin layer of sample (~100 nm) is excited by the evanescent wave generated in a process
of reflection of a laser beam within the cover slip holding the sample, thus eliminating the
background fluorescence and enhancing the aperture. This technique is used not only for
studies of cell structure but also in research on single proteins immobilized in vitro (see
the following chapters).
4.2.1.1 Fluorescence Recovery After Photobleaching (FRAP)
Fluorescence Recovery After Photobleaching ( FRAP) is a popular method that uses confo-
cal laser scanning microscopy in order to study diffusion of membrane components, hence
dynamical aspect related to function. Chloroplast granae can be visualized by this method
(see Figures 3.1b and 3.2). Special buffers are used to immobilize isolated chloroplasts
onto a flat surface of a sample chamber. A gas laser line, often 488.0 nm, argon is used to
excite chlorophyll or external fluorescence dye (BODIPY) fluorescence. A set of filters is
used to define desired fluorescence spectral range. The same laser beam but much higher
intensity (a few orders of magnitude higher then scanning light) is briefly (a few seconds)
used to permanently bleach fluorescing molecules in one spot (one granum, for example)
following by reversing to the low intensity scanning mode to measure recovery of the fluo-
rescence of a beached area due to diffusion into it fluorescing molecules from the
unbleached thylakoid membranes. Low temperature or, indeed, cross-linkers will inhibit
membrane dynamics and therefore the bleach generated by FRAP technique will never be
restored. However, at ambient conditions it is possible to observe very rapid and complete
recovery of the lipid diffusion probe, BODIPY and partial, slower recovery of chlorophyll
fluorescence that belongs to photosystem and light harvesting complexes (Figure 3.8).
Obtained recovery kinetic data can be analysed in order to obtain diffusion coefficients for
lipids as well as pigment protein complexes in the photosynthetic membrane.
4.2.2 Electron Microscopy (EM)
4.2.2.1 Negative Staining EM
Electron microscopy (EM) is a high resolution method that uses electron instead of light
beam to study on the nanoscale level of cell structures including the photosynthetic mem-
brane. The high resolution of this type of spectroscopy is due to a very small wavelength
(<<1 Å) of fast moving electrons accelerated by high voltage in EM. The transmission
mode of EM is based upon the fact that electrons well penetrate the thin layers of biologi-
cal samples missing most of light nuclei of the major elements life matter is made of
(H, C, O, N) hence leaving little for the picture contrast. Therefore, the biological samples
Rupan_c04.indd 42 8/29/2012 5:38:21 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 43
are often stained with salts of heavy metals, such as uranium (uranyl formate/uranyl ace-
tate). This approach is called negative staining procedure because the water-soluble stain
penetrates only hydrophilic regions of the membrane and its components, leaving hydro-
phobic ones unstained and therefore transparent for electrons. The whole photosynthetic
membrane can be visualized using thin section preparation method that includes fixation
by cross-linkers and incorporation of leaf/chloroplasts into the epoxy resin-based medium
followed by preparation of thin (100–200 nm) sections containing the fixed material using
a special knife, a microtome. Figure 3.1(f) shows an EM image of grana and stroma mem-
branes. The dark areas trace hydrophilic surfaces of membranes, where the stain was
deposited. Geometry of granum, number of thylakoids and their thickness can be estimated
from the image. In order to visualize individual photosynthetic membrane complexes, a
further preparation is required, often using detergent solubilization and FPLC technique to
isolate individual membrane fragments or protein complexes. Figure 4.4 (left) shows a
large grana thylakoid membrane fragment containing numerous PSII complexes.
Hydrophobic cores are seen as unstained rhomboid particles aligned in rows. A few loose
PSII particles are visible too. The resolution of this technique is not better than 2 nm, there-
fore the elements of PSII structure are poorly defined. To enhance it special image-process-
ing software is used to sort particles into different classes, align them and by summing up
the images within each class to reduce the level of noise. This process enhances the resolu-
tion up to five times. The topographic image on the right of the Figure 4.4 is a result of the
sum of thousands of images of PSII. The lightly stained dual core complex is positioned in
the centre of the particle that also contains four trimeric LHCII and all minor LHC antenna
complexes (details of this structure will be discussed in the following chapters).
Figure 4.4 Negative stain electron microscopy of the photosystem II membrane fragment isolated from Spinach thylakoids (left). Vertical arrows indicate the rows of PSII core complexes. Horizontal arrow indicates a single PSII particle. Bar is 50 nm. A single dimeric PSII core complex with attached two pairs of trimers and minor LHC complexes is presented on the right. Bar is 5 nm. Image on the right is provided courtesy of Egbert Boekema.
Rupan_c04.indd 43 8/29/2012 5:38:21 PM
44 The Photosynthetic Membrane
4.2.2.2 Freeze-Fracture EM (FFEM)
Freeze-fracture (also known as freeze-etch) is an electron microscopy technique that uses
a specific method of sample preparation that is especially valid for examining biological
membranes, including the photosynthetic membranes of chloroplasts. The fresh protoplast
preparation (chloroplast or thyalkoid) has to be frozen rapidly (cryofixation) in special
sample holders first. The next step is to fracture the sample by breaking or using a special
knife (microtome) under liquid nitrogen or somewhat higher temperature. The frozen frac-
tured surface needs to be shadowed to enable contrast with evaporated heavy atoms of
platinum or gold at ~45° angle in vacuum followed by coating with carbon (evaporated
perpendicular to the average surface plane). This stabilizes the replica coating. A very frag-
ile heavy metal replica is removed from the sample at room temperature, usually by wash-
ing with detergent or strong alkaline solution (bleach) before application onto a fine grid
and viewing in transmission electron microscope. FFEM is most suitable for membrane
studies because the method very often splits membranes in half, thus revealing both of
internal membrane faces (Figure 4.5 ). The freeze-fracture technique splits the hydrophobic
core of the membrane bilayer into the exoplasmic and protoplasmic leaflets, allowing
information on the organization and dimensions of the proteins therein to be determined by
image analysis. The occurrence of such split can be explained by the fact the forces that
hold two lipid layers together (van der Waals) are the weakest forces in the cell (see Chapter
1). In a frozen state, the liquid phase is solidified by establishment of rigid water structures
with participation of the network of strong hydrogen bonds. Therefore it is easier to split
the membrane in half then remove it intact from the ice within the cell or chloroplast. In the
early 1970s membrane proteins were first identified in the FFEM images that allowed Singer
and Nicolson to propose their fluid-mosaic model of the biological membrane (Singer and
Nicolson, 1972 ). Figure 4.5 shows the diagram displaying positions of various membrane
proteins, some integral spanning some non-spanning as well as holes on an opposite half of
the membrane made by spanning proteins. Figures 3.1(g) and (h) and Figure 3.7 show typical
freeze-fracture images of grana membranes that accommodate PSII (EFs or exoplasm-facing
stacked membrane surface) and LHCII (PFs or protoplasm-facing stacked membrane surface)
complexes. The protoplasmic fracture face of the unstacked membranes (PFu) is
distinguished on the basis of its slightly larger asymmetric PSI particles. The complementary
E-Face
P-FaceFracture plane
Membrane proteins
Figure 4.5 The principles of sample preparation for freeze-fracture electron microscopy. E- and P-faces are the exoplasm (space outside of an organelle) and protoplasm (space insight an organelle) facing surfaces of the split membrane.
Rupan_c04.indd 44 8/29/2012 5:38:22 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 45
exoplasmic fracture face of the unstacked membranes (EFu) is largely smooth and marked
by generally more widely spaced (low concentration) PSII particles. An example of analy-
sis of multiple protein particles is displayed in Figure 4.6 . Special image-analysing soft-
ware automatically identifies proteins, determines distances between them, highlights
protein clusters, and so on. The resolution of FFEM is not as high as the EM that uses
negative staining procedure, only ~5 nm. This is largely determined by the fact that not the
sample but its heavy metal replica that is being studied. The thickness of the replica masks
fine features of the membrane proteins leading to the decrease in resolution.
4.2.3 Atomic Force Microscopy (AFM)
All previously described methods of electron microscopy have one disadvantage, the state
of a sample is largely artificial: cross-linkers and stains are used to condition components
of the photosynthetic membrane. AFM is an alternative high resolution (up to 5 Å) tech-
nique that in principle can be applied to the intact photosynthetic membrane or at least
membrane fragments containing hundreds of proteins at ambient temperature and free
from any artificial chemical agents. AFM visualizes the topography of an object via a
microscopic probe (cantilever) with a very thin tip of molecular, nanoscale, sharpness
(Figure 4.7 ). To map the object the cantilever scans over it. During this scanning the probe
constantly or intermittently (oscillating mode) interacts via atomic interactive forces with
the sample molecules. The sharper the tip, the smaller is the interaction area between it and
the sample and hence the better resolution could be achieved. Since the force strength
depends upon a distance between the probe and the sample, the feedback loop enabled by
piezo-actuator attached to the probe (similar to the vinyl record playing machines) ensures
always the same interaction force by constantly adjusting the vertical position of the canti-
lever over the un-even membrane surface (protruding proteins and their clusters with lipids,
etc.). As a result a topographic scan is produced revealing various structural elements of the
membrane surface. The accuracy of the tip position can reach 10 Å. These days AFM has
been developed into a multipurpose approach that can detect apart for the membrane sur-
face image various important biophysical parameters. Therefore it has become possible to
study structural and functional properties of biological membranes in parallel. Results of
AFM applications in the photosynthetic membrane research will be increasingly in focus
for years to come.
4.2.4 Crystallography Methods
4.2.4.1 X-ray Crystallography
Electron microscopy methods described above can zoom into the nanoworld with minimum
dimension of around of 1 nm, a more than two orders of magnitude improvement in
comparison to the optical microscopy. The sizes of membrane proteins and their complexes
with pigments and often oligomeric forms vary within 5–25 nm. As far as the groupings
and redistribution of membrane proteins are concerned as well as some crude imaging of
shapes, 1 nm resolution is sufficient. However, the knowledge of domain structure, helixes,
Rupan_c04.indd 45 8/29/2012 5:38:23 PM
LHC
II an
tenn
a co
mpl
exes
Ave
rage
siz
e 8.
7± 1
.1 n
m
Figu
re 4
.6
An
exam
ple
of a
naly
sis
of a
free
ze-fr
actu
re e
lect
ron
mic
rosc
opy
imag
e of
mem
bran
e co
ntai
ning
LH
CII
com
plex
of p
lant
s (l
eft)
. The
pi
ctur
e in
mid
dle
repr
esen
ts a
utom
atic
ally
iden
tifie
d an
d hi
ghlig
hted
LH
CII
part
icle
s ob
tain
ed f
or t
he a
rea
calc
ulat
ions
. Rig
ht im
age
disp
lays
cl
uste
rs o
f pr
otei
ns o
btai
ned
sing
clu
ster
-iden
tific
atio
n so
ftwar
e th
at h
ighl
ight
s gr
oups
of
part
icle
s po
sitio
ned
with
in e
ach
othe
r at
a c
erta
in
dist
ance
.
Rupan_c04.indd 46 8/29/2012 5:38:23 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 47
cofactors and finally specific aminoacids remains out of reach of microscopies. In order to
see them one has to go into the atomic resolution, that is a few Ångstroms: another order
of magnitude down from nanometre and a window open for studies of life chemistry and
physics. Protein crystallography methods are designed to obtain a resolution of up to 1 Å.
With this resolution contours of single atoms (electron density maps) could be obtained,
hence distinguishing atoms of carbon from oxygen, and so on in the 3D state of a protein.
X-ray crystallography is the method of choice, where possible. The short wavelength of
X-rays enables us to see very fine molecular features as small as single atoms. But
membrane proteins are generally harder to crystallize than water soluble proteins. The first
membrane protein complex to have its structure solved by X-ray crystallography at high
resolution was the photosynthetic reaction centre of purple bacteria. For this work Michel,
Deisenhofer and Huber were awarded Nobel Prize for Chemistry in 1988 (Deisenhofer
et al ., 1985). Knowledge of the protein structure details is believed to be essential for
understanding its function. One disadvantage of X-ray crystallography, however, is that a
membrane protein is taken from its environment, membrane, and its structure may not
correspond to the structure of a native complex and is inevitably a static one. The method
is also not free from a few difficulties. The most serious problem is to obtain good quality
crystals that will diffract at the highest resolution. If the resolution is only about 4 Å it
Figure 4.7 The principles of Atomic Force Microscopy (AFM). A laser beam is reflected from the cantilever monitoring its position. The controller receives this information and drives the piezo-actuator to compensate for the cantilever deflection in vertical direction, feedback compensation. Information on the sample microscopic landscape is processed by computer to generate an image.
Rupan_c04.indd 47 8/29/2012 5:38:25 PM
48 The Photosynthetic Membrane
would be almost impossible to unambiguously identify the aminoacid side chains.
However, alpha helixes can be identified with this resolution. At a resolution of about 2.5 Å
most of the atoms could be identified and water and other components like ions can be
seen. Resolution depends on the regularity of crystal as well as its stability during the
measurement of the diffraction picture. Crystallization is an entropy-driven process. The
build-up of order within the crystal is gained at the expense of increase in entropy of the
medium; molecules of solvent, detergent, and so on are being expelled from the proteins
that build crystal. Factors like pH, temperature, composition of crystallization medium can
strongly affect the quality of crystals. Therefore multiple crystallization trials, often using
automated multisampling equipment are required for establishing optimum crystallization
conditions. In an X-ray diffractometer crystals are subjected to an X-ray beam where its
scattering occurs. This scattering represents actually a multiple reflection process within
the regularly ordered proteins and their multiple structural elements. Reflected rays often
diffract and as a result a diffraction pattern is registered on the screen (photographic film
or camera). The interpretation of this pattern is based on the Bragg’s law that links
parameters of the structural elements of the diffracting protein to the complex diffraction
picture. This pattern is processed using Fourier transformation analysis in order to obtain
protein 3D electron density map. The next step is to identify or fit a molecule to particular
element in the map. Here, the resolution (the map quality) is of paramount importance,
since the higher resolution the more unambiguously certain density can be assigned. With
lesser resolution the molecular contours are less clearly defined leading to the increase in
uncertainty of assignment.
4.2.4.2 Electron Diffraction
Fast electrons also exhibit wave behaviour with the wavelength even shorter than X-rays.
They can be used in studies of 2D protein crystals. The latter are much easier to obtain in
comparison to 3D crystals. Membrane proteins tend to form lamellar sheets where they
often are organized into ordered arrays that can be obtained at high rate under certain crys-
tallization conditions. The resolution is not quite as good as X-ray crystallography (>3 Å),
but is often used for membrane proteins that cannot be crystallized in three-dimensions and
in order to obtain at least some information about helixes, domain structure, number of
cofactors, and so on. The data analysis is based upon Fourier transformation similar to the
analysis of X-ray diffraction patterns.
4.3 Function Probing Methods
Although biochemistry and visualization approaches provide fundamental information
about the membrane components, like identification, composition and structure, function
probing methods are a large group of approaches that aim to address various mechanistic
aspects of the photosynthetic membrane works. This is by far the largest class of methods
used to study the photosynthetic membrane functions with majority of them suitable for in vivo research. Many of the methods applicable for functional studies are based on the use
of various spectroscopies to gently analytically probe photosynthetic membrane functions.
Rupan_c04.indd 48 8/29/2012 5:38:26 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 49
The popularity of spectroscopic methods in photosynthesis research can be explained by
the fact that primary photosynthetic processes are based upon the use of light by photosys-
tems to trigger the chain of energy conserving events (see Figure 1.1). As can be seen in
Chapter 5, the particles that perform the primary photosynthetic energy transformations are
electrons of pigments and electron transport carriers. The reactions they are involved into
are by nature photobiological and therefore accompanied by various photobiological pro-
cesses, like absorption, fluorescence, phosphorescence, anisotropy, and so on that can be
studied by optical spectroscopy.
4.3.1 Absorption-Based Approaches
Processes of light harvesting, excitation energy migration among pigments and electron
transfer between carriers are often followed by spectral changes in absorption. The time-
scale of these changes varies depending upon the type of reaction. Visible-UV light-based
absorption methods are used broadly in the photosynthesis research in steady-state and
kinetic modes of measurements. Light absorption spectroscopy can be defined as an analy-
sis of light absorption by matter as a function of wavelength (λ). The central principle of
any optical absorption spectroscopy is based upon the Beer-Lambert law. Figure 4.8 shows
the scheme of light absorption within the sample of a depth L. Propagating within the sam-
ple light is gradually absorbed and the intensity of transmitted beam, I , is less than the
intensity of incident one, I 0 . The decrease in the incident light intensity due to absorption
within an infinitely thin section of sample, dx , is proportional to the intensity of probing
light and the concentration of sample molecules, C :
,dI I C dxα= − ⋅ ⋅ ⋅⋅ ⋅ ⋅
(4.2)
or
,
dICdx
Iα= −
(4.3)
I=0 dx
Solution oflight absorber
Transmitted light, IInsident light, Io
Figure 4.8 Principles of optical absorption spectroscopy. Derivation of the Beer-Lambert law.
Rupan_c04.indd 49 8/29/2012 5:38:27 PM
50 The Photosynthetic Membrane
where a is proportionality coefficient (constant). Now both parts of the equation can be
integrated resulting in:
0
.I
ln CxI
α⎛ ⎞
= −⎜ ⎟⎝ ⎠
(4.4)
The left part of Equation 4.4 is linearly proportional to sample concentration and sample
depth/thickness as well as a constant α . In spectroscopy natural logarithm is normally
replaced by common logarithm:
010log ,Cx OD
Iε⎛ ⎞ = =⎜ ⎟⎝ ⎠
I
(4.5)
where 2.303ε α= is called molar extinction coefficient with dimensions (M −1 cm −1 ). OD is called optical density or absorption and is dimensionless. Basically, OD indicated the
power of magnitude of reduction in incident light intensity as a result of absorption within
a sample. If OD = 1 , this means that the transmitted light intensity for a sample is only 10%
of the incident one. If OD is 2, then only 1% of incident light is left after absorption. OD is a convenient and simple way for estimation of molecular concentration. The extinction
coefficient is dependent upon the wavelength of absorbed light. Normally it is given at the
maximum of absorption spectrum, λεmax
. Figure 4.9 displays a basic scheme of a simple
spectrophotometer. Light from the light source (normally tungsten halogen, deuterium or
mercury lamp) is directed into a monochromator. The latter contains a prism of diffraction
grating that split light into various relatively monochromatic colours or wavelengths,
which are sequentially directed upon a sample and the transmitted light intensity is detected
by the detector (photodiode, photomultiplier, CCD: charge coupled device, camera, etc.).
The analyser registers intensity for all probed wavelengths. However, in order to do so, I 0
needs to be registered too. For this often a second channel (dual beam regime) is used
where a reference cuvette, containing a solvent or buffer in which the sample molecules
were dissolved, is placed. The analyser automatically calculates a common logarithm from
the I 0 / I corresponding to each wavelength used and reconstructs an OD spectrum.
Figure 4.9 Basic scheme of an absorption spectrometer.
Rupan_c04.indd 50 8/29/2012 5:38:28 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 51
In reality, the most conventional spectrophotometers are limited by the sensitivity of the
detectors and the presence of so-called stray light that originates from the incident light
bypassing the sample without being absorbed (reflection from the cuvette walls, scatter-
ing, etc.). This causes underestimation of the true OD and heavy distortion of absorption
spectrum due to the loss of linearity between OD and concentration. Therefore, it is gener-
ally recommended to use the sample at somewhat low concentration, where OD varies
from 0.3 to 0.8, for the most of spectrophotometers. Photosynthetic membranes as well as
isolated membrane complexes are relatively large particles that inevitably cause light scat-
tering during absorption measurements. This can lead to spectral distortion. Normally, OD
becomes overestimated throughout the absorption spectrum, since the escape of light from
the cuvette and photomultiplier is interpreted by the analyser as a lost transmitted light. To
correct this artefact, the sample is often positioned closely to the detector, light diffuser
(opal glass) is used to equally scatter light in the sample and reference cuvettes and, finally
and most effectively, light scattering particles (latex or milk) are added to the reference
cuvette to obtain there levels of scattering equal to those of the sample. Poorly transparent
or non-transparent samples, like leaves, are often measured in reflectance regime. The
sample is being probed by light at 45°with reflected light detection at the same angle. The
reflected light intensity is taken instead of transmitted one in calculation of OD.
Among the most common applications of absorption spectrophotometry in photosynthe-
sis research is the determination of chlorophyll concentration. First, pigments need to be
extracted using organic solvents, most often acetone. Extract OD is measured at maxima of
chlorophyll a and b absorption and concentrations of these pigments are calculated using a
formula specific for the solvent, since the extinction coefficient varies depending upon the
solvent type. Chlorophyll a/b (Chl a/b ) ratio is a popular parameter, characteristic of the
membrane or isolated pigment-protein composition. Particular care needs to be taken to
preserve stability of pigment extracts, since light and acid exposure can easily damage
chlorophylls leading to underestimation of their concentration. Total carotenoid content
can also be calculated using this method.
Absorption spectral measurements of isolated pigment-proteins can be useful in their
preliminary identification and characterization. In order to improve signal to noise ratio,
procedures like Fourier filtration can be applied. Figure 4.10 compares spectra of a multi-
component system before (original) and after (smoothed) such filtration. For gaining more
information about number of components and their accurate maxima positions, calculation
of the second or fourth derivative is often used. The maxima of pigment spectra are much
better resolved in derivative mode, since the spectral bandwidth for example in the second
derivative spectrum is almost two times narrower than that in the original one. Figure 4.10
shows that the second derivative spectrum revealed at least five clearly defined maxima,
whilst the original spectrum showed only one clear maximum and two bands appeared as
shoulders. Narrowing bands in spectroscopy is of paramount importance, since it can allow
analysis of spectra of very complex systems, like isolated pigment-protein complexes or
even whole photosynthetic membranes, that contain many types of pigments and their
forms originating from the same pigment bound into different microenvironments/binding
pockets (for details see Chapter 6). Another way to increase the spectral resolution is to
Rupan_c04.indd 51 8/29/2012 5:38:30 PM
52 The Photosynthetic Membrane
cool the sample to the temperature of liquid nitrogen (77 K) or even liquid helium (4 K).
Measurements of absorption spectra at these temperatures are complicated by the issues of
sample transparency that can be addressed by using glycerol-based sample media to pre-
vent water crystallization resulting in very strong light scattering.
Absorption spectroscopy is also widely applied as a tool to monitor certain photosynthetic
electron transfer reactions. In conditions where electron acceptors are missing from the
thylakoid or BBY particles preparations, it is possible to support/restore the electron trans-
port chain by using artificially added electron acceptors such as dichlorophenol indophenol
(DCIP), potassium ferricyanide, ferredoxin, and so on. Their absorption spectra are very
sensitive to the redox state. For example, reduced DCIP is colourless whilst the oxidized is
blue. The electron transfer rate can simply be measured by the rate of DCIP absorption
change caused by illumination.
Information about spectra of components of electron transfer chain can be obtained
using differential absorption spectroscopy. There, the sample cuvette contains sample that
undergoes treatment with chemical reagents, temperature or, indeed, light. The reference
cuvette contains, instead of buffer, an untreated sample. The difference spectrum treated-
minus-untreated is automatically acquired. Often it reveals very specific spectral informa-
tion on some minor components whose spectra are heavily masked by the spectra of
chlorophylls, for example. This approach allowed producing spectra of cytochromes and
reaction centre chlorophylls.
Original
Smoothed
2nd derivative
Figure 4.10 Basic spectral analysis using methods of digital filtration and second derivatives.
Rupan_c04.indd 52 8/29/2012 5:38:30 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 53
Another insightful pool of absorption methodology applications comes from kinetic spec-
troscopy. Since photosynthesis is a sequence of events that gradually stabilize and slow-down
energy given by light (see Chapter 1), it is possible to register these events using various time
windows and wavelengths of detection as well as the level of intactness of the sample. Energy
transfer and trapping events in photosystems’ pigment ensamples are accompanied by tran-
sient alterations in absorption of pigments. Pigments that receive energy and are excited can-
not absorb light until they undergo de-excitation. Excited states leave from nano- to
picoseconds or even shorter. Therefore, the accompanied light-induced absorption changes
have to be recorded very rapidly by specialized equipment using streak-cameras, laser pulses,
delay circuits, and so on. The method is generally called pump-probe spectroscopy with
various evolved modifications. It can be used to study isolated pigment protein complexes,
photosystems, photosynthetic membrane fragments or, indeed, chloroplasts and even leaves.
It helps greatly to understand primary photosynthetic photophysical and photochemical
events and explain high efficiency of energy conversion in the photosystems. For slower reac-
tions of electron transport ranging from submicroseconds (in photosystems) to milliseconds
(cytochromes, etc.) flash-photolysis equipment is normally used. It is based on using repeti-
tive flashes of light from xenon lamp strong enough to saturate all reaction centres by one
flash with duration of a few microseconds. The same equipment can be used to measure so-
called electrochromic shift that originate from the altered absorption of some carotenoids as
a result of a build-up of electric field across the photosynthetic membrane. The field is build
due to electron and coupled proton transfer across the membrane. This technique became
popular for estimations of the extent of the transmembrane proton gradient in chloroplasts
and leaves. Finally, the slowest light-triggered absorption changes that take place during the
light phase of photosynthesis in the membrane associated with enzymatic pigment intercon-
version and establishment of the photoprotective energy dissipative state (xanthophyll cycle,
see Chapter 9) can be monitored on the timescale of seconds and minutes. Very often the
kinetic absorption measurements use a dual wavelength regime that involves a reference light
of a certain wavelength, where no absorption change is expected to take place, to be used in
the same light path as a measuring beam. This way of referencing allows performance of
more stable and accurate measurements compared to the dual beam configuration.
So far, we have mentioned various absorption spectroscopy approaches that provide infor-
mation on the type and concentration of pigments. However, absorption spectroscopy has
much broader potential. Applications of spectroscopies that use polarized light enable to
study pigment architecture in protein complexes and the membrane, their mutual orientation,
interactions with each other and protein as well as their molecular conformation. Two meth-
ods of polarization spectroscopy are often used in photosynthesis research; linear, LD, and
circular, CD, dichroism absorption spectroscopies. For LD, light is polarized using a special
crystal in one plane of its electric field oscillation (see Chapter 5). Membranes of isolated
pigmented complexes need to be oriented by magnetic field or using various mechanic meth-
ods (stretching in gel or brushing onto the glass slide). LD uses light polarized either in paral-
lel as well as perpendicular to the sample alignment. A sample absorption of light beams with
these two orientations is analysed to produce LD that is normally proportional to Δ A = A − A ⊥ ,
where A and A ⊥ is absorption of light oriented in parallel and perpendicular planes relatively
to the sample molecules alignment. The LD spectrum of the photosynthetic membrane
Rupan_c04.indd 53 8/29/2012 5:38:30 PM
54 The Photosynthetic Membrane
or isolated pigment-protein complexes contains a number of bands that belong to carotenoids
and chlorophylls indicating relative orientation of these pigments as well as possible close
energetic interactions (excitonic coupling). CD uses light that is helically oriented producing
a spiral of its electric field propagation in space. It can spiral clockwise (right) or anticlock-
wise (left). In this case, circular dichroism is a difference between absorption of left and right
circularly polarized lights: Δ A = A L − A
R . For CD, a sample does not have to be oriented. The
CD spectrum of isolated chlorophylls or carotenoids is normally very weak and featureless.
On the contrary, the CD spectrum of protein-bound pigments is very strong. This is because
binding causes conformational strain and distortion of a pigment molecule that reflects in the
increase in its optical activity. Interactions between pigments can also result in appearance of
strong CD spectrum with one positive and one negative band (conservative change, no gain/
loss in absorption) of excitonic origin. Modern polarization absorption spectrophotometers
can easily combine LD and CD modes of absorption measurements that can work in spectral
or kinetic modes at a range of sample temperatures.
Infrared absorption spectroscopy (IR) is another absorption-based method that utilizes
infrared light in order to probe energies of molecular vibrations. They are an order of
magnitude weaker than those of electronic energy and can be potentially useful in
identification of molecular species (for example pigments) and their interactions with
environment (hydrogen bonding, etc.) as well as studies of membrane protein secondary
structure. Kinetic IR spectroscopy is used in photosynthesis research to probe structural
changes in cofactors and their environment as a result of photochemical reactions of
electron transport. Use of interferometers instead of monochromators enables better
stability and promptness of spectral recording. Employment of attenuated total reflection
(ATR) sample compartments makes it possible to do measurements on very small sample
volumes, semidried films and use of nontransparent samples.
4.3.2 Raman Spectroscopy
Raman spectroscopy is becoming a popular tool in photosynthesis research. It is a method
which uses Raman or combinational scattering effect that occurs when the monochromatic
laser light is absorbed by sample. The majority of light photons that are not absorbed by a
molecule tend to reflect from it producing light scattering or more accurately elastic
Rayleigh scattering. The scattered light has the same wavelength as incident light. However,
there is a probability that incident light will interact with vibrations of sample molecules
resulting in alterations (decrease or increase) in the energy of incident light photons
(Figure 4.11 ). The shift in energy of exciting light is due to molecular dynamics originating
from constant vibrational and rotational motions (see Chapter 5). Therefore the Raman
shift gives information about the energy of these modes in the sample molecules. In fact,
Raman spectroscopy is similar but complementary to the IR spectroscopy, since it reveals
vibrations normally not seen by IR. The information gained by Raman spectroscopy is very
useful in identification of molecular species, pigments; for example, their environment,
conformation, and so on. Raman scattering is normally very weak. However, if the wave-
length of the incident light matches that of the electronic (UV-Vis) absorption spectrum the
probability of Raman scattering dramatically increases, sometimes up to one million times.
Rupan_c04.indd 54 8/29/2012 5:38:30 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 55
Besides, resonance conditions excite only one or a very few molecular species that absorbed
the incident light wavelength, therefore this method can be highly selective suitable to
study particular types of molecules in very complex mixtures with others. Particularly use-
ful is resonance Raman in studies of carotenoids: secondary light harvesting pigments.
Carotenoids unlike chlorophylls are nonfluorescent, therefore they cannot be studied by
fluorescence spectroscopy. Fortunately they are very strong Raman scatterers, more effec-
tive then chlorophylls. Therefore, the majority of important parameters of the photosyn-
thetic carotenoids have been obtained using resonance Raman spectroscopy (for details see
Chapter 8). One of the major disadvantages of resonance Raman spectroscopy is the often
strong fluorescence excited by incident light that is overwhelming for the sensitive Raman
emission detectors. In addition, photodegradation or photoisomerization of the sample can
take place since the energy of incident light is normally high. This, however, can be par-
tially overcome by cooling of the sample to the liquid nitrogen temperature (77 K).
4.3.3 Fluorescence-Based Approaches
Fluorescence, a type of emission of light that takes place after absorption of photon by a
pigment molecule, has always been popular in research of the photosynthetic membrane.
It counts a number of classes of approaches to studying the photosynthetic membrane
Laser line(Rayleigh scattering)
Raman scattering
Energies of molecular vibrations0
ν4
ν3
ν2
ν1
Figure 4.11 Spectra of scattering of incident laser line (488 nm) – Rayleigh and carotenoid in solvent – resonance Raman. Energies of individual intramolecular vibrations are determined by the extent of the shift of Raman spectrum from the energy (wavelength) of scattered incident laser light (Rayleigh).
Rupan_c04.indd 55 8/29/2012 5:38:30 PM
56 The Photosynthetic Membrane
and its components and is being rapidly developed to gain novel insights into its structure
and functions. Fluorescence of chlorophylls, the main photosynthetic pigments, provides
vital information about their variety, energy transfer between them, interactions with the
environment, efficiency, adaptations of the photosynthetic membrane to environmental
conditions, and so on. One of the reasons for the popularity of fluorescence applications
could be that it reveals the fate of light energy absorption by the membrane as well as
reflects the state of electron transport and even ATP synthesis and carbon metabolism.
4.3.3.1 Fluorescence Spectroscopy
Fluorescence compete with a number of nonradiative processes (see Chapter 5 for details)
that usually make fluorescence light coming out of sample much weaker than the light that
is absorbed ( I a = I
0 − I ) (see Figure 4.8 ). Hence, fluorescence depends first of all upon the
sample absorption, that include concentration, the absorption path and molar extinction as
well as upon the efficiency/rate of competitive nonradiative processes. Fluorescence
intensity can be expressed as:
,f
ff nr
kI I
k kα
⎛ ⎞= ⎜ ⎟+⎝ ⎠
(4.6)
where I a is the intensity of absorbed light or incident light minus transmitted light inten-
sity; k f is the fluorescence rate constant and k
nr is the sum of all nonradiative rate constants.
+( ( ))f f nrk k k is known as the fluorescence yield ( f f ) and is always less than unity. The
chlorophyll fluorescence yield in solvents approaches 0.33 or 33%, meaning that one out
of three absorbed photons on average will be reemitted as a fluorescence photon. However,
it is usually hard to capture all fluorescence photons coming out of a sample upon absorp-
tion, since they are being emitted in various directions, in a similar (but not identical)
manner to light scattering (Figure 4.12 ). Therefore, the majority of fluorescence spectral
measurements taken at steady state give only relative fluorescence intensity. Figure 4.12
shows components of a typical spectrofluorimeter. Light defined by excitation channel
monochromators excites fluorescence at a certain wavelength, λ exc
. Fluorescence is emit-
ted by the sample in different directions with some delivered to emission monochromator,
that disperses it into a range of wavelengths in order to generate a range of intensities,
detected and processed by the detector and analyser to obtain a fluorescence spectrum.
A range of special sample compartments can be used in order to adopt various types of
samples: liquid solutions of isolated chloroplasts or complexes, leaf fragments or indeed
the whole nondetached leaves. In addition, an optical cryostat can be placed in the sample
compartment in order to enable measurements at cryogenic temperatures, most often 77 K
or 4 K. Some cryostats enable to use a broad range of temperatures from room to cryogenic
for studies of thermodynamic properties of samples. The emission monochromator wave-
length can be fixed at maximum of fluorescence spectrum whilst excitation monochroma-
tor could scan a range of wavelengths in order to produce excitation fluorescence spectrum .
Rupan_c04.indd 56 8/29/2012 5:38:31 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 57
This type of spectrum in case of a homogenous pigment system has a shape of I a or I 0 − I – a
spectrum of absorbed excitation light intensity. It is not to be confused with a logarithmic
absorption spectrum, log ( I 0 / I ), if one wants to compare excitation and absorption spectra.
Indeed, ( I − I 0 ) amplitude is not a linear function to pigment concentration. Therefore the
shape of excitation fluorescence spectrum will differ at different concentration of a pig-
ment. It will become increasingly broader with the concentration increase. In case of chlo-
rophyll it is better to undertake the measurements at reasonably low concentration,
corresponding to OD = 0.1 or even lower. If excitation fluorescence spectra of various sam-
ples need to be compared, it is essential to make sure that the optical densities of all samples
are equal. Figure 4.13 shows a scheme explaining the principle of excitation fluorescence
spectroscopy. This is the case of multicomponent system with energy transfer between pig-
ments directed towards the red-most pigment, called terminal emitter. Fluorescence of this
emitter is detected at the wavelength of its maximum. Excitation light is scanned in the
short wavelength region throughout the whole absorption spectrum of the system. The
resulting excitation fluorescence spectrum can be expressed as:
( ) ( )0
1
( ) * ( ) ( ) ,n
i ii
F f k I Iλ λ λ=
= −∑
(4.7)
Light source
Detector
Analyser
Emissionmonochromator
Excitationmonochromator
Sample cuvette
lf
lo
Figure 4.12 Basic scheme of a spectrofluorimeter.
Rupan_c04.indd 57 8/29/2012 5:38:31 PM
58 The Photosynthetic Membrane
where f is a proportionality coefficient k i is the energy transfer efficiency coefficient of
i component (varies from 0 to 1), ( I 0 ( l ) − I
i ( l )) is a reversed transmission spectrum of an
i component. If k i < 1 it means that there are some energy losses during its transfer to the
terminal emitter and the corresponding excitation fluorescence spectrum amplitude will be
decreased in comparison to the reversed transmission spectrum of the system.
Fluorescence can be excited by linearly polarized light and detected through a polar-
izer oriented either in parallel or perpendicular direction to the excitation light polariza-
tion plane to probe fluorescence polarization, P , that is equal to Δ I / I , where Δ I = I − I ⊥ and I = I + I ⊥ where I and I ⊥ are fluorescence intensities at parallel and perpendicular ori-
entation of polarized relatively to the polarization plane of excitation light. More often
than P, another polarization parameter, fluorescence anisotropy, is used: ⊥= Δ +/ ( 2 )r I I I
If the excited pigment molecule changes orientation/conformation or passes energy to
another pigment P will decrease. The fluorescence anisotropy spectroscopy of photosyn-
thetic membrane or pigment protein complexes is used to identify pigments involved in
energy transfer or those which are uncoupled due to the damage or their specific origins
and functions.
4.3.3.2 Time-Resolved Fluorescence
The formula for fluorescence quantum yield expressed in terms of rate constants. This is
derived from the monoexponential type of decay of excited molecular state. This results
from the solution of a differential equation:
= − +( ) ,f nr
dnk k n
dt (4.8)
Ene
rgy
ki (I0 – Ii(λ))
λ
Absorption
Fluorescence
Figure 4.13 Principles of fluorescence excitation spectroscopy. Fluorescence excitation spectrum of a multicomponent system connected with the energy transfer (down arrows) directed to the terminal emitter (the lowest absorption level) the fluorescence of which is detected.
Rupan_c04.indd 58 8/29/2012 5:38:32 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 59
where n 0 and n are number of excited molecules at the time of absorption of light and at
time t , respectively. The minus sign indicates decay in n with time. Regrouping and integra-
tion of this equation gives us:
( )
0 ,f nrk k tn n e
− +=
(4.9)
where ( k f + k
nr ) correspond to an exponential decay rate constant. Therefore the yield can be
expressed as:
0
,f f
ff nr
k
k k
τφ
τ= =
+
(4.10)
where t f = 1/( k f + k nr
) and t 0 = 1/ k
f is the intrinsic radiative lifetime. This lifetime corresponds
to the lifetime of the excited state in the absence of all nonradiative deactivation processes,
when the yield is unity. The measured fluorescence lifetime is always shorter than the
intrinsic lifetime due to the presence of a combination of various nonradiative decays (see
Chapter 5). For chlorophyll a the intrinsic lifetime is around 15 ns, whilst the maximum
measured fluorescence lifetime is about 5 ns giving the yield of about 0.33, as was
mentioned previously. Measurement of fluorescence decay is therefore a unique method
that enables to estimate absolute fluorescence yield and obtain kinetic information about
processes of energy transfer, trapping and de-excitation within the photosynthetic pigments,
pigment-protein complexes and the membrane as a whole.
Phase fluorometers, time-correlated single photon counting (TCSPC) or streak camera
devises are used to measure chlorophyll fluorescence lifetimes. The basic scheme of a
TCSPC lifetime fluorometer is similar to that depicted in the Figure 4.12 . However, for
excitation pulsed lasers are used. In addition the system counts every fluorescence photon
and estimates the time taken for it to arrive onto the detector, basically working as a very
fast timer, that times photons arriving at various times and reconstructs the decay curve
using thousands of counts. Many components of a lifetime fluorometer are specifically
adopted to enable the fast response of the system. A TCSPC machine possesses average
time resolution of about 50 ps (0.05 ns). However, the analytical software enables to
increase this to about 10 ps (0.01), which is reasonably good for analysis of fluorescence
lifetimes in the range of 0.1–5 ns. Normally temporal resolution is also complemented by
spectral resolution so that decay-associated spectra of complex samples possessing several
chlorophyll-emitting bands can be calculated.
4.3.3.3 Pulse Amplitude Modulated (PAM) Fluorescence
Nowadays, chlorophyll fluorescence has become one of the most rapid and non- destructive
methods for efficient assessment of photosynthetic membrane performance in plants in situ
popular among various kinds of plant researchers. At ambient temperature the fluorescence
of the intact photosynthetic membrane originates mainly from PSII, maximum at
Rupan_c04.indd 59 8/29/2012 5:38:33 PM
60 The Photosynthetic Membrane
680–685 nm with a small contribution from PSI around 720 nm. Hence, the both photosys-
tems fluoresce at far-red edge of the visible spectrum. This is due to a very different
arrangement of antenna pigments in these photosystems (see Chapter 6). The fluorescence
intensity is proportional to the yield that is defined by the ratio of radiative and the sum of
all de-excitation constants, as defined in the previous paragraph (in Section 4.3.3.2). Apart
from fluorescence there are two more major channels of de-excitation in PSII, nonradiative
dissipation into heat (rate constant k d ) and photochemistry (rate constant k
P ) due to the reac-
tion centre activity – a major event starting the chain of photosynthetic reactions
(Figure 4.14 ).
Hence the chlorophyll fluorescence yield of the photosynthetic membrane with ‘ working’
PSII reaction centres can be expressed as:
,( )
f
ff d p
k
k k kφ =
+ +
(4.11)
Yields of nonradiative heat dissipation and photochemical activity of PSII reaction centres
can be expressed by analogy as:
,( )
dd
f d p
k
k k kφ =
+ +
(4.12)
HeatLHA
RC
Fluorescence
Photochemistry
ML
PLAL
Figure 4.14 Principles of pulse amplitude modulated fluorescence measurements.
Rupan_c04.indd 60 8/29/2012 5:38:34 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 61
and
,( )
p
PSIIf d p
k
k k kφ =
+ +
(4.13)
It is easy to figure out if one can control one of the three dissipation channels it would be
possible to find out the yields of the other two. Fortunately, the photochemistry can be
blocked by chemicals, like DCMU, or by using a light flash of very high intensity. Both
factors cause the closure of RCII that manifests in reduction of the Q A acceptor that causes
chlorophyll fluorescence to rise. Saturating pulses are more frequently used in fluorescence
analysis since the invention of the pulse amplitude modulated fluorimeter. This devise uses
pulse-triggered lock-in amplifier system that registers fluorescence only induced by pulsed
excitation light. Any other fluorescence induced by continuous or pulsed light of different
frequency and duration, no matter how bright it is, will not be registered by this fluorime-
ter: it will simply not respond to any signal but pulsed light of the programmed frequency
and duration. This is the basic principle of PAM fluorimetry. Measuring pulsed light is set
normally at very low intensity (<1 μ M m −2 s −1 ) that is barely visible by eye. Figure 4.15
shows a typical fluorescence trace obtained from a leaf measurement.
The level of fluorescence induced by the measuring beam is very low, however, it is
not equal to zero no matter how low is the exciting light intensity. This is because the
photochemical channel rate constant is not infinitely large. This fluorescence level is called F o
and reflects the state when all PSII centres are open and consume the energy of the measuring
beam. In order to obtain the idea how much larger is the photochemical channel in comparison
to the fluorescence one a 1 s very bright light pulse (>5000 μ M m −2 s −1 ) is applied. This light
competitively saturates all PSII reaction centres with energy, so they are not anymore able to
utilize the energy of the measuring beam light. Hence, the k P relatively to the measuring light
becomes zero. The fluorescence rises to a maximum level called F m . The fluorescence yields of
F 0 and F
m can be expressed as:
( )0
f
F
f d P
k
k k kφ =
+ +
(4.14)
and
( )m
f
Ff d
k
k kφ =
+
(4.15)
It is easy to find out from these two equations by simple algebra transformations that:
0( )
m
m
F F
PSIIF
φ φφ
φ−
=
(4.16)
Rupan_c04.indd 61 8/29/2012 5:38:35 PM
62 The Photosynthetic Membrane
Since mF mKFφ = and
0 0F KFφ = , where K is the proportionality constant that links relative
fluorescence intensity with the fluorescence yield and is always the same regardless of the
state of photochemistry or other processes taking place in PSII it is possible to express f PSII
as:
( )0,
m vPSII
m m
F F F
F Fφ
−= =
(4.17)
where F v = F
m − F
0 .
F v / F
m is the first fundamental parameter that defines the quantum yield of PSII photo-
chemistry. It is normally 0.8 or 80%, a very efficient light energy conversion into the energy
of electron moving into the electron transport chain. PAM fluorimetry is therefore a unique
method that allows calculation of fundamental absolute parameters like yields without
measuring absolute fluorescence yield. A third type of light, called actinic light, can also be
Pulses1 min
Time
Fm’
Fm
Fm’’
Fs
Pulse
Flu
ores
cenc
e
Actinic lighton
Actinic lightoff
Measuring light
Figure 4.15 Typical chlorophyll fluorescence induction curve of dark-adapted leaves measured using a PAM fluorimeter. First, fluorescence is excited by very weak, pulsed light (<1 m Mm −2 s −1 and frequency of 1.6 kHz), called ML (measuring light), to monitor Fo, the fluorescence state of antenna, when reaction centres are open for excitation energy delivery. Then 1 s pulse of saturating light (PL, 5000 m Mm −2 s −1 ) was applied in parallel to close all reaction centres. This almost immediately brought the fluorescence level to its maximum, Fm. Therefore the quenching by open reaction centres, given as (Fm-Fo)/Fm is used to quantify the photochemical quenching, which indicates how efficiently light is being utilized. However, it does not account for all of the quenching observed. Indeed, in light close to saturating for electron transport (AL, here intensity was ~1000 m M.s −1 .m −2 ), quenching by reaction centres is reduced almost to zero, yet there can be large amounts of other type of quenching. Such quenching is therefore called non-photochemical quenching and refers to the difference between the initial, dark-adapted Fm and that recorded after a period of illumination, Fm′ This quenching has been termed variously qN or NPQ.
Rupan_c04.indd 62 8/29/2012 5:38:36 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 63
applied to actually observe the fluorescence induction trace (Figure 4.15 ). This light is
continuous and of somewhat moderate intensity, chosen to keep some reaction centres free
from saturation. On top of this light, bright light pulses can be applied to see the level of
maximum fluorescence. What is remarkable, first of all, is that this maximum level during
actinic light illumination is at first very high, reaching Fm level in the dark but then becomes
to decline, sometimes very steeply and within a few minutes or longer stabilizes at some-
what low level called F m ′. The yield of F
m ′ is expressed as:
,( )m
f
Ff d D
k
k k kφ =
+ +
(4.18)
where k D is a rate constant of the nonradiative process that causes F
m level decline. This
lowering of Fm induced by continuous light it termed nonphotochemical quenching, qN . The yield of this process, f
D , can be calculated as
,( )
DD
f d D
k
k k kφ =
+ +
(4.19)
where k D is a transient nonradiative dissipation constant, or induced non-photochemical
fluorescence quenching constant. Often f D is referred to as qN and expressed via
flu orescence levels:
( )m m
m
F FqN
F
− ′=
(4.20)
The nonphotochemical quenching is also quantified as ( F m − F
m ′)/ F
m ′. This calculation
simply corresponds to the ratio k D /( k
f + k
d ), which basically compares the rate of
non- photochemical quenching process to the sum of all other rates at the conditions when
all PSII reaction centres are closed and is referred to as NPQ . Interestingly that the level of
fluorescence under actinic light without pulses is somewhat lower ( F s ) and indicates at least
partial contribution of reaction centre activity to the fluorescence quenching. The latter is
called photochemical quenching, qP , and calculated as:
0
m s
m
F FqP
F F
′ +=
′ + ′
(4.21)
In the dark, this quenching equals 1. The PSII yield at actinic light relates to qP via
following formula:
.vPSII
m
FqP
Fφ =
(4.22)
Rupan_c04.indd 63 8/29/2012 5:38:37 PM
64 The Photosynthetic Membrane
Figure 4.14 also shows that the light-induced fluorescence decline relaxes upon removal of
actinic light, so that at least the major part of F m is restored after some 5–10 min of the dark.
This relatively quickly reversible qN component was originally called energy−dependent quenching , qE . Nowadays it is often related to a measure of ‘induced dissipation’ or
‘photoprotective energy dissipation’. The yield of qE is calculated as:
m m
m
F FqE
F
″ ′=
′�
(4.23)
The corresponding NPQ parameter for the reversible quenching will be
/ /r m m m mNPQ F F F F ″′= � . Chapter 9 will discuss causes, role, origins and mechanisms
of nonphotochemical quenching in detail. The dynamic fluorescence behaviour presented
in Figure 4.15 was first discovered by Kautsky 80 years ago and still fascinates scientists
and reflects a chain of events of electron and proton transport that are being sequentially
born in the photosynthetic membrane upon absorption of light (Kautsky and Hirsch, 1931 ).
PAM fluorimetry is a quickly-developing technique that became well-accepted and used
in laboratories, in field experiments on land and under water. PAM cameras and micro-
scopes have been produced to measure photosynthetic performance of individual plant
seedlings, cells and even chloroplasts. It is now being combined with the measurements of
oxygen evolution during illumination, proton gradient formation (see the next paragraph)
and other processes that are triggered by the photosynthetic activity of the membrane.
Combined with the time-resolved fluorescence spectroscopy that measures absolute fluo-
rescence yields (see the previous paragraph) it became one of the most popular and insight-
ful tools that can study in situ the photosynthetic membrane efficiency and dynamic
mechanisms of adaptations to light environment.
4.3.3.4 ΔpH Measurements using Fluorescence Probes
Externally added fluorescence probes can be used for spectral measurements on the
photosynthetic membrane to monitor its functions. One of them is the dye called
9- aminoacrydine (9-aa). It cannot be used on intact or detached leaves but chloroplast suspen-
sions of a certain volume. Its absorption maximum is around 350 nm and fluorescence is
around 400 nm. Therefore it is not in overlap with the far-red fluorescence of photosystems
chlorophyll and can actually be monitored in parallel with chlorophyll fluorescence induction
of chloroplasts. Indeed, the measurements are made in kinetic mode with detection in 400–
420 nm region defined by an optical interference filter. This amine in protonated form redis-
tributes itself across the membrane. The protonation takes place as a result of ΔpH formation
resulting from the photosynthetic electron transport (see Chapter 3). It takes normally around
5–15 s for complete establishment of the proton gradient, a much slower than some of the
electron transfer rates described earlier. Therefore, it does not require a sophisticated equip-
ment to perform these measurements. 9-aa is fluorescent in both, protonated and nonproto-
nated forms. However, once diffused in the thylakoid lumen, the space of which is very small,
it easily concentrates and becomes nonfluorescent as a result of so-called concentration
Rupan_c04.indd 64 8/29/2012 5:38:39 PM
Popular Methods and Approaches to Study Composition, Structure and Functions 65
quenching. Therefore, the measured quenching of 9-aa induced by ΔpH formation is simply
due to the removal of fluorescent 9-aa from the stroma into the lumen where its fluorescence
vanishes completely. Light-induced 9-aa quenching can be calculated as:
9 ,
i q
aai
F Fq
F=�
�
(4.24)
where Fi and F
q are fluorescence before illumination (and therefore ΔpH establishment)
and after formation of ΔpH, respectively. This quenching is normally noticeable, around
50% or even more. The numerical difference (will be negative) between lumen and stromal
pH is expressed as:
( )− Δ
⎡ ⎤ ⎛ ⎞= +⎢ ⎥ ⎜ ⎟⎝ ⎠⎢ ⎥⎣ ⎦9
9
,1
aa
aa
q VpH log log
vq�
��
(4.25)
where V and v are the total volumes of the chloroplast-containing suspension and the inter-
nal volume of all thylakoids, that is lumen, of the whole sample. Whilst is it relatively easy
to monitor 9-aa quenching, provided it is used at right concentration (~1 mM) and ratio to
the chlorophyll concentration of the sample (~1 : 40) , it is often hard to estimate correctly
to know the lumen volume, v . There are, however, a few reports that provide values of the
lumen volume that are often used in calculations of ΔpH using formula (Equation 4.25 ).
ΔpH induced in the dark by hydrolysis of ATP can also be monitored using the 9-aa method.
The accurate estimation of the lumen volume is the most controversial issue of the 9-aa
method making some to look for alternative approaches to measure proton gradient.
References
Berthold , D.A. , Babcock , G.T. and Yocum , C.F. ( 1981 ) A highly resolved, oxygen-evolving photosystem II preparation from spinach thylakoid membranes: EPR and electron-transport properties . FEBS Lett. , 134 , 231 – 234 .
Deisenhofer , J. , Epp , O. , Miki , K. et al . ( 1985 ) Structure of the protein subunits in the photosynthetic reaction centre of Rhodopseudomonas viridis at 3Å resolution . Nature , 318 ( 6047 ), 618 – 662 .
Kautsky , H. and Hirsch , A. ( 1931 ) Neue Versuche zur Kohlensäureassimilation , Naturwissenschaften , 19 , 964 – 964 .
Singer , S.J. and Nicolson , G.L. ( 1972 ) The Fluid Mosaic Model of the Structure of Cell Membranes . Science , 175 ( 4023 ), 720 – 731 .
Bibliography
Berg , J.M. , Tymoczko , J.L. and Stryer , L. ( 2012 ) Biochemistry . Basingstoke : W.H. Freeman and Company .
Boekema , E.J. , Folea , M. and Kouril , R. ( 2009 ) Single particle electron microscopy . Photosynth. Res ., 102 , 189 – 196 .
Rupan_c04.indd 65 8/29/2012 5:38:40 PM
66 The Photosynthetic Membrane
Blankenship , R. ( 2002 ) Molecular Mechanisms of Photosynthesis . London : Blackwell Science . Branden , C. and Tooze , J. ( 1991 ) Introduction to Protein Structure . New York and London : Garland
Publishing . Carpentier , R. (ed.) ( 2004 ) Photosynthesis research protocols . Methods in Molecular Biology , 274 ,
1064 – 3745 , New Jersey : Humana Press . Clayton , R.K. ( 1970 ) Light and Living Matter, Volume 1: The Physical Part . New York : McGraw-Hill . Hall , D.O. and Rao , K.K. ( 1995 ) Photosynthesis . Cambridge : Cambridge University Press . Hipkins , M.F. and Baker , N.R. (eds.) ( 1986 ) Photosynthesis: Energy Transduction: A Practical
Approach. Practical Approach Series . Oxdord : IRL Press Limited . Kirchhoff , H. , Haferkamp , S. , Allen , J.F. et al . ( 2008 ) Protein diffusion and macromolecular crowd-
ing in thylakoid membranes . Plant Physiol. , 146 , 1571 – 1578 . Krause , G.H . and Weis , E . ( 1991 ) Chlorophyll fluorescence in photosynthesis: the basics . Ann. Rev.
Plant Pysiol. Plant Mol. Biol ., 42 , 313349 . Krysan , P.JU ., Young , J.C. and Sussman , M.R. ( 1999 ) T-DNA as an insertional mutagen in
Arabidopsis . The Plant Cell , 11 , 2283 – 2290 . Miller , D. ( 2008 ) AFM: a nanotool in membrane biology . Biochemistry , 47 , 7986 – 7998 . Moya , I. , Silvestri , M. , Vallon , O. et al . ( 2001 ) Time-resolved fluorescence analysis of the photosys-
tem II antenna proteins in detergent micelles and liposomes . Biochemistry , 40 , 12552 – 12561 . Østergaard , L. and Yanofsky , M.F. ( 2004 ) Establishing gene function by mutagenesis in Arabidopsis
thaliana . The Plant Journal , 39 , 682 – 696 . Paulsen , H ., Rümler , U . and Rüdiger , W . ( 1990 ) Reconstitution of pigment-containing complexes
from light-harvesting chlorophyll a/b-binding protein overexpressed in E. col i. Planta , 181 , 204 – 211 .
Robert , B. , Horton , P. , Pascal , A.A. and Ruban , A.V. ( 2004 ) Insights into the molecular dynamics of plant light−harvesting proteins in vivo . Trends in Plant Science , 9 , 385 – 390 .
Salinas , J. and Sanchez-Serrano , J.J. ( 2006 ) Me thods in Molecular Biology, Volume 323, Arabidopsis Protocols , 2nd edn . Totowa, NJ : Humana Press Inc .
Serdyuk , I.N. , Zaccai , N.R. and Zaccai , J. ( 2007 ) Methods in Molecular Biophysics . Cambridge : Cambridge University Press .
Schreiber , U. ( 1986 ) Detection of rapid induction kinetics with a new type of high frequency modu-lated chlorophyll fluorometer . Photosynth. Res. , 9 , 261 – 272 .
Staehelin , L.A. ( 2003 ) Chloroplast structure: from chlorophyll granules to supra−molecular architecture of thylakoid membranes . Photosynth. Res. , 76 , 185 – 196 .
Rupan_c04.indd 66 8/29/2012 5:38:41 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
‘ The hardest thing of all is to find a black cat in a dark room, especially if there is no cat .’ Confucius
5.1 The Nature of Light
In Chapter 1 defining life we mentioned that essential for it was the availability of unlimited
amount of a special sort of energy, that was easily transported in space, basically wireless,
and was specific . What kind of energy is it? Nature has chosen light. It travels with the fast-
est speed attainable in our Universe, it carries energy that can be ‘addressed’ to a certain
receiver, a type of molecule, hence the specificity of light energy. Some molecules are
totally indifferent to visible light, and therefore transparent, like water, the major constitu-
ent of life. On the other hand, certain molecules are coloured, hence interact directly with
visible light, as it will be explained later. Light is therefore the most convenient form of
energy for the life in the universe, a source of building up negative entropy: order, an essen-
tial attribute of all life forms.
The nature of light presented scientists with a serious challenge at the beginning of
the twentieth century contributing to the so-called crisis in physics resulted in emergence
of new fundamental disciplines explaining the nature of matter and light – the special and
Primary Processes of the Light Phase of Photosynthesis: Principles of Light Harvesting
in Antennae
5
Rupan_c05.indd 67 8/29/2012 5:37:44 PM
68 The Photosynthetic Membrane
general theories of relativity, quantum mechanics, quantum electrodynamics and the
physics of elementary particles – all nano- and even attoworld sciences. Whilst the mechanics
of the macroworld created by Newton assumed that particles and waves are different
manifestations of nature, particle coordinates, the movement trajectory and energy are pre-
cisely predictable obeying the relatively simple laws. These properties of our macroworld
are perfectly in agreement with our daily perception of matter around us. However, at the
beginning of the twentieth century physicists started to understand that classical Newtonian
mechanics was failing to describe the motions of the nanoworld; electrons, atoms, molecules
and most of all, light. The appearance of theoretical explanation of the nature of light
preceded the development of physical understanding of the nature of electricity and
magnetism. At first glance two independent, invisible force fields known by scientists
for some time and later found to be fundamentally connected in Faraday’s discovery of
electromagnetic induction were justified by Maxwell in his theoretical work. Electromagnetic
waves originate from an oscillating electric dipole. These harmonic oscillations of electric
field are followed by oscillations in magnetic field oriented perpendicularly to the former.
Both propagate in space with the speed of light (Figure 5.1 ):
,c λυ= (5.1)
where c is a speed of light (~3 . 10 8 m/c) l is wavelength (as in Figure 5.1 ) and u is a
frequency of field oscillations.
Maxwell’s approach provided fundamental grounds for the future that explained various
electromagnetic wave phenomena observed in nature. Now we can construct a scale of a
large range of electromagnetic waves, keeping the speed of light constant and varying
wavelength/frequency as shown in Figure 5.2 .
The magnitudes of the wavelengths span from hundreds of metres, for radio waves
to fractions of nanometres for ionizing radiation. The frequency changes greatly too: from
Megahertz for radio waves to Exahertz for X-rays. This is a colossal span of nearly 15
orders of magnitude, a remarkable feature of electromagnetic waves. Visible light inhabits
λ– Wavelenth
Oscillatingdipole
L, distance
M+
–
E
Figure 5.1 Electromagnetic wave: origin and propagation. M and E, magnetic and electric field amplitudes.
Rupan_c05.indd 68 8/29/2012 5:37:47 PM
Primary Processes of the Light Phase of Photosynthesis 69
a very narrow region in this scale of electromagnetic waves, just 400–700 nm. The fact
that we see these waves is due to a photophysical reaction they cause in the pigments of
the retina. Luckily we see only a narrow electromagnetic wave span, otherwise we
could be easily lost in the world of visible, radio, micro, infrared and UV radiation. But
photosynthetic organisms use only this region simply because its source, the Sun, has the
maximum of available for Earth electromagnetic emission in the visible region. Figure 5.3
shows the spectrum of solar radiation at the surface of Earth.
Figure 5.2 The spectrum of electromagnetic waves in nature and the place of visible light in it.
500 1000
Wavelength, nm
Ligh
t int
ensi
ty, r
el.
Figure 5.3 The spectrum of sunlight on land surface in an open field. (Courtesy of Eric Murchie.)
Rupan_c05.indd 69 8/29/2012 5:37:47 PM
70 The Photosynthetic Membrane
The maximum of Sun’s spectrum is positioned around 500 nm. Numerous troughs can
be seen particularly on the right side of the spectrum. They are Fraunhofer lines, absorption
due to atmospheric water and oxygen. This spectrum of radiation is all that feeds our
biosphere with energy. Visible light fluctuates with a colossal frequency of about 0.6 peta-
Hertz or 6.0 × 10 14 fluctuations per second! What kind of dipole fluctuates with such agility?
The answer is electrons of atoms and molecules. Hence, light radiation originates from the
nanoworld as the result of very fast movements of tiny particles. These particles, electrons,
can not only emit light but also can be set by light into oscillation of the same frequency.
This is a process of resonance similar to that observed in the macroworld of sound and
mechanical waves. One vibrating tuning fork can set off the vibrations of another, closely
positioned, provided they have the same resonant frequency. Light as an electromagnetic
wave is a carrier of a certain amount of energy that can be absorbed by matter and reemitted
giving it back into space. Hence the light-matter interaction is a process of constant energy
transformation, of moving charges and electromagnetic waves propagating in space. This
exchange of energy was thoroughly investigated by Planck ( 1900 ), who proposed that
it must be discontinuous, occurring in discrete portions of energy – quanta. Hence the
radiation energy and its interaction with matter should be quantized. Planck suggested that
electrons of atoms possess only a certain number of fixed energy levels, some of which can
be resonant with the energy of light:
υ= ,E nh (5.2)
where h is a constant (Planck’s constant, = 6.62 . 10 −34 J . s), n = 0, 1, 2 … The quanta of light
energy are called photons. Their energy depends only upon their frequency. The colour of
light defines its energy. Therefore, blue light (~450 nm) has higher energy than the red light
(~650 nm). The intensity of light is simply determined by the amplitude of waves or number
of photons. Hence, the colour determines the resonance energy required to excite certain
dipoles within the matter, whilst intensity of light means quantity of photons that carry this
fixed level of energy. Here we enter the special nature of light radiation, wave-particle
duality. It comes from the origins of light from the subnanoworld of atoms, where tiny
particle dimensions, colossal speeds of electron movements disobey the laws of classical
mechanics so that it becomes impossible to track precisely their coordinates and their
energies. They possess ‘fuzzy’ trajectories that can only be described by probability
functions. Some experiments like photoelectric effect and response of light to gravity
confirmed the particle properties of light. However, diffraction of light is a typical property
of wave. This conflict of light properties was addressed by De Broglie ( 1922 , 1923 ) who
proposed that such dualism is an inherent property of all matter, including the macroworld
we live in, implying an interesting generalization of the laws of fundamental physics in
macro- and nanoworlds. Indeed, also we consider ourselves as reasonably particular, not
wave-like creatures; we possess properties of waves, with the wavelength of:
,h
pλ =
(5.3)
Rupan_c05.indd 70 8/29/2012 5:37:48 PM
Primary Processes of the Light Phase of Photosynthesis 71
where p is the mechanical momentum ( p = mass × velocity ). According to this formula,
particles that move fast should possess shorter wavelength. Such formula is the basis of
the electron microscopy that by accelerating electrons decreases their wavelength far
beyond the optical diffraction limit enabling to achieve very high special resolution and
see various details of nanostructures including those of the photosynthetic membrane
(see Chapter 4).
5.2 Absorption of Light by Molecules
The movements of electrons within atoms and molecules are also described by a quantum
theory that provided a fundamental ground for understanding the evolution and relation-
ships between all elements in nature. Schrödinger ( 1925 , 1926 ) devised an equation that
could define the states of electrons in atoms. The solution of this equation provides a set of
discrete energy levels that correspond to electrons located on different atomic orbitals,
number and types of which are unique to an each element of matter, like hydrogen, carbon,
oxygen, and so on. Negatively charged electrons move in their orbitals around positively
charged nuclei. There is no emission of electromagnetic radiation until they change an
orbital, where they will have different energy value. Difference in the energy values gives
an electromagnetic radiation that can be emitted by atom. In a similar manner, if the
electromagnetic wave (light) will interact with electron and cause it to change the orbital,
the energy of this radiation will be absorbed and be equal to the difference between energy
levels after and before the act of absorption. Figure 5.4 shows two discrete orbitals of an
atom with energies E 1 and E
2 . The light with energy h u can potentially be absorbed if its
energy is equal to E 2 − E
1 – conditions of resonance. The change in the dipole moment
during transition is the second requirement of absorption to occur. Hence a certain degree
of asymmetry is required.
Absorption spectrum of a simple single transition will look, in most cases, like a line of
intensity corresponding to a single energy value. The line will have a finite width owing to the
poorly defined energy of the excited state that originates from the energy-time uncertainty
Energy
Inte
nsityExcited
state
Emission
Absorption
Groundstate
hν = E2–E1
hn
E1
E2
Figure 5.4 Light is a highly selective form of energy. On the right: the schematic presentation of the absorption spectrum corresponding to the scheme.
Rupan_c05.indd 71 8/29/2012 5:37:49 PM
72 The Photosynthetic Membrane
principle, proposed by Heisenberg ( 1927 ). It states that it is impossible to be equally precise
in determination of the energy of a particle and time it possess this energy (electron, etc.). The
longer the particle lives at a certain energy level, the more accurately this energy can be
defined. The shorter the particle stays in a certain energy state, the less defined will be its
energy. For a molecule, a system of various molecular orbitals exists that are occupied by
electrons. The higher occupied molecular orbital (HOMO) accommodates two electrons that
are optically active or react to the electromagnetic field of radiation. Upon absorption, excited
electron will occupy lowest unoccupied molecular orbital (LUMO). However, in addition to
electronic energy ( E el .
), energy of vibrations ( E vib .
) and rotations ( E rot .
) of atoms within a mol-
ecule will be added to the electronic energy highly enriching the spectrum of energy levels in
the ground (HOMO) and excited (LUMO) molecular states (Figure 5.5 ). In addition, the
translational movement on a molecule in space ( Ε trans .
) will also add to the total molecular
energy:
= + + +m el. vib. rot. trans.E E E E E
(5.4)
As a result, the absorption spectrum will be complex, much broader than the line of atomic
absorption spectrum. Interaction of motion of electrons with the electromagnetic fluctua-
tions in the immediate, condensed matter environment (vibrations and polarization by the
solvent) can result in homogenous broadening of absorption spectrum. In the biological
environment, water-based or hydrophobic membrane interior absorption spectrum will also
be broadened by variations in electronic energy due to variability of microenvironment of
individual molecules (inhomogeneous broadening) or existence of a number of different
types of molecular species with highly overlapping absorption spectra (sample heterogeneity).
Relaxation
VibrationPure electronic
energy
LUMO
Inte
nsity
HOMO
S1
S0
Fluorescence
1/energy
Vibronicband
Vibrationalband
FluorescenceAbsorption
Electronic
Rotation
Figure 5.5 The complex scheme of energy levels of polyatomic molecule. On the right: the schematic presentation of absorption and fluorescence spectra of polyatomic molecules.
Rupan_c05.indd 72 8/29/2012 5:37:49 PM
Primary Processes of the Light Phase of Photosynthesis 73
Therefore, absorption spectra of complex compounds can be as broad as several dozens of
nanometres and asymmetric due to a contribution of vibrations to their higher energy state
that is located on the left from the absorption maximum (see Figure 5.5 ). Absorption spectra
can therefore be a rich source of information about the concentration, identity of a molecule
or, in case of multicomponent system, number and types of compounds in a sample, their
immediate environment, interactions, and so on.
5.3 Fate of Absorbed Light Energy
After approximately 1 fs a number of events associated with the excited moving electron
can take place. First of all, according to the Frank-Condon principle, during the time of
electron movement into the excited state nuclei of molecule do not move, they are too inert
to follow the changes in orbital occupation by the excited electron. Following absorption,
nuclei will rearrange to adapt or rather to relax to accommodate the excitation. This
rearrangement is relatively fast, within 1 ps time scale. The reason for such rearrangement
is the term reorganization energy (Em) which appears as a result of the existence of a
coupling between electron and nuclear motions. What is the cause of the reorganization?
Well, excitation leads to changes in the spatial distribution of the electron. Since the
electrons have moved the nuclear arrangement of the ground state will now be subject to an
electrostatic force that was absent in the ground state and will rearrange accordingly.
Hence, nuclei ‘feel’ changes in electron energy as a result of absorption of light. Within
1 ps, nuclear coordinates will change in the excited state and a fraction of excited energy
will be lost nonradiatively as heat, whilst the electron is still in the excited, S1 state. This
energy loss is inevitable but relatively small. Following this relaxation a molecule can live
a few nanoseconds in the excited state with the excited electron occupying the LUMO.
Figure 5.5 shows absorption and fluorescence spectra of chlorophyll. The point of energy
where they overlap corresponds to the pure electron transition energy, the energy that is not
affected by nuclear motion. This is known as Frank-Condon or vertical transition. The
energy difference between maximum of absorption and maximum of emission is called
Stokes shift and is broadly equal to the amount of energy lost during nuclear reorganization.
For chlorophyll it is normally within 10 nm or ~200 cm −1 . The latter is in units that are
directly linear to the energy scale and called wavenumbers, ν = 1/ λ , calculated in cm −1 rather
than nm −1 . For a pigment absorbing at 660 nm, the wavenumber is 10 7 /660 = 15151.52 cm −1 .
If the fluorescence of this pigment is centred at 670 nm, then the Stokes shift will be:
10 7 /660 − 10 7 /670 = 226.15 cm −1 .
The lifetime of the excited state varies among different types of molecules. First of all it
is determined by t 0 , radiative lifetime: the fundamental molecular constant that can be
expressed as:
( )
τυ ε υ υ
=∫0 2 2
0
1,
2900n d
(5.5)
Rupan_c05.indd 73 8/29/2012 5:37:50 PM
74 The Photosynthetic Membrane
where ∫ e ( u ) d u is the integral over the molar extinction coefficient, u 0 is the frequency at
point of maximum intensity, n is the refractive index of the medium into which the light is
being emitted. Hence the radiative lifetime depends upon the molar extinction. Molar
extinction is determined by absorption cross-section, s , that is proportional to the oscilla-
tor strength, f . The latter depends upon the length of the transition dipole moment, as was
mentioned previously. These relations mean that the time the electron can potentially live
in the excited state is determined by the probability of transition of this electron into excited
state upon interaction with light. Parker ( 1968 ) calculated that molecules with a large
molar extinction of around 10 5 should possess the radiative lifetime of a few nanoseconds
that is more than a million times longer than the time required for electron to occupy the
excited state, S 1 . Clearly, absorption of light is a good means of temporarily storing energy.
Reemission of absorbed light, fluorescence is an obvious fate of absorbed energy, when
the excited electron returns to the ground state, losing its energy in the form of an emitted
photon: radiative energy dissipation . However, in reality this channel is often not a main
channel of de-excitation. Figure 5.6 shows four more alternative fates of electronic excita-
tion energy dissipation. Apart from fluorescence, internal conversion can take place, when
excited electron returns into the ground state losing the excitation energy via molecular
vibrations resulting in production of heat. Whilst the fluorescence rate constant, 1/ τ o for
chlorophyll is 0.06−0.07 ns −1 , the internal conversion rate, k IC
, is almost two times higher.
In the system with this internal conversion rate fluorescence lifetime will be not 15 ns ( t 0 ),
Fates of excitation energy
1 2Fluorescence
0.07 ns–1 0.14 ns–1 0.01 ns–1 20 ns–1 1–100 ns–1
Internalconversion
Tripletformation
5
4
1
S0
S1
2
3
T1
Photochemistry Energytransfer
KTKPKSTKICKf
3 4 5
Figure 5.6 Fates of excited energy in a molecule.
Rupan_c05.indd 74 8/29/2012 5:37:51 PM
Primary Processes of the Light Phase of Photosynthesis 75
but ( )1 / 4.8 nsf f ICk kτ = + = . This means that internal conversion shortens the excited
state lifetime and therefore the time light energy is being stored and is available for photo-
synthesis.
Another fate of excitation energy is intersystem crossing ( k ST
) that leads to the formation
of a triplet excited state. This takes place when the electron in the LUMO changes its
‘spin’. Therefore the remaining electron in the HOMO and the excited electron in the
LUMO have the same spin polarization, giving the whole molecule a net spin. Absorption
into a singlet state does not change the spin orbital momentum. Decreased coupling of the
excited electron with the rest of electrons, certain environmental factors, like presence of
strong fields, and so on can cause the change of spin leading to the transition of molecule
into the triplet state. The electron energy in the T 1 state is less than in the S
1 state. For chlo-
rophyll the event is less likely than the fluorescence with the rate constant of ~0.01 ns −1 and
a yield of a few percent. However, the triplet excited state can leave much longer than the
singlet one (hundreds of microseconds) with a transition to the ground state proceeding via
a slow radiative process known as phosphorescence.
The most interesting fate of energy from the photosynthesis point of view is photochem-
istry, light-triggered chemical reactions. This process occurs when excited electron leaves
the molecule from S 1 state to be donated to another molecule. The molecule that loses an
electron can be re-reduced within ~10 ms and be ready for absorption of another photon.
Therefore, there can take place as many as 100 photosynthetic charge separation cycles per
second. Such a process occurs in the reaction centres of photosystems I and II starting the
chain of electron transport events that further stabilize the energy of Sun, making the light
harvesting process less and less reversible and converting this energy into an energy of
stable chemical bonds of the universal biological fuel ATP and reducing agent NADPH
(see previous chapters). The rate of photochemical reactions in the photosynthetic reaction
centre chlorophylls can be as high as 20 ns −1 with a potential quantum yield of 20/(20 + 0
.07 + 0.14 + 0.01) = 99 %. This means that the initial energy stabilization stage of the light
phase of photosynthesis is extremely efficient. Energy of almost every photon can poten-
tially be converted into the energy of moving electrons.
5.4 The Need for the Photosynthetic Antenna and the Fifth Fate of Excitation Energy
Photosynthesis evolved in anaerobic atmosphere where organisms lived in shade to avoid
the damage by UV radiation. Under these conditions, when the light intensity can be as low
as 50 or even less μ M m −2 s −1 or (6.02 × 10 17 . 50) photons, one quantum is absorbed by
chlorophyll only per 1–2 seconds. These figures can be obtained using the relationship
between the absorption cross-section, s , and e − molar extinction:
( )310 10,
A
ln
N
εσ =
(5.6)
Rupan_c05.indd 75 8/29/2012 5:37:51 PM
76 The Photosynthetic Membrane
where N A is an Avogadro number. Absorption cross-section given in Å 2 and is for the e in
maximum chlorophyll absorption (~10 5 M −1 cm −1 ) ~ 4 Å 2 . Number of red photon absorption
acts per second will be equal to ( light intensity × s ) . Converting the light intensity from μ M
m −2 s −1 into μ M Ǻ −2 s −1 we obtain (0.3 × 4) = 1.2 photons per chlorophyll per second.
To utilize reaction centres more effectively the cheapest strategy in biosynthetic terms is
to synthesize light-harvesting pigment-proteins that increase area of cross-section of absorp-
tion and feed more quanta per second into the reaction centres, which can possess a turnover
rate of 100 per second (see previously). This means that there is a need to increase the rate of
energy delivery to the reaction centre by the order of two or even more orders of magnitude.
The first evidence of the existence of the photosynthetic antenna was obtained by experi-
ments of Emerson and Arnold some 80 years ago using fast (10 μs) flashes of light in order
to obtain one turnover (oxidation-reduction cycle, described previously) per flash (Emerson
and Arnold, 1932 ). The rate of turnover was found to reach 100 per second. They also found
that approximately 2500 chlorophylls are able to cause the evolution of one oxygen mole-
cule. Despite this, the efficiency of the light use corresponded to one molecule of oxygen
evolved per eight light quanta that were absorbed. According to the law of photobiology, one
quantum can drive one photochemical act. Therefore, one quantum absorbed in the popula-
tion of ~300 chlorophylls in the photosynthetic membrane causes one redox reaction (turno-
ver) in the reaction centre. This observation led to an unexpected conclusion that one reaction
centre of photosynthesis must be served somehow by ~300 molecules of chlorophyll. The
conclusions of Emerson and Arnold ( 1932 ) have been confirmed in several independent
experiments dealing with the estimation of effective cross-sections of the photosynthetic
reaction centres as well as the analysis of the ratio between various electron transport chain
components (cytochromes, reaction centre chlorophylls, etc.) and the total chlorophyll in the
membrane. There were simply too many chlorophyll molecules that seem to have no photo-
chemical activity at all. These observations led to emergence of the concept of the photosyn-
thetic unit, where majority of pigments are ‘serving’ one reaction centre with the absorbed
energy of light. But how can this process occur? What events should take place among the
pigments? So far we have considered the fates of excitation energy concerning one molecule.
However, the photosynthetic membranes are densely populated with proteins that carry pig-
ments at high concentration, meaning that they can potentially interact with each other.
Indeed, close positioning of pigments within each other in the photosynthetic membrane
is one of the major conditions at which these pigments can exchange excitation energy of
electrons. This process is called energy transfer and is the fifth channel of excited state
energy dissipation in chlorophyll. This process is called inductive resonance and was quan-
titatively described in Förster’s theory (1948). The simple resonance energy transfer
scheme is described by Equation 5.7:
+ = +* *,D A D A (5.7)
where D * and D is a molecule that gives energy ( D , donor) in excited and ground states,
respectively; A * and A is a molecule that receives energy ( A , acceptor) in excited and
Rupan_c05.indd 76 8/29/2012 5:37:52 PM
Primary Processes of the Light Phase of Photosynthesis 77
ground states, respectively. The event of energy transfer is similar to the phenomenon of
electromagnetic induction that can be observed in the macroworld. Molecules behave as
electromagnetic field oscillators that could emit, absorb, or indeed, give the electromag-
netic energy to each other. Förster ( 1948 ) derived the formula that enabled him to obtain a
rate constant for this energy transfer, k T :
6
0 ,T f
Rk k
R
⎛ ⎞= ⎜ ⎟⎝ ⎠
(5.8)
where k f is the fluorescence rate constant of a donor (D), R 0 is a distance between donor and
acceptor molecules at which the efficiency of energy transfer is 50% of the maximum, R is
the actual distance between donor and acceptor molecules. Remarkably, the Förster transfer
rate is steeply dependent on the distance between pigments, since it is proportional to the
sixth degree! R 0 was found to depend upon a few key parameters: (a) mutual orientation of
molecules ( k ), more accurately the direction of electronic transitions between states (transi-
tion dipole moments); (b) fluorescence yield of the donor ( f D ); (c) the refraction index of the
medium ( n ); and (d) the overlap between the fluorescence spectrum of donor ( f D ) and absorp-
tion spectrum of acceptor ( e A ) expressed via an energy overlap integral ( J = ∫ f
D e
A u − 4 d u) :
( ) 2
6 4
0 6 4
9000 10~ ,
128
DD A
lnR f d
n N
κ ϕε υ υ
π−∫
(5.9)
where u is the wavenumber, and N is Avogadro’s number. The orientation factor k = 2/3 in a
situation where pigments are randomly oriented, but can range from 0–4. For randomly ori-
ented chlorophyll molecules R 0 was reported to be about 80 Ǻ. Taking into account the size
of a chlorophyll molecule (~8 Ǻ) this is a very significant distance. If R ~ 25 Å , the k T will be
approximately 100 ns −1 , this is comparable with the photochemical rate constant. Therefore,
the energy transfer between pigments can be extremely efficient, provided they are oriented
and positioned in space appropriately and their energy overlap integral is reasonably large.
This means the pigments should be spectrally not too different, having similar excited state
energies. The other implication of Förster theory is that the rates of forward and backward
energy transfer from the acceptor to the donor can be similar, or can indeed be very different.
The latter case will take place when the excited state energy of acceptor is reasonably smaller
than that of a donor. In this case the D-A energy transfer rate will be faster than A-D energy
transfer rate. Figure 5.7 illustrates this idea showing absorption and fluorescence spectra of
the pair of pigments. It is clear that in this case the forward energy transfer rate should be at
least an order of magnitude higher than the back transfer rate. Here, the excited state of
acceptor is lower than that of a donor. When these levels are close, then the mentioned rate
constants become less different, since the respective overlap integrals should be less differ-
ent. At some point of shift between the excited state energies of donor and acceptor the
overlap integral of back energy transfer will become zero and this transfer will be impossible,
Rupan_c05.indd 77 8/29/2012 5:37:52 PM
78 The Photosynthetic Membrane
only forward transfer will take place. In reality it may not be a likely event but ideally this is
a case of ‘trapping’ or localization of excitation energy on a single molecule.
It is important to mention that in a solution of pigments, when their average distances are
about 100 Ǻ their molar concentration should be about 2 mM. This concentration is already
high enough to observe reasonably strong concentration quenching described by Beddard
and Porter ( 1976 ). This energy de-excitation channel was attributed to molecular collisions
with each other and transient or sometimes stable formation of quenching pigment associa-
tions. Hence, effective energy transfer among 300 chlorophylls of the photosynthetic unit
derived from experiments of Emerson and Arnold was in danger of being undermined by
efficient energy dissipation due to the presence of concentration quenching. Indeed, as was
described earlier in this chapter, the molar cross-section of chlorophyll is small, 4 Ǻ 2 , and
the frequency of photon absorption at low light intensity is only about 1 per second. In this
situation, photoinduced charge separation in photosynthesis is far from being optimum,
since reaction centre turnover rate is ~100 per second, a hundred times faster than photon
absorption by one chlorophyll molecule. Hence a requirement for the action of many more
pigments emerges, as was indeed proved in experiments of Emerson and Arnold ( 1932 ).
This collection of photochemically inactive chlorophylls that feed the reaction centre with
excitation energy is called the photosynthetic antenna or light harvesting antenna .
Schematically the photosynthetic antenna is often shown as a funnel (Figure 5.8 ) channel-
ling energy of absorbed light in the form of electronic excitation within its pigments to the
reaction centre pigments that are photochemically active, able to donate electrons into the
electron transport chain. Antenna pigments must be organized efficiently in order not to
lose too much energy into various dissipative channels that were described earlier. The only
channel that is important is the energy transfer between antenna pigments, its efficiency
and directionality, so that the excitation could find its way relatively quickly into the reac-
tion centre. But how can those antenna pigments avoid concentration quenching if they are
Df
JAD
JDA
De Ae Af
Figure 5.7 Relationship between Förster spectral overlaps in cases of forward (JAD) and backward (JDA) energy transfer between the pair of donor (D) and acceptor (A) pigments. e and f indicate absorption and fluorescence spectra respectively.
Rupan_c05.indd 78 8/29/2012 5:37:53 PM
Primary Processes of the Light Phase of Photosynthesis 79
at high concentration in the photosynthetic membrane? Some decades after Emerson and
Arnold’s discovery (1932), biochemical studies revealed a number of pigment protein com-
plexes that build the antenna of photosystems (see Chapter 3). Association of pigments
with protein was certainly a solution. The last paragraph of this chapter, as well as Chapter
6, will explain this in detail and give examples.
The requirement for pigment interactions in the antenna is an obligatory feature or prop-
erty. Förster resonance energy transfer occurs in a condition when interpigment dipole-
dipole interaction energy is much smaller than the energy of their interaction with
environment (solvent). Normally at this condition vibrational relaxation of the excited mol-
ecule (see Figure 5.5 ) takes place before energy transfer can occur. However, it was
observed in solids or molecular aggregates of pigments, where pigment molecules can be
positioned much closer to each other and in particular regular orientations, interpigment
interaction energy can prevail over the energy of their interaction with environment.
Davydov ( 1964 ) formulated a theory of molecular excitons in solids that could explain a
number of important spectral phenomena that occur among chlorophylls in the photosyn-
thetic membrane. At certain intermolecular distances pigments can become excitonically
coupled. The energy of this coupling is described by the following equation:
1 2
12 3
12
,JR
μ μ=
(5.10)
where | μ 1 | and | μ
2 | are the magnitudes of the transition dipole moments of molecule 1 and 2
and | R 12
| is the intermolecular distance (measured as the separation of the centres of mass of
Heat
Fluorescence
AntennaTriplet
Photosynthesis
RC
Figure 5.8 The light harvesting antenna concept: the funnel of absorbed light energy for the photosynthetic reaction centre.
Rupan_c05.indd 79 8/29/2012 5:37:53 PM
80 The Photosynthetic Membrane
the two molecules). In case of particular orientation of the transition dipole moments of the
two pigments splitting of the S 1 energy level (Davydov’s splitting) takes place, even if the
absorption spectra of the both pigments are identical. The extent of splitting is determined
by J 12 . The mutual dipole moment orientation defines the resulting spectrum appearance or
relative amplitudes of splitting components, one of which is of lower and the other of higher
energy then the energy of the monomeric pigment. Such an excitonically- coupled associa-
tion of molecules behaves as a single excitation holding unit. The exciton by definition is
delocalized across two or more pigments or, indeed, pigment domains. This excitonic state
persists until interactions of the component molecules with their respective environments
destroy the coherence that exists between molecules involved in the state, leading to emer-
gence of localized excitonic states or excitations of only one molecule that can be spread to
other pigments via the inductive resonance mechanism to other excitonically coupled
domains triggering the complex energy migration process. The delocalized excitonic states
occur mainly in solids, where pigments are well-organized and the environmental effects
leading to the loss of coherence of excited states are minimized. In biological systems such
as the photosynthetic membrane where pigment environment does not correspond to either
the liquid or solid phase medium, the coherent delocalized excitonic states are rare or short-
lived. They are frequently broken into localized excitons that migrate among pigment
domains or pigments, often by the inductive resonance process described earlier. Therefore,
the biological ‘soft’ matter of the photosynthetic membrane provides apparently an entropi-
cally-optimized environment where pigments in the photosynthetic unit are concentrated but
not entirely free to diffuse to encounter unwanted concentration quenching. They are not
entirely fixed either, to provide flexible excitation energy delocalization, migration and
delivery to the reaction centre. Compromise between excitonic states and the possibility of
the occurrence of highly unidirectional Förster energy transfer emerges as one of the key
features of photosynthetic unit organization. This compromise was recently addressed by
application of Redfield approaches to theoretical modelling of rather concentrated and het-
erogeneous pigment systems. Indeed, pigment organization in light harvesting antenna is not
as perfect as in a crystalline solid state. There are clusters of closely interacting pigments
separated from one another by larger distances. Therefore, the energy migration modelling
is more complex and includes excitonic as well as inductive resonance transfer features. In
addition, the protein environment and high pigment concentration are likely to modulate
internal conversion dissipative channel, which currently is very difficult to experimentally
assess and model.
As the distance between pigments becomes very short so that their electronic wave-
functions start to overlap with emergence of shared molecular orbitals promoting the
likelihood of yet another mechanism, Dexter electron exchange excitation transfer. This
transfer is a process that two molecules bilaterally exchange their electrons (Figure 5.9 ).
Indeed, whilst during inductive resonance, there is no substance transfer; Dexter transfer
requires the movement of electrons between two interacting molecules. Hence, this pro-
cess can be qualified as much localized electron transfer with zero-net charge transferred
within the molecular associate. It is unlikely to take place among large numbers of mol-
ecules in the photosynthetic unit of chlorophylls but rather occurs in specific minor cases
Rupan_c05.indd 80 8/29/2012 5:37:54 PM
Primary Processes of the Light Phase of Photosynthesis 81
that can be functionally very important, such as photoprotective excess energy dissipation
that will be described in Chapter 9. Unlike the six-power dependence of Förster energy
transfer rate, the rate of the Dexter mechanism decays exponentially when the distance
between pigments increases:
−2
~ ,DAR
LTk Je
(5.11)
where J is the energy overlap integral, as in Equation 5.9 and L is the sum of van der Waals
radii of the two molecules. This process occurs at faster rates than inductive resonance
energy transfer and is particularly significant for certain pigment-pigment associations and
when the excited state lifetime is very short (<1 ps) by nature of a pigment (see the later
description of xanthophylls energetics). The short excited state lifetime as well as very
small or zero value of transition dipole moment makes all other mechanisms of energy
transfer described previously rather unlikely (see Equations 5.9 and 5.10). Dexter transfer
does not depend upon the transition dipole moment and therefore can be a unique if not the
only way to transfer excitation between specific types of molecules, like carotenoids and
chlorophylls, positioned within van der Waals distance and closely interacting with each
other (see for example, Figure 3.5).
5.5 Photosynthetic Antenna Pigments
As a result of evolution nature has selected a relatively small group of pigments to serve in
the photosynthetic antenna: chlorophylls, phycobilins and carotenoids. Only very few of
them serve as photochemically active reaction centre pigments. The latter are chlorophyll,
in plants and algae, and bacteriochlorophyll, in photosynthetic bacteria. The antenna
pigments are more versatile. The reason for it will be discussed later in this chapter. The
photosynthetic antenna pigments of plants include chlorophylls a and b and several types
of oxygenated carotenoids, xanthophylls.
Figure 5.9 Schemes of Förster (inductive resonance) and Dexter (electron exchange) mechanisms of energy transfer.
Rupan_c05.indd 81 8/29/2012 5:37:54 PM
82 The Photosynthetic Membrane
5.5.1 Chlorophylls
Chlorophylls are global pigments. Figure 5.10 shows a NASA satellite image of chlorophyll
a redistribution in the Biosphere made by SeaWiFS (sea-viewing wide field-of-view sen-
sor). The principle of this device is based upon reflection/colour spectral measurements
and enables to quantify chlorophyll concentration. Enormous areas of land and oceans
contain photosynthetic organisms that carry chlorophyll a giving them characteristic col-
our. The highest chlorophyll concentration was detected in polar waters full of microscopic
algae, like diatoms. In addition, equatorial waters and waters around the shores also contain
plenty of photosynthetic organisms. On land, the most intense chlorophyll signal was
detected from the areas of tropical forests and the vast lands of North American and
Siberian forests.
Why did chlorophyll become a major photosynthetic pigment? One of the reasons is
that, as was mentioned earlier, it possesses very high molar extinction of about 10 5 and
large absorption cross-section of 4Ǻ 2 . This makes it a very effective light capturer. The
radiative lifetime is reasonably long, ~15 ns, and the excited state lifetime in dilute solu-
tions is about 5 ns: nearly three orders of magnitude longer than the rate of photochemical
reaction or energy transfer, meaning that it is an effective transient energy storage pigment.
In addition, chlorophylls possess electronic first excited state (S 1 ) energy of around 1.8 eV
or ~42 kcal mol −1 . This is equivalent to the energy of nearly six molecules of ATP. This
means that the energy initially stored in chlorophyll in the excited state is large enough to
drive the process of the light phase of photosynthesis that ends with accumulation of ATP.
Structurally, chlorophylls are also suitable molecules since, as was discussed in Chapter 3,
they are amphiphilic, lipid-like molecules, natural to the membrane or more accurately,
membrane-bound protein environment.
The part of a chlorophyll molecule that is involved in photon absorption is a macrocycle:
a derivative of a tetrapyrrole, porphyrin ring that contains a coordinated magnesium atom
in its centre (Figure 5.11 ). In chlorophyll the ring is modified by oxidation to make a
chlorin ring. In addition a fifth, unconjugated ring is added by derivation from propionic
acid (C13) adjacent to the ring III. Chlorophyll’s a C7 atom is methylated, whereas in chlo-
rophyll b the group is replaced by a formyl group (Figure 5.12 ). Chlorophyll rings are
normally labelled with Roman numerals I–V clockwise. The hydrophobic phytol tail is
attached to the fourth ring. Phytol is very flexible and therefore can adopt various positions
and orientation relative to the chlorin ring. The plane of the chlorophyll is typically said to
define a local xy-plane where the x- and y-axes are defined so that they pass through rings
II–IV and I–III respectively (Figure 5.12 ). The chlorin ring of chlorophyll is the actual
chromophore , the light-absorbing part of the molecule. This chromophore is defined by 24
π -electrons which are delocalized across the conjugation path defined by the alternating
single/double carbon-carbon bonds which make up rings I-III. Laying above these occu-
pied π -orbitals is an identical number of unoccupied π -orbitals. Transitions between these
occupied and unoccupied orbitals, particularly between those near the band gap between
the Highest Occupied Molecular Orbital (HOMO) and the Lowest Unoccupied Molecular
Orbital (LUMO), have energies comparable to those of visible light. For illustrative
Rupan_c05.indd 82 8/29/2012 5:37:54 PM
Figu
re 5
.10
Glo
bal r
edis
trib
utio
n of
chl
orop
hyll
a . R
eprin
ted
with
per
mis
sion
from
http
://o
cean
colo
r.gsf
c.na
sa.
gov/
SeaW
iFS/
. © S
eaW
iFS
Proj
ect/
NA
SA. (
See
Plat
e 5.
10 in
col
our
plat
e se
ctio
n.)
Rupan_c05.indd 83 8/29/2012 5:37:54 PM
84 The Photosynthetic Membrane
purposes schematic diagrams of the HOMO and LUMO of chlorin are shown in Figure 5.11 .
These orbital functions (or more correctly the square of these functions) represent
probability distributions, indicating the likelihood that the electron will be located at a
certain point around the ring.
The absorption spectrum of chlorophylls has two regions in the visible light spectrum.
One is located in the red part and corresponds to the absorption into the first excited state,
S 1 (Figure 5.13 ). The other region is in the blue site of the visible light spectrum and cor-
responds to the absorption into the second excited state, S 2 . It is often called the Soret
region or Soret band. The green colour of chlorophyll is due to reflection of green light that
is not absorbed by the pigment. There are two absorption peeks per each of excited state
regions, red and Soret, of chlorophyll reflecting the fact that the transition dipole moments
Chlorin
HOMO LUMO
Porphyrin
3
2
20
19
1817 15
14
13
12
11
10
9
8
7
65
NH
I II
IV III
HNN
N
4
16
1
Chlorin
3
2
20
19
1817 15
14
13
12
11
10
9
87
65
NH
I II
IV III
HNN
N
4
16
1
Figure 5.11 Structures of porphyrin and chlorin rings ( top ). The delocalized p -electron path is highlighted by dots. Probability of one electron location in the chlorin ring on the highest occupied molecular orbital (ground state) and lowest unoccupied molecular orbital (excited state) (bottom). (Courtesy of Christopher Duffy.)
Rupan_c05.indd 84 8/29/2012 5:37:56 PM
Mg
N
Y
VO
O
O
132 carbonyl
131 carbonyl
173 carbonyl
Polar groups1
23
Hydrophobictail
3
2
1
O
H
Chlorophyll-aH3C
* *
*
Chlorophyll-b O
H
2O
NN
N
X
I
II
III
IV
Figure 5.12 Structural formula of higher plant chlorophylls with indication of polar groups of chlorophyll involved in binding into the antenna protein environment. (Courtesy of Christopher Duffy.)
Abs
orpt
ion
Chl a
Chl b
QY (S1)
Chl b
Chl a
Qx
Wavelengh, nm
Soret(S2)
Phycocyanin
Fluorescence
S1
S2
S0
2 10–9S
10–12S
700600500400
Phycoerythrin
Carotenoids
Figure 5.13 Absorption spectra of chlorophyll a and b . Also schematically shown are regions of absorption of other photosynthetic pigments, carotenoids and phycobilins in order to demonstrate how light harvesting pigments of different photosynthetic organisms share the visible spectrum of Sun.
Rupan_c05.indd 85 8/29/2012 5:37:57 PM
86 The Photosynthetic Membrane
lie along either the x or y molecular axis (Figure 5.13 ). The Q Y transition is much stronger
then Q X and is often referred to as the red absorption band. The vast majority of spectro-
scopic studies in the field of photosynthesis focus on this particular transition. The Soret
band possesses stronger extinction than the red band. However, the excited state is short-
lived, only ~1 ps (see Figure 5.13 ). This is due to a strong nonradiative relaxation via
vibrational transitions into the S 1 state. Naturally, during this process some energy is lost as
heat; however, since S 1 receives the energy from S
2 Soret absorption does contribute to light
harvesting. From S 1 energy can be dissipated via various channels described earlier in this
chapter. The fluorescence spectrum of chlorophyll is also displayed in Figure 5.13 . In part
it looks like a mirror image of red absorption. The Stokes shift is about 7 nm (~140 cm −1 ).
The vibronic satellite is normally ~15% of the main band maximum and is shifted into the
red by ~ 60 nm (~1200 cm −1 ).
Chlorophyll b is slightly less abundant than chlorophyll a and is present only in the light
harvesting antenna complexes. Reaction centre complexes and their core antenna compo-
nents (see Chapter 3) do not bind this pigment. The chlorophyll- b Soret band is red-shifted
relatively to that of chlorophyll a and the red band is blue-shifted. Therefore, simple struc-
tural modification (see Figure 5.12 ) creates a new pigment with a slightly different absorp-
tion profile. This means that chlorophyll b makes light harvesting antennae absorb light
over a broader spectral region than would be possible if the antennae bound chlorophyll a
alone. This is known as the spectral broadening of absorption cross-section. The funnel size
becomes larger (see Figure 5.8 ), hence more excitations per second can reach the reaction
centre (a cup in Figure 5.8 ). In addition, since the chlorophyll b Qy excited state energy is
higher than that of chlorophyll a the energy transfer between these pigments is highly uni-
directional (see Figure 5.7 ). Indeed, chlorophyll b to chlorophyll a transfer rate will be
much faster than the reverse transfer because the overlap integral in the b-a transfer rate
will be much higher than that corresponding to a-b transfer. This is another fundamental
advantage of having pigments with differing excited state energies. They can contribute
potentially to the directionality of the energy transfer in antenna analogous to the function
of gravity in the funnel displayed in Figure 5.8 .
The large chlorin ring has a potential to interact, via polar groups, with the protein envi-
ronment of antenna, as was already mentioned in Chapter 3. These groups are magnesium
atoms that can be involved in co-ordination interaction with certain polar aminoacids, like
histidine. In addition, three carbonyls, 13 1 C, 13 2 C (ether) (ring V) and 17 3 C (phytol
etherification site to ring IV) can potentially be involved in the hydrogen bonding. The
scheme in Figure 5.12 displays the principal potential sites of chlorophyll molecule anchor-
ing within the protein environment. The hydrophobic, flexible phytol tail will partition into
hydrophobic aminoacid domains or interact with phytols of other chlorophylls. Magnesium
could strongly anchor the centre of the chromophore to the protein and three carbonyls
could be involved in determining its orientation in order to adapt the direction of the transi-
tion dipole moments according to the energy transfer pathway requirements within an
antenna complex. Early biochemical studies on isolated antenna complexes revealed that it
was very difficult to remove chlorophyll from protein using only non-ionic detergents.
Ionic detergents, on the other hand would remove the pigment often leaving it free from
Rupan_c05.indd 86 8/29/2012 5:37:58 PM
Primary Processes of the Light Phase of Photosynthesis 87
magnesium in a form of phaeophytin. Hence, chlorophyll interacts reasonably strongly
with protein but not via covalent forces. Therefore, some conformational freedom is left to
enable a fine orientation of the pigment within its environment. Bound to antenna protein,
chlorophyll possesses a somewhat red-shifted spectrum in comparison to the pigment in
organic solvents like ethanol or acetone. Whilst in the latter state the maximum in the Q Y
absorption region occurs at about 662 nm, in the antenna environment it could be red-
shifted by up to 50 nm. Different microenvironments cause red-shifts of different ampli-
tudes, creating a range of chlorophyll spectral forms . Therefore, the absorption spectra of
antenna complexes are always red-shifted and broader that the spectra of isolated pigments
in solvents (see the next chapter). This broadening due to heterogeneity of the chlorophyll
environment is another beneficial feature of antenna organization, since it broadens the
spectral range of absorbed light, enhancing the cross-section and contributing to direction-
ality of the energy transfer.
5.5.2 Xanthophylls
Xanthophylls are one of the most abundant groups of pigments found in Nature. Every year
more than 100 million tonnes of them are being synthesized in the biosphere. Several hun-
dred molecular species of xanthophylls are currently known to exist. It is a functionally
versatile group that can act as powerful antioxidants, vitamin precursors, natural colorants
and odorants and therefore it is not surprizing that they are of global economic significance
contributing hundreds of millions of dollars to yearly trade.
Higher plant antenna xanthophylls, lutein, neoxanthin, violaxanthin and zeaxanthin are
among the most common xanthophylls on our planet (Figure 5.14 ). Neoxanthin is the most
polar of these xanthophylls, possesses a normally highly reactive allene group found rarely
in carotenoids. Neoxanthin is found to be almost exclusively in the 9- cis conformation in
nature. The significance of this structure is yet to be discovered. Violaxanthin, in contrast,
is a very symmetric molecule, containing two epoxy oxygen atoms on the end-ring groups.
Lutein is less oxygenated than violaxanthin and is asymmetric. It possesses two different
types of end-groups, β - and ε -rings, which differ by the position of the double bond within
the ring. Zeaxanthin, an isomer of lutein, is symmetrical. Zeaxanthin possess two β -ring
end-groups. Reversible de-epoxidation of violaxanthin into zeaxanthin occurs in the pho-
tosynthetic membrane, and is dependent on the light environment. As a result, an interme-
diate xanthophyll, antheraxanthin, which carries only one epoxy group, is transiently
formed. The variations in the end group structure and conformation are determined by the
carotenoid biosynthesis enzymes. These structural features are likely to determine localiza-
tion as well as functions of these xanthophylls in vivo .
Varying numbers of conjugated carbon double bonds in xanthophyll molecule affects
their delocalized excited state π -electron energy and therefore defines the colour. Indeed,
optical spectroscopic analysis of carotenoids is based on the fact that the 0-0 energy of the
first optically allowed transition is inversely correlated to the number of conjugated carbon
double bonds in the backbone of the molecule. Therefore, in theory, violaxanthin, lutein
and zeaxanthin, which have 9, 10 and 11 conjugated bonds should have all different
Rupan_c05.indd 87 8/29/2012 5:37:58 PM
Lute
in
Zea
xant
hin
0–
0
0–
1
0–
2
Vio
laxa
nthi
n
Neo
xant
hin
520
500
480
460
S2
Wav
elen
gth,
nm
440
420
400
0.0
0.1
0.2
0.3
0.4
0.5
0.7
0.8
0.6
0.9
1.0
1.1
1.2
1.3
Absorption
OH
HO
5'3'
1'
7'9'
11'
13'
15'
1513
119
71
53
OH
HO
HO
OO
5'3'
1'
7'9'
11'
13'
15'
1513
119
7
1 53
OH
OH
O
5'
5'
3'
3'
1'1'
7'
7'
9'
9'
11'
13'
15'
1513
11
Vio
laxa
nthi
n
Neo
xant
hin
OH
*
HO
Zea
xant
hin
Lute
in
9
11'
13'
15'
1513
119
7
15
3
15
7
3
Figu
re 5
.14
Xant
hoph
ylls
of h
ighe
r pl
ant p
hoto
synt
hesi
s. S
truc
tura
l for
mul
ae (
left )
and
abs
orpt
ion
spec
tra
in e
than
ol (
right
).
Rupan_c05.indd 88 8/29/2012 5:37:58 PM
Primary Processes of the Light Phase of Photosynthesis 89
absorption maxima positions of their second excited sate (Figure 5.14 ). The S 1 (or 2A
g ) is
symmetry forbidden with the transition dipole moment equal to zero. Hence the molar
extinction is zero. Neoxanthin has the same number of the conjugated double bonds as
violaxanthin, 9. However, the cis -conformation increases the energy of excited state lead-
ing to a slightly blue-shifted 0–0 transition. In addition to this shift, a characteristic cis -
band emerges at around 310–330 nm, which can also be used for distinguishing different
cis - isomers of the same carotenoid. Absorption maxima of lutein and zeaxanthin are fur-
ther red-shifted. One extra conjugation shifts the carotenoid absorption maximum to about
6 nm (~240 cm −1 ). Interestingly, unlike the chlorophyll absorption, spectrum of xantho-
phyll is much broader with a characteristic three band structure corresponding to signifi-
cant contribution of 0−1 and 0−2 vibrational transitions originating from a strong coupling
of electronic to vibrational transitions making the latter as strong the 0−0 transition
(Figure 5.14 ). The excited states of the xanthophylls are very short-lived in comparison to
chlorophyll, only a few hundred of femtoseconds, around four orders of magnitude shorter
then in chlorophyll. This makes xanthophylls potentially not very efficient light harvesting
molecules unless they engage in ultra-fast energy transfer with chlorophylls. This point
will be discussed later. As to the molar extinction, it is almost as high as for chlorophyll a
and the broad absorption spectrum as well as its complimentary coverage of part of a chlo-
rophyll Soret band absorption makes xanthophylls potentially good light harvesting pig-
ments (Figures 5.13 and 5.14 ).
Xanthophyll absorption is very sensitive to environment. Solvents with different polari-
ties and refractive indices significantly affect their optical properties. Because of the pro-
portionality of refractive index to the ability of a solvent molecule to interact with the
electric field of the solute, the excited state energy of a molecule is sensitive to it reflecting
in the effect on the absorption maxima positions. Figure 5.15 ( top ) shows three absorption
spectra of the same xanthophyll, lutein, dissolved in isopropanol, pyridine and carbon
disulfide. The solvent refractive indexes in this case were 1.38, 1.42 and 1.63 for the three
mentioned solvents, respectively. 0−0 transition maximum changes from 473 to 505 nm,
which is 32 nm or corresponds to approximately 1340 cm −1 or nearly 4 kcal mol −1 of energy.
This is an important example of how the molecular environment can dramatically affect the
excited state energy. Another spectral development can take place if the solvent mixture is
not able to maintain pigments in solute state. In this case formation of dimers and higher
aggregates of all plant xanthophylls is a very common phenomenon. Ethanol-water mix-
tures represent a good binary solvent system, which could not only yield xanthophyll
aggregates but also test hydrophobicity of these pigments using the solvent ratio at which
aggregation takes place (more detail will be provided in Chapter 8). Figure 5.15 (bottom)
displays three types of zeaxanthin absorption spectra: the pigment in solution, H- and
J-type aggregates. In H-type aggregate the transition dipole moments of the two xantho-
phylls molecules are in parallel orientation to each other. Since they are oriented along the
xanthophyll conjugated carbon backbone the molecular arrangement is called sometimes a
‘card-pack’. In J-type aggregate the transition dipole moments are arranged in a sequence,
called ‘head-to-tail’, as shown in Figure 5.15 . The H-type of aggregation causes a very
strong blue shift of the absorption spectrum duet to the domination of absorption of the
Rupan_c05.indd 89 8/29/2012 5:37:58 PM
90 The Photosynthetic Membrane
high energy component of excitonic splitting (see the previous paragraph). J-type of aggre-
gation leads to the appearance of a red-shifted excitonic component. Here, the resulting
spectral variation in the measured mix of H- and J-type aggregates of zeaxanthin shown in
Figure 5.15 of more than 150 nm (~7500 cm −1 , 21 kcal mol −1 or just 3 ATP molecules), a
very significant difference, indeed. It is therefore important to bear in mind the dependency
of the carotenoid spectrum upon properties of the environment for in vivo analysis, which
is based on application of optical spectroscopies. This approach is often the only way to
study the composition, structure and biological functions of carotenoids. Spectral sensitivity
0.0400 420 440 460
Wavelength, nm
480 400
470 505∼1400 cm–1
380
H
Zeaxanthin
535
J
∼7500 cm–1
520 540
350 375 400 425 450
Wavelength, nm
500475 525 550 575 600
0.2
0.4
LuteinAbs
orpt
ion
Abs
orpt
ion
0.6
0.8
0.0
0.2
0.4
0.6
0.8
1.0
Figure 5.15 Absorption spectra of lutein in different solvents ( top ) and zeaxanthin is different states of aggregation ( bottom ).
Rupan_c05.indd 90 8/29/2012 5:37:58 PM
Primary Processes of the Light Phase of Photosynthesis 91
of xanthophylls to the medium could be a property to use for gaining vital information on
their binding sites and dynamics.
This presence of symmetric cyclic end-groups carrying oxygen atoms increases co-
ordination of the xanthophyll molecule in the membrane determining interaction patterns
with protein membrane-spanning helixes, as will be shown in the next chapter. Hydrogen
bonding plays an important role in the same way as the hydrogen bonding of chlorophyll
carbonyl groups to the protein environment. Xanthophylls bound to not only antenna but
other nonrelated proteins are likely to play important, yet currently not well-understood,
structural functions, similar to those of membrane lipids and beyond. Interestingly, lutein
and zeaxanthin have also been found in retina of humans and some primates. It is possible
that these carotenoids possess some universal photophysical properties essential for both,
photosynthesis and vision.
5.6 Variety and Classification of Photosynthetic Antennae
The photosynthetic antenna of different classes of organisms varies a lot in its pigment com-
position, concentration, number of protein subunits and their interaction with the reaction
centre. The reaction centres themselves are far more conservatively organized than antennae.
Here the crucial factor that led to the diversity of antenna systems is light environment.
Availability of light for different photosynthetic organisms, adaptations to very low light
environment or to specific spectral compositions of available light exerted a selection pres-
sure during the evolution of the early life on our planet. The first photosynthetic organisms
were prokaryotes, various types of bacteria that utilize light energy to drive their metabolic
processes. Their antenna systems vary considerably. Photosynthetic bacteria use different
types of bacteriochlorophyll as the major photosynthetic pigment in the reaction centre as
well as antenna. Xanthophylls are also present. The structure of one of them, rhodopsin glu-
coside, was already shown in Chapter 4. The S 1 absorption energy of bacteriochlorophyll is
localized in the infrared region of 800–900 nm. The structure of bacterial antenna system is
very different from the structure of antennae of higher plants. Some comparison of these will
be presented in the next chapter in order to understand evolutionary patterns in antenna func-
tion in general. Another class of photosynthetic organisms, blue-green algae or cyanobacteria
carry phycobilins as the major light harvesting pigments. They are open-chain tetrapyrroles.
Their absorption lies within the region where chlorophyll does not strongly absorb,
550–650 nm. Hence these organisms found their own share of the visible spectrum so that
they do not practically compete for light energy with photosynthetic bacteria or green algae.
In a similar manner to higher plants, the latter contain chlorophylls as well as various xantho-
phylls in their antenna: chlorophylls a , b , c and d as well as variety of different types of
xanthophylls with absorption extending up to 550 nm and more, with some also containing
phycobilins. The photosynthetic algae is the great example of chromatic antenna system
evolution that enabled their biodiversity and adaptations to particular wavelength regions of
sun light and co-exist with the other groups of photosynthetic organisms. Altogether their
various types of antenna cover then whole spectrum of sunlight (see Figure 5.13 ).
Rupan_c05.indd 91 8/29/2012 5:37:59 PM
92 The Photosynthetic Membrane
Apart from different types of photosynthetic pigments, there exist different classes
of antenna design often showing no evolutionary connection that suggests that the
photosynthetic antenna emerged in several independent evolutionary ways. Thus, there
exist two major types of photosynthetic antenna: integral antenna, built of integral
membrane proteins and peripheral antenna that are not integral to the membrane but associ-
ated with it and reaction centre complexes via noncovalent (often electrostatic) interactions
(see Figure 5.16 ). Integral antenna can be of three types: fused, core or accessory antenna.
A fused antenna is integrated into the reaction centre, sharing the same polypeptide. A
typical example of a fused antenna is the photosystem I reaction centre complex that con-
tain two heavy polypeptides (see Chapter 3) that bind the photochemically active reaction
centre chlorophyll as well as about 100 chlorophyll a molecules serving only as light har-
vesting pigments. Core antenna complexes are intimately associated with reaction centres
but they do not share the same polypeptides. Typical examples are the core antennae of
photosystem II, the CP43 and CP47 complexes that bind only chlorophyll a and the LH1
complex of purple bacteria. Accessory antenna complexes are built of proteins that can be
arranged separately from the reaction centre complex and adopt various localizations rela-
tive to it. Typical examples are the major LHCII complex of photosystem II, the LHCI
complexes of photosystem I and the LH2 complex of purple bacteria. Finally, peripheral
antenna complexes associate with components of the reaction centre complexes that are
embedded in the photosynthetic membrane but do not themselves cross it. Typical repre-
sentatives are the phycobilisomes of cyanobacteria and red algae, the chlorosomes and
FMO complex of green bacteria and the peridinin-chlorophyll proteins of Dinoflagellates.
This classification is based on how autonomic the photosynthetic antenna is from the reac-
tion centre complex. It will become clear from next chapters that autonomicity of antenna
organization is important to enable prompt and efficient adaptation of the photosynthetic
membrane to the light environment.
Peripheral antennae
Antenna
RC Membrane
Integral antennae
RC + AntennaAntenna
AntennaRC
RC
CoreFused Accessory
Figure 5.16 Types of photosynthetic antenna.
Rupan_c05.indd 92 8/29/2012 5:37:59 PM
Primary Processes of the Light Phase of Photosynthesis 93
5.7 Principles of Light Harvesting: Summary
It is important now to summarize the design of the photosynthetic antenna based on
the analysis of its pigment composition, their spectral properties, their binding to the
protein, etc. The principles of light harvesting antenna design in the photosynthetic
membrane can be listed as:
1. The antenna utilizes pigment types with high molecular optical cross-section (large
chlorin ring-based molecules, the chlorophylls, and long linear polyenes, the carotenoids).
Both classes of molecule are archetypal examples of conjugated π -electron systems.
2. The antenna binds pigments that are relatively easily spectrally tuneable by their inter-
action with the environment or with each other. These pigments normally have rela-
tively broad absorption bands.
3. The antenna possesses an extremely high pigment concentration (often up to 1 M) while
simultaneously avoiding wasteful energy dissipation due to concentration quenching.
4. The antenna protein is of paramount importance to its function. It enables pigment
binding, defines their orientation within the environment, tunes their excitation
energies, determines the energetics and character of pigment-pigment interactions and
ultimately the overall efficiency of the antenna. Figure 5.17 displays the concept of the
antenna protein as ‘ a programmed solvent ’. It is genetically programmed to bind pig-
ments at certain sites, to interact with them and thereby tuning their spectral proper-
ties, hence modulating both the light harvesting and the adaptive properties of antenna.
5. The modular structure of the antenna enables its discrete organization, allowing for size
adjustment and repair.
6. The dynamic character of antenna organization allows for the lateral mobility and reor-
ganization which is essential for the adaptation of the photosynthetic membrane to the
Protein of antenna: “a programmed solvent” concept
Pigment binding
Primary structure determines:
Pigment tuning
Pigment orientation
Efficiency of pigments
•
•
•
•
MRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Figure 5.17 The role of protein in the photosynthetic antenna.
Rupan_c05.indd 93 8/29/2012 5:38:00 PM
94 The Photosynthetic Membrane
light environment. This ensures a ‘correct’ level of energy input into the photosystems
and an overall safe and efficient light harvesting process.
There exist three fundamental properties or parameters of the photosynthetic light harvesting antenna which determine its efficient function:
1. absorption cross-section : corresponds to the size (number of pigments and their
efficiency at feeding the reaction centre with excitation energy);
2. excitation energy lifetime : the time of energy storage within the antenna before it reaches
the reaction centres. This is an important parameter that depends on various pigment
associations and states that determine the overall excited state lifetime of antenna; and
3. energy migration efficiency and delivery to the reaction centre. This parameter is largely
determined by pigment positioning, mutual orientations and their spectral properties.
The absorption cross-section depends on the type and number of pigments, spectral redis-
tribution of extinction coefficients and the oscillator strengths of the electronic transitions
of the absorbing species. These are adjustable within long-term and even short-term light
adaptation processes and vary significantly among different types of photosynthetic organ-
isms. Spectral quality variations are of particular importance since they enable coexistence
and hence the biodiversity of photosynthetic organisms, particularly those living in low
light environments or aquatic ecosystems; purple, green and cyanobacteria, red, diatom and
green algae.
The time during which the antenna remains excited is the other important parameter. It is
generally proportional to the probability of energy delivery to the reaction centre and
largely depends on the environment surrounding the chlorophylls. The latter could influ-
ence chlorophyll conformation, directly interfere with the optical π -electron configuration
or remove excitations via energy transfer. Carotenoids, amino acids and lipids are potential
modulators of the antenna chlorophyll lifetime. The excitation lifetime can be monitored
by fluorescence lifetime or yield measurements, which reveal their remarkable dynamics,
reflecting the existence of control over the light harvesting process in plants.
The antenna protein functions as a tuner of pigment energies, determining the energy
transfer pathways within it. Figure 5.18 shows evidence for the energy transfer between
chlorophylls of isolated light harvesting complex II from plants (the major LHCII). It
displays two spectra. The dashed line spectrum is the fluorescence spectrum of LHCII
measured at 77 K in order to narrow the bands and increase spectral resolution. Fluorescence
is typically excited in the Soret band at around 435 nm. The spectrum shown in solid line is
a fluorescence excitation spectrum measured in the same experiment. The fluorescence is
detected at its maximum or, more often, at longer wavelength up to the vibronic satellite
region of 740 nm to avoid overlap with the excitation light that can be seen by the detector
as a result of scattering. The latter can be minimized by using transparent samples, special
sample compartment geometries and polarizers. The scheme of energy levels (Figure 5.18 ,
bottom panel) shows that different pigments, or indeed pigment forms, transfer energy
directionally down to the terminal emitter where it is being localized and emitted as
fluorescence. Remarkably, no fluorescence from chlorophyll b (which absorbs at 650 nm
Rupan_c05.indd 94 8/29/2012 5:38:01 PM
Primary Processes of the Light Phase of Photosynthesis 95
and is expected to emit at around 655 nm) is present in the fluorescence spectrum.
Fluorescence is neither observed from chlorophyll a forms absorbing at 660 nor 670 nm.
The maximum of LHCII fluorescence is centred at 680 nm and corresponds to the absorption
at around 676 nm or slightly longer with a small Stokes shift. Contributions to the excitation
fluorescence spectrum from chlorophyll b and xanthophylls are present, indicating that
these pigments transfer energy to the terminal emitter chlorophyll a . The excitation
fluorescence or action fluorescence spectroscopy was one of the first methods that
established the fact of energy transfer between antenna pigments connected in the funnel
fashion, so that energy from blue-shifted pigments is transferred downhill towards the red
pigments. This energy finally reaches the terminal emitter, the ‘collector’ of the energy
absorbed by the whole antenna. This setup therefore functions as a true energy funnel.
Provided the antenna is appropriately positioned in the vicinity of the reaction centre, the
Wavelength, nm
Fluorescencespectrum
4000.0
0.2
0.4
0.6
0.8
Flu
ores
cenc
e, e
l. Xanthophylls
Chl b
Chl b
660Excitation
flourescencespectrum
676 680
670
650
Chl a
Chl a
S2 S1
1.0
1.2
1.4
1.6
450
RC
ElectronRed
emitter
Terminalemitter
Light harvesting antennapigments
ΔE
500 550 600 650 700 750
Figure 5.18 Evidence for energy transfer in the major light harvesting complex of plants.
Rupan_c05.indd 95 8/29/2012 5:38:01 PM
96 The Photosynthetic Membrane
energy that is collected by the terminal emitter chlorophyll can be transported to the reaction
centre for trapping and stabilization prior to eventual charge separation and electron transfer.
Careful analysis of the structure of excitation fluorescence and reversed transmission
spectra is a useful approach that can yield information about the energy transfer efficiency
from various pigments to the terminal emitter (see Chapter 4). A curve fitting technique
based on the mathematical deconvolution of multicomponent spectra into individual bell-
shaped components (most often Gaussian or Lorentzian functions) is used for this pur-
pose. It produces the areas below each component and compares them for two types of
spectra, excitation fluorescence and reversed transmission. This comparison, along with
simple calculations, yields the energy transfer coefficients. When LHCII is subjected to
high temperature treatment or incubation with a strong detergent that denatures the protein
and disconnects pigments the excitation fluorescence spectrum becomes much simpler,
narrower, showing only bands of mainly one chlorophyll a . The entire regions from
460–520 and from 630–650 nm will be missing since chlorophyll b and the xanthophylls
will be energetically uncoupled from chlorophyll a .
Protein as a key conductor of pigment properties ensures the efficient funnel-like energy
transfer properties of the light harvesting antenna. As a result, instead of trapping an amount
of energy equivalent to only one photon per second in a low light environment (see previ-
ously) the reaction centres receive 200–300 times that amount from the antenna. Hence, the
antenna is a key power enhancer of the photosynthetic apparatus and therefore an enhancer
of plant growth and productivity in general. The photosynthetic antenna is built of several
discrete pigment-protein complexes, organized in monomeric and/or oligomeric units
associated differently with the proteins carrying the reaction centre (see Chapter 3). This
arrangement allows gradual regulation of antenna size according to the environmental light
intensity and flexible repair of the reaction centre components in the case of their photoda-
mage. The differential association of the light harvesting antennae allows loosely associated
units to undergo diffusion in order to rearrange themselves within the membrane (see
Chapter 9 for more detail). Such rearrangements are normally of an adaptive nature, help-
ing photosystems to cope with fluctuations in environmental light quality and variations in
intensity in order to optimize and protect the functionality of the photosynthetic membrane,
specifically the delicately balanced charge separation processes in the reaction centres.
Therefore, the modular and dynamic character of natural antenna design on the nanoscale
ensures the durability and flexibility of the primary energy conversion processes of photo-
synthesis. This design enables a fundamentally important property of the antenna: regula-
tion and optimization of photosynthetic electron transport efficiency for the most economic
and safe performance of the light phase of photosynthesis.
5.8 Connecting Light Harvesting Antenna to the Photosystems: Red Energy Traps
Peripheral light harvesting antenna is connected to the photosystem complexes. This con-
nection is based on noncovalent interactions between antenna subunits and subunits of
reaction centre core complexes. In the case of PSII light harvesting antenna is attached to
Rupan_c05.indd 96 8/29/2012 5:38:01 PM
Primary Processes of the Light Phase of Photosynthesis 97
the core PSII containing CP43 and CP47 inner antenna complexes tightly interacting with
proteins carrying the reaction centre chlorophylls, D1 and D2. The reaction centre is almost
isoenergetic with the terminal emitter energy of LHCII. However, CP43 and CP47 com-
plexes possess terminal emitters slightly downshifted, around 683 and 690 nm respectively.
Both are red-shifted relatively to the absorption of P680, the reaction centre of chlorophyll.
In PSI, the redshift of the terminal antenna emitters does also take place relatively to the
RCI (P700) absorption, where the red-shifted chlorophyll forms absorb at around 710 nm.
The presence of red-absorbing emitters presumes the existence of the anti-Stokes energy
transfer, that is, from the lower energy level to the higher energy level of the reaction cen-
tres (Figure 5.18 ). At room temperature it is possible, since the energy difference is not
large (up to 10–15 nm) and fluorescence spectra of red-shifted donors overlap with broad
absorption spectra of reaction centre chlorophylls. The role of the red emitting chlorophyll
forms present in photosystems has been investigated for a number of years. One of the
major opinions suggests that they are essential in focusing excitation energy in the vicinity
of reaction centre ensuring its prompt localization around RC and constant balanced supply.
Figure 5.19 (top) shows low-temperature fluorescence spectra of PSII with dominating
fluorescence emission from CP43 (685 nm, known as F685) and CP47 (693 nm, known as
1.2
1.0 680685
693733
PSIPSIILHCII
660 680 700
Wavelength, nm
Flu
ores
cenc
e, r
el.
720 740 760 780
0.8
0.6
0.4
0.2
0.0
1.0
0.8
0.6
0.4
0.2
0.0650 700 750 800
PSI
PSlI
LHCIIFlu
ores
cenc
e, r
el.
Figure 5.19 Low temperature fluorescence spectra of photosystems and LHCII complex ( top ) and fluorescence spectrum of isolated chloroplasts ( bottom ).
Rupan_c05.indd 97 8/29/2012 5:38:01 PM
98 The Photosynthetic Membrane
F695) complexes. The emission of LHCII antenna in this preparation is not clearly visible
since most of its energy is trapped by the red emitters at this temperature and therefore the
fluorescence is quenched and appears as a small shoulder, which is more pronounced in the
spectrum of whole chloroplasts (Figure 5.19 , bottom). Fluorescence spectrum of PSI is
even more red-shifted then that of PSII, peaking at 733 nm: a red emitter of this photosys-
tem, also known as F735. The fact that the chloroplast fluorescence spectrum is presented
by the both PSII and PSI bands suggests that these photosystems are separated in space by
the grana stacking as was discussed in Chapter 3.
Figure 5.20 shows electron microscopic pictures of stacked grana, where PSII is local-
ized and unstacked stroma thylakoids: a site for PSI localization. Magnesium cations are
required to keep grana stacked. Artificial removal of magnesium from the chloroplast incu-
bation medium leads to unstacking of grana, as shown in Figure 5.20 , with appearance of
long lamellae that contain mixed complexes of photosystems and LHCII. The first and
classical method of assessing whether in this state photosystems can interact with each
other is to measure excitation fluorescence spectra of the red emitting forms of PSI, since
they are the most red-shifted and can signal if PSII and LHCII are energetically coupled to
PSI. Figure 5.20 shows 77 K excitation fluorescence spectrum for F735 PSI band. At
stacked grana conditions, PSI excitation fluorescence spectrum is enriched almost with
chlorophylls belonging to this photosystem with low contribution from Chl b (650 nm) and
red-shifted Chl a maximum at 681 nm. In unstacked membranes, PSI cross-section (here,
read F735 cross-section) is much increased at the expense of Chl b and blue-shifted Chl a
(676 nm). The difference unstacked- minus -stacked spectrum is identical to excitation fluo-
rescence spectrum of PSII with attached LHCII antenna. This means that PSII with its light
Stacked
StackedUnstacked
Unstacked
PSI+PSII
PSI
PSII+LHCII
660 680 700620 640
1.0
0.8
0.6
0.4
0.2
0.0
Figure 5.20 Negative stain electron microscopy images of stacked ( top left ) and unstacked ( bottom left ) thylakoid membranes and corresponding excitation fluorescence spectra of photosystem I (F735) with the difference spectrum unstacked-minus-stacked, PSII + LHCII ( right ).
Rupan_c05.indd 98 8/29/2012 5:38:02 PM
Primary Processes of the Light Phase of Photosynthesis 99
harvesting antenna is channelling energy into PSI resulting in a strong increase in F735
emission of the PSI band. The 77 K fluorescence and excitation fluorescence techniques
have been used for many years in the photosynthesis research and gave first insights into
energy redistribution between the two photosystems and the impact of the structure of the
photosynthetic membrane on this process. Later, it will be shown how these approaches
were used in studies of composition and vital processes of light adaptation of the photosyn-
thetic membrane.
References
Beddard , G.S. and Porter , G. ( 1976 ) Concentration quenching in chlorophyll , Nature , 260 , 366 – 367 . Davydov , A.S. ( 1964 ) The theory of molecular excitons , Sov. Phys. Usp. , 7 , 145 – 178 . De Broglie , L. ( 1922 ) Rayonnement noir et quanta de lumière . Journal de Physique , 3 , 422 – 428 . De Broglie , L. ( 1923 ) Waves and quanta . Nature , 112 , 540 . Emerson , R. and Arnold , W. ( 1932 ) The photochemical reaction in photosynthesis . Journal of
General Physiology , 16 , 191 – 205 . Förster , T. ( 1948 ) Zwischenmolekulare Energiewanderung und Fluoreszenz , Ann. Phys. , 437 , 55 – 75 . Heisenberg , W. ( 1927 ) Über den anschulichen Inhalt der quantentheoretischen Kinematik und
Mechanik . Zeitschrift für Physik , 43 , 172 – 198 . Parker , C.A. ( 1968 ) Photoluminescence of Solutions: With Applications to Photochemistry and
Analytical Chemistry . Amsterdam, London, New York : Elsevier . Planck , M. ( 1900 ) Entropy and Temperature of Radiant Heat . Annalen der Physik , 1 , 719 – 737 . Schrödinger , E. ( 1925 ) An Undulatory Theory of the Mechanics of Atoms and Molecules . The
Physical Review , 28 , 1049 – 1070 . Schrödinger , E. ( 1926 ) Quantisierung als Eigenwertproblem . Annalen der Physik , 79 ( 361–376 ), 489 − 527 .
Bibliography
Atkins , P.W. ( 2000 ) Physical Chemistry . Oxford : Oxford University Press . Atkins , P.W. and de Paula J. ( 2006 ) Physical Chemistry for the Life Sciences . Oxford : Oxford
University Press . Blankenship , R. ( 2002 ) Molecular Mechanisms of Photosynthesis . London : Blackwell Science . Chang , R. ( 1981 ) Physical Chemistry with Applications to Biological Systems . New York : Macmillan
Publishing Company . Clayton , R.K. ( 1970 ) Light and Living Matter, Volume 1: The Physical Part . New York : McGraw-Hill . Clayton , R.K. ( 1970 ) Light and Living Matter, Volume 2: The Biological . New York : McGraw-Hill . Clayton , R.K. ( 1980 ) Photosynthesis. Physical Mechanisms and Chemical Patterns . Cambridge :
Cambridge University Press . Landrum , J. (ed.) ( 2009 ) Carotenoids: Physical, Chemical and Biological Functions and Properties .
Florida International University : CRC Press . Ruban , A.V. and Johnson , M.P. ( 2009 ) Dynamics of the Photosystems Cross-Section Associated with
the State Transitions in Higher Plants . Photosynthesis Research , 99 , 173 – 183 . Ruban , A.V. , Duffy , C.D.P. and Johnson , M.P. ( 2011 ) Natural light harvesting: principles and envi-
ronmental trends . Energy and Environmental Science , 4 , 1643 – 1650 . Serdyuk , I.N. , Zaccai , N.R. and Zaccai , J. ( 2007 ) Methods in Molecular Biophysics . Cambridge :
Cambridge University Press . van Amerongen , H. , Valkunas , L. and van Grondelle , R. ( 2000 ) Photosynthetic Excitons . Singapore :
World Scientific .
Rupan_c05.indd 99 8/29/2012 5:38:03 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
‘ Study the past if you would define the future .’ Confucius
Research into the mechanisms of light harvesting has been going on for decades.
Methods of functional studies using various spectroscopies have been applied to reveal
various features of the process and understand its sheer efficiency and robustness. Along
with them, various isolation procedures for light harvesting complexes have been devel-
oped yielding essential material for spectroscopic studies that in most cases demanded
pure and simpler systems than those existing in vivo in the form of multi-subunit anten-
nae attached to the reaction centre complexes. In addition, newly emerging molecular
biology procedures of production of recombinant antenna proteins and their reconstitu-
tion with pigments enabled highly homogeneous individual pigment-protein complexes
to be obtained. Furthermore, some trials were successful in producing aminoacid point
mutants to probe pigment binding and assist the identification of chlorophyll a and b
spectral forms. However, the atomic resolution structure of higher plant antenna com-
plexes was always an ultimate goal for understanding the works of the photosynthetic
light harvesting. The path towards this goal was and remains not straight-forward,
exactly as the discoverer of the light harvesting complex II (LHCII), Philip Thornber,
predicted in 1975:
Towards the Atomic Resolution Structure of Light Harvesting
Antennae: On the Path of Discoveries
6
Rupan_c06.indd 101 8/29/2012 5:37:08 PM
102 The Photosynthetic Membrane
… certain necessary studies will be more difficult, such as the development of an improved technique for isolating the existing and new chlorophyll-proteins in a stable form, as well as the determination of the three-dimensional organization of the chlorophylls within the protein framework .
Indeed, isolation of a membrane protein in intact state sounds almost contradictory, since
its natural environment is lipid bilayer in a membrane crowded with protein (see Chapter 3).
In addition, conditioning a membrane protein for crystallography imposes further artificial
environment factors likely to influence protein conformation. Finally, the ambiguity of this
structural approach is largely defined by the level of resolution, as it will be shown and
discussed in this chapter. It will become increasingly apparent that the structure and func-
tion of light harvesting antenna complex can only be understood when various approaches
and methods are combined together in a complimentary way with understanding of advan-
tages as well as limitations of each of them.
6.1 Discovery and Primary Characterization of the Higher Plant Antenna Complex
Postulation by Emerson and Arnold (1932, see Chapter 5) of the photosynthetic unit
concept in the 1930s and justification of the need for an antenna and the evolutionary
inevitability of its emergence were the first crucial advances in the studies of the phe-
nomenon of light harvesting. The next big step on this path came from biochemical
studies proposing the chlorophyll of the photosynthetic membrane is attached to protein
and hence is not free in the membrane. Indeed, the environment of chlorophyll in the
membrane always caught the attention of researchers. About 10 years after the discov-
ery of the photosynthetic unit and therefore the existence of a dominating amount of
photochemically-inactive chlorophyll, the first evidence emerged suggesting that chlo-
rophyll forms complexes with membrane protein. In the early 1940s Smith and Pickels
( 1941 ), who experimented with various surfactant-type agents, like bile salts (natural
fat-dispersing agents), detergents cholate, digitonin or sodium dodecyl sulfate (SDS)
aimed to dissolve (solubilize) chloroplast membranes. SDS treatment with subsequent
centrifugation enabled the observation of comigration of normally fairly light chloro-
phyll (~1 kDa) with a much heavier protein fraction. They also observed that anionic
detergent SDS produced a lot of free pigments. Nevertheless, the use of anionic deter-
gents became very popular in the studies of the photosynthetic membrane composition
manifesting in another discovery: the existence of several different chlorophyll-binding
proteins. This advance was made owing to the invention of polyacrylamide gel electro-
phoresis that enabled to separate two different pigmented protein fractions based on
their charge. These fractions possessed different chlorophyll a/b ratios. One had Chl a/b
ratio of about 5 and the other 1 : 2. Component II possessed much higher chlorophyll
amount than component I. However, the amount of free chlorophyll in these experi-
ments was far too high – 60–80%. Attempts have been made to reduce SDS/Chl ratio in
order to decrease the amount of free chlorophyll. Despite this, until the end of 1980s the
Rupan_c06.indd 102 8/29/2012 5:37:09 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 103
uncertainty existed as to the origins of the free chlorophyll band in the preparations and
existence of the free pigment in vivo . The least mobile band, termed complex I, turned
out to be photosystem I: relatively stable complex made of large polypeptides (see
Chapter 3). Indeed, it turned out to be more resilient to the ionic detergents than com-
plex II, which possessed low Chl a/b ratio. The two complexes had not only different
chlorophyll but also carotenoid composition. Complex II was more enriched in lutein
and neoxanthin, whilst complex I was enriched in β −carotene. The origins of this com-
plex have been in the focus of intense research for some time. No photochemical activ-
ity has been detected on these preparations. Most interestingly, Thornber found that
whilst complex I was essential for survival of plants and algae, complex II, that com-
prised almost 50% of all membrane chlorophyll, was not. On the other hand, prepara-
tions of thylakoid membrane fragments using nonionic detergents digitonin and triton
X100 enriched in the complex II possessed photochemical activity. The fact that mutants
lacking this complex could survive autotrophically lead Thornber to suggest the follow-
ing in 1975:
This chlorophyll a/b-protein complex which accounts for such a large proportion of the chlorophyll and protein of the photosynthetic apparatus of higher plants is thus not essential for a plant to grow photosynthetically, and therefore a new name , light-harvesting chloro-
phyll protein, is proposed for the complex, which was formerly termed the photosystem II chlorophyll-protein .
Further, it was suggested that this LHCP (or more commonly referred to as LHCII) com-
plex acts as the photosynthetic antenna for photosystem II reaction centre, RCII. The fact
the complex II on the SDS gel did not possess the photochemical activity prompted to
propose that the method simply was not capable to identify whereabouts of the PSII reac-
tion centre as it did for PSI in the complex I. In addition, since the complex II was entirely
absent in the membranes of mutants lacking chlorophyll b , it was apparent that RCII com-
ponents could not be physically present in the complex II gel band.
In Chapter 3 we learned that the two photosystems have very different architecture. PSI
has its antenna integrated with the reaction centre on the same protein (see Chapter 5),
whereas PSII has a very large outer type of accessory antenna, LHCII complex that can
bind the majority of its pigments (average 80%), relatively minor core antenna and reaction
centre-carrying proteins (see Chapter 3). Therefore in the days of the use of a very strong
ionic detergent SDS, more stable complex, PSI, with integrated antenna could ‘survive’ the
treatment, whilst PSII was largely disintegrated losing its activity with a lot of pigments
washed away from it by the detergent. This event could also be explained by the potentially
weaker protein binding strength of chlorophyll a than chlorophyll b since the latter pos-
sesses additional polar group that could be involved in hydrogen bonding, a formyl car-
bonyl (see Chapter 5). Indeed, pigment composition of the free pigment fractions regardless
the isolation procedure tends to be enriched in chlorophyll a .
Discovery and isolation of light harvesting complex in higher plants and algae was the
major achievement in biochemical photosynthesis research that opened a path towards
Rupan_c06.indd 103 8/29/2012 5:37:09 PM
104 The Photosynthetic Membrane
structural and functional characterization of the photosynthetic unit proposed by Emerson
and Arnold and specifically the organization of the light harvesting antenna. LHCII as an
outer antenna is by far the major light harvesting complex, dominating the membrane pro-
tein composition, hence it is not surprising it was discovered first and studied much better
than any other PSII and PSI antenna complexes (minor PSII light harvesting complexes,
inner antenna complexes, CP43 and CP47, LHCI complexes of PSI) that were isolated and
characterized later.
6.2 Development of Isolation Methods: Intactness, Purity and Quantity
Further biochemical work on the photosynthetic antenna focussed on the invention of vari-
ous techniques to analyse and prepare light harvesting complexes in significant amounts
and with a high level of intactness. However, this was not an easy task, since nobody knew
what was the native state of a light harvesting complex. How many pigments and pigment
types it should bind in vivo ? What oligomeric state of LHCII was the natural one?
Towards the end of 1970s Arntzen’s group made a major breakthrough in the isolation
in preparative amounts of reasonably pure LHCII complex (Armond et al ., 1977 ). This
work came from the study of the role of light LHCII complex in magnesium- and potas-
sium-dependent grana stacking (see Chapters 3 and 5). The process is vitally important in
the sharing of light energy or energy redistribution between PSII and PSI, otherwise known
as spillover. It was found that mutants lacking LHCII have a reduced ability for spillover.
In addition, for the high chlorophyll fluorescence state of PSII corresponding to its intact
state with LHCII assembled around the photosystem magnesium was absolutely required
(see Chapter 5, Figure 5.20). Therefore it was suggested that LHCII binds magnesium and
this triggers grana stacking and segregation of photosystems leading to a minimum spillo-
ver as well as promotes assembly of LHCII around the core PSII complex. At low cation
concentration, a certain extent of spillover takes place at which LHCII is less tightly bound
to PSII and shared by both, PSII and PSI, so that the excitation energy is more evenly
redistributed between them. Using this assumption Arntzen and coworkers treated isolated
thylakoid membranes with nonionic detergent Triton X-100 at conditions of low cation
concentrations at which grana were unstacked and LHCII was separated from PSII
(Armond et al ., 1977 ). The solubilized complex was separated on the sucrose gradient (see
Chapter 4) presenting itself as a broad highly fluorescent band. This band was removed
from the gradient, and magnesium and potassium salts were added to the sample. This
caused binding of magnesium and potassium cations to LHCII particles and resulting com-
pensation of negative charges that promoted their aggregation. Aggregated LHCII was
separated from the rest of the sample by centrifugation through the cushion of 0.5 M of
sucrose in the ultracentrifuge. Aggregates appeared in the pellet indicating the higher den-
sity of LHCII in the aggregated state. They could be resuspended back into solution by the
addition of detergent. Denaturing SDS gel electrophoresis of the prepared LHCII revealed
the presence of not one but at least two polypeptides of different intensity, suggesting the
heterogeneity of LHCII complex. This preparation yielded relatively large amounts of
Rupan_c06.indd 104 8/29/2012 5:37:09 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 105
LHCII. The method immediately became one of the major procedures used in various
modifications for isolation of the complex for analytical and spectroscopic studies. It also
became a key method of LHCII preparation for the first crystallographic trials (see the fol-
lowing). As early as 1980 it was suggested by Ryrie and coworkers that the ability of
LHCII to form 2D lamellae in the low detergent solutions can be used for creation of
highly ordered arrays of the complex suitable for crystallography studies (Ryrie et al ., 1980 ). Indeed, LHCII preparations were relatively stable and the complex was easily self-
assembled into the 2D ordered arrays particularly when the detergent was removed gradu-
ally at certain temperature and buffer composition by dialysis. Kühlbrandt’s group in the
early 1980s was the first to obtain highly ordered 2D arrays of LHCII complexes induced
by cation precipitation at conditions of low Triton X100 concentration (Kühlbrandt, 1983).
Analytical separation of LHCII on polyacrylamide gels was further improved so that
instead of 50–60%, as in early experiments of Thornber, only 10% of pigments were
removed from protein and ended up in the free pigment zone (FP): the fastest running
band on the electrophoresis. It is often called ‘Anderson phoresis’ after Jan Anderson’s
papers published at the end of the 1970s/early 1980s (1980, 1982) (among some other
prominent groups such as Simpson’s: Bassi et al ., 1987; and Machold’s: Machold and
Meister, 1979 ) that showed this kind of separation. This method was based on the use of
ionic detergent, SDS of about 0.5% concentration only. This allowed separation of sev-
eral green bands from PSI. Three of them belonged to LHCII and were labelled LHCP 1 ,
LHCP 2 and LHCP 3 . The slowest running was LHCP 1 and the fastest, LHCP 3 . This was
the first demonstration of LHCII heterogeneity and it was not entirely clear whether it
was entirely due to the different molecular weight of its polypeptides or different oligo-
meric state or both. Other remarkable achievement was the presence of a small band
containing only chlorophyll a , that was called CPa: a found PSII reaction centre com-
plex. It possessed only 15% of the total membrane chlorophyll. This band was also pre-
sent in plants lacking LHCII and possessed fluorescence properties of the PSII reaction
centre complex. The three separated LHCII complexes had very similar pigment compo-
sitions and similar absorption and fluorescence spectra. Moreover, polypeptide analysis
revealed that they are built of very homologous polypeptides. This suggested that the
differences in mobility of the resolved LHCII complexes were likely to reflect different
states of their oligomerization. The electron crystallography approach used by Butler and
Kühlbrandt ( 1988 ) allowed the first projection map of negatively stained 2D arrays of
LHCII to be obtained. It was revealed that the crystallographic unit cell contained two
structural units, each possessing three-fold symmetry. Therefore, the authors proposed
that the LHCII of their preparation was an oligomer of three monomeric light harvesting
complexes that were built of the two types of polypeptides with 25 and 27 kDa molecular
weights. Some years later Kühlbrandt (1994) successfully used an analytical ultracen-
trifugation method to confirm that LHCII is a trimer. It was also suggested that each
monomeric unit regardless the molecular weight (25 or 27 kDa) possessed eight chloro-
phyll a s and seven chlorophyll b s.
For crystallography the modified LHCII preparation method from Arntzen was of
sufficient quality. The preparation was relatively stable but not essentially pure.
Rupan_c06.indd 105 8/29/2012 5:37:09 PM
106 The Photosynthetic Membrane
However, the crystallization itself was another purification step since only two types of
polypeptides were found in the LHCII crystals. This meant that, although the initial
preparation could have been impure, only specific complexes were involved in the for-
mation of the good quality crystal. Therefore, the work of Kühlbrandt justly focussed
on obtaining the structure of LHCII trimer from such preparations. At the same time the
other path of LHCII antenna research was leading towards development of novel bio-
chemical analytical and preparative methods in order to obtain a separation of various
antenna complexes at the conditions of minimal loss of pigments. This would yield
useful information on the full composition of light harvesting antenna giving accurate
protein and pigment stoichiometries. Such information was essential for accurate func-
tional characterization of LHCII as well as to help improving of emerging structural
data. This work was carried out in the 1990s by several groups, most notably of Thornber
and Bassi (1997). The major idea was to use milder nonionic detergents than Triton
X100. In 1991, both groups produced work suggesting the existence of 4–5 types of
LHCII antenna complexes. Thornber called them LHCII a, b, c, d and e and Bassi
(1987), CP29, LHCII, CP26 and CP24, respectively. The fifth complex was missing in
the latter work. Hence, LHCII was named LHCIIb or the major LHCII complex, whilst
the others were named a, c, d, e or CPs (chlorophyll proteins). All these complexes
formed LHCII antenna. The amounts of newly discovered LHCII complexes were much
lower than those of the major, trimeric LHCII, therefore they have been named ‘minor’
light harvesting complexes or just ‘minor antenna’. They are also referred to as mono-
meric LHCII complexes, since they do not form stable oligomers as LHCIIb. It is worth
to note that the ‘CP’ name is normally attributed to the complex that is not a light har-
vesting antenna. Since LHCII had been discovered years earlier than the minor antenna
complexes and that their amounts were much lower, than the former it was not clear
whether they have the same light harvesting function, or play a different role in the
photosystem II and even belong to the core complex structure. The new separation
methods mainly used nonionic mild detergents: glycosides (see Figure 3.4). The deter-
gents octylglucoside or dodecylglucoside have a relatively short hydrophobic ‘tail’ and
large polar ‘head’, the cyclic structure of glucose residues. These features make such
detergents less penetrating into the hydrophobic protein interior, hence less harmful and
active in removal of pigments. Thornber’s improved gel system was based on the use of
a small concentration of deriphat produced little free pigment. The chlorophyll a/b
ratios were different for all LHCII complexes. LHCIIb (the major LHCII) Chl a/b was
1.33 corresponding to eight Chl a and six Chl b rather than eight and seven, respectively,
as suggested earlier by Kühlbrandt. The Chl a/b ratio of LHCII a, c and d was 2.3, 1.8
and 0.9, respectively. The new isolation method of Bassi (2000) was flat bed preparative
isoelectric focussing. The advantage of it was that the complexes were obtained in rela-
tively large amounts and easily eluted into the buffer solution. The Chl a/b ratio for the
major LHCII was almost the same as in Thornber’s preparation. For the minor com-
plexes CP29 (LHCIIa), CP26 (LHCIIc) and CP24 (LHCIId) Chl a/b the ratios were 2.6,
1.9 and 1.2, relatively close to Thornber’s data. Polypeptides of the minor antenna com-
plexes CP29, 26 and 24 were run at approx 30–31, 28 and 20 kDa, respectively.
Two polypeptides in CP29 complex were often detected. Hence, the use of improved
Rupan_c06.indd 106 8/29/2012 5:37:09 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 107
separation techniques and mild nonionic detergents enabled the discovery and charac-
terization of all LHCII antenna complexes at the same time. Later preparations that
used modified isoelectric focussing or sucrose gradient isolation techniques revealed
significant variations in the Chl a/b ratio of the minor antenna complexes. For CP29 this
value was reported as high as 3.5 and for CP26 as high as 2.5. The estimated total num-
ber of chlorophylls also varied but consistently reported to be lower than in the major
LHCII. Xanthophyll content and composition were also under debate. The estimates
varied from two xanthophylls to three xanthophylls for minor and from three to four
for the major LHCII monomeric complex. There were several potential causes of such
variations. The first was the low stability of the minor antenna complexes. The second
was the purity of the preparations. Indeed, the major LHCII was much stable and oligo-
meric, whilst the minor complexes were monomeric, more hydrophobic and possibly
belonged to the higher oligomeric or macrocomplex assemblies in vivo , like the photo-
system II complex (see Figure 4.4). In Chapter 9 an intriguing novel role that was
proposed exclusively for the minor LHCII complexes in processes of adaptation of the
photosynthetic light harvesting will be described.
6.3 LHCII Crystallography: The Beginnings
The first structure of the major LHCII complex was published by Kühlbrandt and Wang in
1991. It was a result of electron crystallography study of 2D crystals of the complex. The
resolution was only 6 Å at which they confirmed that the complex is built of three nonco-
valently associated subunits, each containing a polypeptide of approx. 25 kDa with 233
aminoacids (Figure 6.1 a). The shape of the trimer was almost cylindrical with 7.3 nm in
diameter. The elongated shape of the monomer had dimensions of 3 × 5 nm (dashed line in
Figure 6.1 a). For the first time this work visualized three membrane–spanning α helixes,
A, B and C (Figure 6.1 b). The abnormally longer central helixes (4.6–4.9 nm) were slightly
inclined with respect to the membrane normal and appeared to be in contact with each
other. Helix C was found to be oriented more perpendicularly to the membrane plane than
helices A and B (nearly 80 o ). It was shorter, only 3 nm long. Helix B was associated with
the N-terminus facing the stromal side of the membrane and connected through the lumen
loop to the helix C which in turn was connected to the stromal site of the helix A that ended
on the lumenal site of the membrane with C-terminus (Figure 6.1 b). Therefore, the whole
LHCIIb monomer structure spanned the membrane three times as if it was aiming to stitch
it. It was noticed that this structure was very different from the structures of the already
known membrane proteins, bacteriorhodopsin, bacterial reaction centre and matrix porin
and that the only relative complex is likely to be LHCI antenna from PSI, that was recently
discovered and characterized at that time since it has strong sequence homology to LHCIIb.
Each monomer of the structure was found to bind 15 chlorophyll pigments, localized
mainly around central helices A and B in the hydrophobic interior of the complex. The
chlorophylls were identified as densities of around 0.8 nm in diameter and 0.4 nm thick. It
was impossible to distinguish which is chlorophyll a and which is chlorophyll b from this
Rupan_c06.indd 107 8/29/2012 5:37:09 PM
108 The Photosynthetic Membrane
structure. In addition the chlorophyll #13 was smaller than the rest and therefore it was pos-
sible that the structure was wrongly assigned. Interestingly, it was found that chlorophylls
are grouped into two layers, one closer to the stromal and the other to the lumenal sites of
the membrane. The upper layer contained eight chlorophylls. Chlorophylls 1 and 5 and 2
and 6 revealed a two-fold symmetry arrangement in the upper parts of helices A and B. This
suggested the existence of conserved chlorophyll binding aminoacids in the homologous
parts of the helixes: a pattern of regularity in pigment arrangement was revealed for the first
time in this study. Chlorophylls of the upper, stromal layer were forming a ring around the
helical structures. All ring structures of chlorophylls were almost perpendicularly oriented
to the membrane plane. It was also predicted that some chlorophylls could have water mol-
ecules involved in their coordination and some aminoacids which did not belong to helical
structures. The authors suggested that the role of the protein in LHCIIb is to ensure highly
Figure 6.1 Structure of LHCII: early days. a: LHCII trimer at 6 Å resolution; b: the side-view of LHCII monomer with numbered chlorophylls and labelled helixes A , B and C . Reprinted by permission from Macmillan Publishers Ltd Kühlbrandt and Wang © 1991.
(a)
(b)
Rupan_c06.indd 108 8/29/2012 5:37:09 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 109
concentrated chlorophyll binding and correct pigment separation and orientation to enable
efficient energy transfer – the fundamental features of ‘the programmed solvent’ described
in Chapter 5. At this resolution, however, no phytol tails, lipids or xanthophyll pigments
were resolved. It was hard to explain why the complex was in the trimeric form and what
the role of trimerization was. It was commented that the chlorophyll concentration was as
high as 0.7 M and the complex was almost three times more effective in light harvesting that
the soluble light harvesting complex from the bacteria Prosthecochloris aestuarii . The
energy transfer rate (Förster-type mechanism) was predicted by the authors to be very high
in LHCIIb complex, since the interpigment distances were very short. The energy transfer
between chlorophylls localized on different trimers was suggested to be much slower since
the relevant shortest distance between the pigments was found to be longer than for the
chlorophylls localized within one monomer. Still, the structure was lacking many important
details that were essential for creation of accurate energy transfer models for LHCIIb.
Nevertheless, this first structure of the higher plant antenna complex offered novel insights
into the helical and pigment organization of the complex, showing that they are very differ-
ent from the bacterial antenna features, suggesting more efficient and therefore advanced
organization of light harvesting than in prokaryotic organisms.
In 1994, Kühlbrandt and coworkers published a much improved structure of LHCIIb
with 3.4 Å resolution using the electron crystallography on 2D crystals (Figure 6.2 , top).
Almost two times better than previous resolution revealed more interesting features of the
structure. The instrument and crystal quality and the much lower temperature during the
data collection (4 K versus 160 K in the previous work) which allowed better sample
stability were amongst the key factors that improved the special resolution. Lower speci-
men temperature enabled longer data collection times avoiding radiation damage and
allowing better quality information on the high-resolution phases. As a result, it was
concluded that LHCIIb contained not 15 but 12 chlorophyll molecules and two xantho-
phylls. The authors admitted that the structure may be missing two other chlorophylls
that they thought should be present in the structure. The structure revealed only eight
ligands form the central magnesium atom of chlorophylls; aminoacids histidines, gluta-
mates, glutamines, asparagine and glycine. Water was also proposed to play role in the
pigment binding.
Almost 80% of apoprotein residues were successfully fitted to the electron densities
obtained. 36% of aminoacid residues were found to form α helices. More details emerged
regarding the two crossing long transmembrane helices A and B. Pairs of residues F58 and
F173, W71 and L186, M73 and M188 were involved in the two-fold symmetry and charged
R70 and R 185, G65 and G180 formed two pairs bound by ionic interactions in the hydro-
phobic core of the complex (Figure 6.2 , bottom). The ionic forces are the strongest among
noncovalent interactive bonds, even stronger then hydrogen bonds. The presence of such
interactions in the structure of LHCIIb suggests that the hydrophobic core based on the two
helixes is a very tightly-built structure, ensuring stability of the three dimensional structure
of the complex. The new structure revealed the existence of the fourth helix, D, that was
located on the interface between the hydrophobic site of the complex and lumen: clearly an
amphipathic type of helix close to the C terminus.
Rupan_c06.indd 109 8/29/2012 5:37:11 PM
110 The Photosynthetic Membrane
The only criterion of assigning chlorophyll a and b was their location in vicinity of two
found xanthophylls, attributed to luteins. The authors assumed that since the energy in
antenna quickly ends up on chlorophylls a (see Chapter 5 for detail), these chlorophylls
only would need to be protected by carotenoids against photooxidation at the conditions
of high light illumination. Therefore, the seven closest to xanthophyll chlorophylls were
assigned as chlorophylls a and the rest as chlorophylls b . The 3.4 Å resolution was not
a6
a3b3
b2
a4
......GPFSGESPSYLT
DYG WDTAGLSAO P E
T F S K
N R E L
A M LA
L
G A L A
AL I
V
FF
C V F80
70
P E L L
S P N G
G
GEP
40F
E V I
GF
MM
FS
190
RG
LK
N
EK
VK
AE
L
PE
AF
170
60
b1
b5
a1
a7
b5
IS
LAIW
T A130
ML
I
A
VQ
GV
RI
VG
140E
V90K
F GE A V W F K A G S QI F SE
GGLDYLGNPSL V H A
Q
120
100
110
HL
N
ADA
LE
P
210
230220
DPVNN
N AWSYATNFVPGK
G K G T V200
30
50
a5 a2H S R W
D
B A
C
DDALGLPOF S
100G GPY LPD
VVEGLPG
GA
150
Stroma
Lumen
Figure 6.2 Structure of LHCII monomer at 3.4 Å resolution. Bottom : schematic presentation of LHCII chlorophyll-binding sites. Reprinted by permission from Macmillan Publishers Ltd Kühlbrandt et al . © 1994.
Rupan_c06.indd 110 8/29/2012 5:37:11 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 111
enough to distinguish methyl group of chlorophyll a from formyl group of chlorophyll b
(see Figure 5.12). Lutein 1 (L1) was found to be in a close vicinity of three chlorophylls
with the minimum distances of around 4 Å. Lutein 2 was also positioned around three
chlorophylls within similar shortest distances. The symmetry of the two domains of pig-
ments although pronounced is not ideal because of the different protein environment. The
authors proposed that the two luteins, six associated chlorophylls and two transmembrane
helixes, A and B form the central core of the complex. Indeed, lutein was found to be
essential xanthophyll in reconstitution of stable LHCIIb complex from the recombinant
protein. The proposed structural role of xanthophylls in LHCII received here a further
support. Two other xanthophylls, violaxanthin and neoxanthin were proposed to be bound
in to the peripheral parts of the complex. Unfortunately, the resolution did not allow map-
ping of the chlorophyll rings possessing, apart from the four pyrrole cyclic groups, the
fifth cycle (see Chapter 5), neither did it enable seeing the phytol tails. This prevented
determination of the orientation of the transition dipole moments and therefore made
unambiguous calculations of the energy transfer patterns within the LHCIIb complex.
It took another 10 years to reveal the LHCIIb structure at a better resolution. That ena-
bled determination of the orientation of chlorophylls, localization of the phytol tails, find-
ing the lipids as well as missing chlorophylls and xanthophylls. In addition, it was important
to make sure the Chl a and b were correctly assigned. Chang’s group (Liu et al ., 2004 )
published a new LHCIIb structure at 2.72 Å. This was a big improvement that dramatically
influenced and continues to influence the biochemical and biophysical research of LHCII
antenna and beyond. The structure was obtained using X-ray diffraction techniques on 3D
LHCIIb crystals.
6.4 Revealing the Atomic Resolution Structure of LHCII Antenna Complexes
6.4.1 Key Biochemical and Spectroscopic Advances that Aided the Emergence of the Current Atomic LHCIIb Structure
The large gap between the new detailed LHCIIb structure and the old one was filled with
various trials that used alternative approaches to learn more about the LHCIIb structure
than the model of 1994 offered. Work on absorption spectroscopy of recombinant reconsti-
tuted LHCIIb protein aimed to shed some light on identities of chlorophylls a and b . The
idea was to mutate the known pigment-coordinating aminoacids which should allow
removing selectively the chlorophylls. Comparison of absorption spectra of mutated and
original complexes should have enabled, in principle, calculation of the spectra of missing
pigments and if their absorption were to be located around 650 nm the identity would be
Chl b and if 660–680 nm, the pigment should be Chl a . As was described in Chapter 5, the
absorption spectrum of LHCIIb in the red region is indeed represented by chlorophyll b and
chlorophyll a bands. However, the number of these bands is lower than the number of chlo-
rophyll molecules, showing simply that there are pigment forms with similar energies.
Rupan_c06.indd 111 8/29/2012 5:37:11 PM
112 The Photosynthetic Membrane
Also, each of the pigments is located in unique aminoacid environment or binding pocket,
such environment is apparently not always causing unique shifts in the absorption spec-
trum of a pigment. This situation is complicated by the fact that pigment-pigment interac-
tions are likely to contribute in some cases to the tuning of pigment energy. In addition to
all these considerations another problem with the reconstitution approach is that removal
of a pigment binding aminoacid may cause alterations in the refolded protein structure that
can affect energies of other pigments. Indeed, the protein is not a rigid building built of
bricks that can be removed without altering its shape. Protein is more delicate and most
importantly mobile structure. Therefore, attempts to identify chlorophylls in the incom-
plete LHCIIb structure were nearly as ambiguous as their tentative assignment based on the
need to photoprotect chlorophyll a in the vicinity of luteins.
More progress using the recombinant technique was made towards the identification of
the xanthophylls’ binding sites. Most notably, the neoxanthin-binding site was predicted by
Bassi’s group (1997, 2000) to be localized in the helix C-domain, on the interface between
helices C and A/B helix domain. It was also established that this xanthophyll was not
essential for the protein folding. Thus only luteins were found to be key core xanthophylls
that were structurally important for the LHCII native folded state. It is therefore not sur-
prizing that for some years it was believed by some that the minor antenna complexes do
not bind neoxanthin and bind only two xanthophylls (see earlier in this chapter). However,
isolated LHCII complexes consistently contained neoxanthin and in case of the major
LHCII, this xanthophyll was in stoichiometric amounts, that is, one molecule per mono-
mer. Furthermore, later it was found that the minor antenna complexes also contain neox-
anthin. Hence, the correct xanthophyll composition seemed to depend upon the LHCIIb
preparation procedure. Recombinant techniques allowed obtaining a membrane complex
in detergent environment, not in the membrane. Hence, the lack of adequate lipids or their
prompt degradation and inability to control appropriate levels of ions are likely to be the
problems of the early reconstitution experiments. In addition, the lengthy purification pro-
cedure could have also been a significant destabilizing factor.
Whilst after all biochemical trials and preparations it became increasingly evident that
there have to be eight Chl a and six Chl b , the xanthophyll composition and conformational
state remained a subject for debate. Core xanthophylls identity and conformation – the two
lutein molecules bound around helices A and B – left no doubt, though. These carotenoids
were in all- trans conformation and essential for the assembly of intact complex with effi-
ciently connected chlorophylls delivering energy towards the terminal emitter cluster of
chlorophyll a . The localization of neoxanthin and violaxanthin was, however, uncertain.
Moreover, it was not clear whether violaxanthin is at all bound to LHCIIb, since the early
preparative work resulted in inconclusive observations, some showing the evidence of sub-
stoichiometrical binding of this pigment and some revealing complete absence of violax-
anthin in LHCIIb. The reconstitution work also suggested that this xanthophyll is not
required for the maintenance of intact tertiary structure of the complex. Hence it was pos-
tulated that violaxanthin is free in the membrane and does not interact with any proteins
apart from the de-epoxidase, that removes from it two epoxy-oxygens converting the mol-
ecule into zeaxanthin: an activity of so-called xanthophyll cycle that will be described in
Rupan_c06.indd 112 8/29/2012 5:37:11 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 113
detail later. The supporters of free violaxanthin localization in the membrane motivated
their theory that the xanthophylls must be detached from antenna proteins in order to be
readily available for the enzyme. That seemed to be a reasonable explanation. However,
Horton’s group (Ruban et al ., 1999 ) undertook a systematic study that used very mild
detergent solubilization procedure of the PSII membranes and thylakoids and isolated
LHCIIb in somewhat oligomeric state. This preparation was believed to correspond to
more native state of the complex, contained approximately eight LHCIIb trimers and one
violaxanthin per monomer of the complex. Hence, it was proposed that LHCIIb binds eight
Chl a , six Chl b , two luteins, one neoxanthin and one violaxanthin per monomer. The rea-
son for missing violaxanthin in the many early preparations was suggested to be the very
low binding affinity of this xanthophyll. The affinity of violaxanthin binding to LHCIIb
was empirically estimated to be up to five times lower than that of lutein. Therefore, the
trimeric complex should contain four xanthophylls per monomer, with very low-affinity
binding site of violaxanthin. It was proposed that this low affinity should have enabled
accessibility of the xanthophyll for the de-epoxidase. Since the preparations of Horton and
coworkers (Ruban et al ., 1999 ) had virtually no free pigment band (sucrose gradients and
later gel filtrations) it was concluded that the native photosynthetic membrane of vegetat-
ing plants does not contain free pigments in detectable amounts. Later this finding was
confirmed by other research groups.
Towards the end of 1990s there appeared instrumental developments towards analytical
spectroscopic assessment of the state of xanthophylls in the photosysnthetic membrane.
The pioneering work of the laboratory of Robert and coworkers (2004) on the applications
of resonance Raman spectroscopy proved to be a reasonably neat way to address the prob-
lem (for details on the method see Chapters 4 and 8). Violaxanthin was found to change its
configuration from relaxed to slightly out of plane distorted one that resulted in a pro-
nounced alteration of the C—H wagging vibrational mode that became coupled to the
electronic excitation of the molecule. Figure 6.3 (top) displays two distinctly different
spectra of violaxanthin in the 930–980 cm −1 region of the mentioned C—H vibrations
( ν 4 region). In the intact membrane this mode is strong and well-resolved into two bands
(950 and 963 cm −1 ), whilst in the solubilized state (nonionic detergent was added to the
membrane) the spectrum is strongly reduced and the characteristic structure has almost
disappeared. Similar binding ‘fingerprint’ was found in the LHCIIb isolated with the mild
detergent treatment, mentioned in the previous paragraph, when violaxanthin was attached
to the complex in the pigment to monomer ratio close to 1. The resonance Raman spectros-
copy provided independent evidence that confirmed that violaxanthin was an inherent
component of LHCIIb that should have its own specific binding site/domain. In addition,
it was established that this xanthophyll exists in all- trans configuration as two intrinsi-
cally-bound lutein molecules of the complex.
The binding site of neoxanthin and the conformational state of in vivo were not identi-
fied in the 1994 structure. Biochemical work indicated a very strong affinity of binding of
this xanthophyll to LHCIIb suggesting that the binding pocket is not as ‘loose’ as that of
violaxanthin. The conformation of neoxanthin was unambiguously tested by the resonance
Raman spectroscopy. The resonance Raman spectrum of carotenoids in the region of
Rupan_c06.indd 113 8/29/2012 5:37:11 PM
114 The Photosynthetic Membrane
0.0
940 950
Wavenumber, cm–1
Free
960 970
0.2
0.4
0.6
0.8
0.0
Ram
an in
tens
ity, r
el.
Bound Vio
Ram
an in
tens
ity, r
el.
Wavenumber, cm–1
1100 1140
11241132
1157
9-cis
1180 1220 1260
Neo
Figure 6.3 Evidence of violaxanthin binding to the LHCIIb protein in the intact photosynthetic membrane ( top ) and of 9- cis conformation of neoxanthin ( bottom ) obtained by the resonance Raman spectroscopy. The spectrum below neoxanthin (Neo) corresponds to 9- cis violaxanthin of the complex from Cuscuta reflexa, bound into the neoxanthin locus.
Rupan_c06.indd 114 8/29/2012 5:37:12 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 115
1100–1250 cm −1 (called ν 2 ) is sensitive to the molecular conformation and is broadly used
to establish cis-trans states (see Chapter 3 for structures of xanthophylls). The spectrum
for neoxanthin attached to the light harvesting antenna in the photosynthetic membrane
revealed two specific features that are absent in spectra of all- trans carotenoids. These
features are positioned at 1124 and 1132 cm −1 (see Figure 6.3 , bottom). They are the ‘fin-
gerprints’ of 9- cis conformation. Therefore, not only neoxanthin is consistently present in
LHCIIb of the vast majority of higher plant species it is always in 9- cis conformation (the
complete LHCIIb structure will follow in this chapter). What turned out to be even more
interesting is that in exceptional cases when neoxanthin was found totally absent, it was
replaced by violaxanthin in the same binding pocket and in 9- cis conformation. This fact
suggests that the neoxanthin binding pocket is less strict to the type of the xanthophyll
(violaxanthin can replace neoxanthin, etc.) than the xanthophyll conformation. Hence, it is
a conformation-required binding site. Indeed, Figure 6.3 shows a very much similar spec-
trum of Cuscuta reflexa membranes containing no neoxanthin and enriched in violaxan-
thin. This spectrum is nearly identical to the one above it that belongs to the 9- cis
neoxanthin of spinach. Therefore, biochemical and spectral experiments provided clear
evidence that neoxanthin of LHCIIb complex must be in cis -conformation. The conserved
nature of this state remains to be explained.
6.4.2 The New Structure of LHCII b
Methods that provided fine details of the LHCIIb pigment composition and conformation
were invaluable for those who solved the structure of the complex at atomic resolution.
Chang and coworkers (Liu et al ., 2004 ) first succeeded in providing a very detailed struc-
ture of LHCIIb from spinach showing that it contained all 14 chlorophylls, four xantho-
phylls and two lipids.
Their success was based on development of a gentle isolation procedure that was required
to preserve all pigments in their intact states. They were guided by the previously-men-
tioned biochemical and spectroscopic work that suggested the presence of four xantho-
phylls in LHCII. In addition they succeeded in obtaining 3D crystals of the complex that
could diffract at the highest resolution. The crystallization procedure yielded crystals where
LHCIIb was packed into icosahedral spherical particles each containing 20 trimers. The
outer diameter of the sphere is ~26 nm. It is believed to be embedded into the irregular lipid
bilayer forming a proteoliposome structure. The orientation of trimers is uniform with the
lumenal side always facing into the interior of the sphere. In these particles trimer-trimer
interactions are very minimal and mediated mainly by digalactosyl diacylglycerol (DGDG)
molecules and two pairs of chlorophylls van der Waals forces. Spherical particles contain-
ing LHCIIb interact with each other within the crystal via polar forces established between
hydrophilic outer surfaces. This type of crystals was new and Liu et al . ( 2004 ) named them
Type III membrane protein crystals.
Figure 6.4 represents side and top views on the structure of the LHCIIb monomer. The
layout of the major transmembrane helices, A, B and C is very similar to that of the 1994
Rupan_c06.indd 115 8/29/2012 5:37:12 PM
116 The Photosynthetic Membrane
D-helix E-helix
C-helix
B-helixA-helix
Figure 6.4 2.72 Å resolution structure of LHCII monomer. Top : side view of the monomeric complex. Bottom : top view with the dashed line showing nearly linear alignment of all five α -helices of the complex. Presented in freeware PyMol 0.99.
Rupan_c06.indd 116 8/29/2012 5:37:12 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 117
structure, although the latter was done for LHCIIb from pea that had the apoprotein nearly
90% homologous to that of spinach. Lumen side amphipathic helixes D and E are clearly
mapped. The latter, helix E, was not previously observed. Interestingly, the loop between
helices E and C is organized in two antiparallel strands that are stabilized via ionic bonds
from D111 and H120 aminoacids as well as a number of hydrogen bonds: a special detail
worth noticing. Such a structural motif is likely to be of some functional significance yet to
be discovered. The top view shows the linear alignment of all five helices highlighted by
the dashed line.
The complete structure of the monomer is complex enough to see features of individual
domains and pigments. This is largely due to the resolution of nearly all phytol tails of
chlorophylls. Therefore, it makes much sense to present groups of pigments or pigment
domains in order to show and discuss their peculiarities. Figure 6.5 displays all chlorophylls
of the LHCIIb monomer. They are organized in a circle, although quite irregularly. Hence,
one of the major functions of a protein is to make sure that numerous pigments are reason-
ably spaced from each other. The average centre to centre distance is around 10 Å. This
circle of pigments if very tightly arranged around the hydrophobic core of the protein built
by the helixes A and B. Presentation of the LHCII structure using van der Waals surfaces
gives an idea of how compacted all pigments are around the protein (Figure 6.5 , right).
Apart from the resolution of the phytol tails, this structure revealed the fifth cycle of the
chlorine ring making it possible for the first time to unambiguously determine the direc-
tions of the transition dipole moments along X and Y axis of chlorophylls (explained in
Chapter 5). Therefore, this structure offered rich information for the theoretical modeling
of energy transfer and dissipation pathways within the LHCII antenna and therefore was
enthusiastically received by many spectroscopists and theoretical biophysicists. And finally,
the resolution allowed to unambiguously assigning chlorophylls a and b . Indeed, the
C7-formyl group of Chl b could be clearly distinguished from C7-methyl group of Chl a .
Localization of Chl a is shown in Figure 6.6 . Only three of eight Chls a are found closer
to the lumenal site of the complex; Chl a604, 613 and 614. Chls a 610, 611 and 612 form a
Figure 6.5 Chlorophylls of LHCIIb monomer in 2.72 Å resolution structure ( left ) and tight circular way of chlorophyll arrangement around the hydrophobic core of the complex ( right ). Presented in freeware PyMol 0.99. (See Plate 6.5 in colour plate section.)
Rupan_c06.indd 117 8/29/2012 5:37:13 PM
118 The Photosynthetic Membrane
terminal emitter locus that receives energy from the rest of chlorophylls within a few pico-
seconds. The excitonic coupling between Chl a 611 and Chl a 612 is about 150 cm −1 , the
highest of all chlorophylls. These pair forms a distinct dimer. Chls a are bound to the pro-
tein via a number of various types of ligands. For example Chl a 611 is only bound into the
complex via the phosphodiester group of phospholipids (PG) that ligates the central mag-
nesium atom. No other specific ligands are found to this pigment. Chl a 610 is ligated by
two aminoacids. Glutamate E180 binds the central magnesium atom and G158 hydrogen
bonds C13 1 carbonyl of the Vth ring of chlorine (see Chapter 5 for the nomenclature). This
Figure 6.6 Chlorophylls a of LHCIIb monomer. Arrangement around the apoprotein ( top ), geometry and nomenclature ( middle ) and types of ligands ( bottom ). Ph: phospholipid. Presented in freeware PyMol 0.99. (See Plate 6.6 in colour plate section.)
Rupan_c06.indd 118 8/29/2012 5:37:13 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 119
double binding ensures not only the strength but also a robust orientation of the molecule,
essential for the optimal energy transfer efficiency between chlorophylls. In case of Chl
a 602 there are three aminoacids involved in binding: E65, central ligand and Y44 and W46
that both form hydrogen bonds with C13 1 carbonyl. Sometimes water can be involved in the
C13 1 bonding, as in the case of Chl a 603 or can even be a central ligand, as in the case of
the Chl a 604. The structure from Liu et al . ( 2004 ) revealed 70 water molecules present in
LHCIIb monomer, a remarkable number for a small membrane protein.
The reasons why there is a variety of types of ligands for chlorophyll such as aminoac-
ids, lipids and water are not yet understood. Chlorophyll ligands form the core of the bind-
ing pocket that is specifically designed for chlorophylls a and b . Therefore there are no
mixed chlorophyll binding sites, as was previously believed, and the stoichiometry of these
chlorophylls always remains constant. This precision in pigment binding and their accurate
position within binding loci is a manifestation of molecular order ensured by the ‘pro-
grammed solvent’ (see Chapter 5). Coordination interactions and hydrogen bonds are well-
pitched in space, so that the interpigment distance variations are minimal so is the level of
entropy in the whole complex. As was stated in Chapter 1, control of entropy is of a para-
mount importance for life, it is a major attribute of life. The structure of LHCII is a typical
example of molecular determinism, where the genetically programmed apoprotein is capa-
ble of self-assembly, always predictable pigment binding and formation of a tertiary struc-
ture: a remarkable achievement of molecular evolution of life. Yet, the structure is not
frozen. At ambient temperature it is fairly dynamic, as will be shown in Chapter 8. Such
dynamics is a result of remaining entropy that is restricted by the structure of the membrane
protein. This ‘tamed’ entropy is the major driving force behind various nanoscale processes
of life, such as diffusion of molecules in the membrane, their conformational dynamics,
and etc. All owing to a very fine and predetermined redistribution of various weak interac-
tive forces, such as hydrogen bonds and a variety of hydrophobic interactions (see Chapter 1).
Indeed, at 25 o C the energy brought by entropy is about 2.5 kJ mol -1 , this is within the same
order of magnitude as the energy of many hydrophobic interactions and some weak hydro-
gen bonds. Therefore, temperature is such an important factor for life. Indeed, the existence
of the ‘tamed’ entropic energy is absolutely vital for various enzymatic reactions. Hence,
life is not just a frozen order of molecules, it is a rather ‘loose’ order, that enables a certain
level of entropy: a truly existence on the edge that is called non-equilibrium thermodynam-
ics, or thermodynamics of open systems. Organism, organ, tissue, cell, organelle are all
open systems, constantly exchanging energy, substance and information with the external
environment. Therefore, cellular or organellar membranes are full of proteins that fulfill
roles of receptors, gates, transporters: all enabling the vital requirements of life’s micro-
scopic compartments (see Chapter 2).
Chlorophylls b are all localized between helices B and C apart from Chl b 601 that is
bound on the periphery of the complex on the site opposite to helix C near the N-terminal
loop with tyrosine Y24 as a central and only ligand to the magnesium atom (Figure 6.7 ).
Three chlorophylls, b 605, 606 and 607 are located closer to the lumenal site of the com-
plex. Some of these chlorophylls are also hydrogen bound to aminoacids via either C13 1 -
carbonyl or, indeed, C7-formyl: a fingerprint feature of chlorophyll b . However, in Chl
Rupan_c06.indd 119 8/29/2012 5:37:15 PM
120 The Photosynthetic Membrane
b 608 and 609 both groups are involved simultaneously in the hydrogen bonding. Chl b 609
is ligated via magnesium atom to glutamate E139, whilst glutamine Q131 of the C-helix
binds C7-formyl and histidine H68 of the helix B binds C13 1 -carbonyl (Figure 6.7 , bot-
tom). This is a truly remarkable binding arrangement in which two helical structures are
involved. An interesting dimer of chlorophylls b has been revealed by the structure from
Liu et al . ( 2004 ). Chl b 606 and b 607 form a dimer that is bridged by a water molecule that
forms one hydrogen bond with central magnesium atom of Chl b 607 and another hydro-
gen bond with a C7-formyl group of Chl b 606 (Figure 6.7 , bottom). This is an unusual
Figure 6.7 Chlorophylls b of the LHCIIb monomer. Arrangement around the apoprotein ( top ), geometry and nomenclature ( middle ) and types of ligands ( bottom ). Presented in freeware PyMol 0.99. (See Plate 6.7 in colour plate section.)
Rupan_c06.indd 120 8/29/2012 5:37:15 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 121
configuration that will be discussed at length along with the role of the other four hydro-
gen bonded formyl groups of Chl b 605, 607, 608 and 609 in Chapter 8.
LHCIIb xanthophylls have fairly fixed binding pockets too. Sometimes they are called
xanthophyll-binding domains that include not only a xanthophyll and aminoacids/helix they
interact with but also closest chlorophylls. Since the reason for the presence of different
types of xanthophylls remains a matter of numerous debates and ongoing investigations it is
common practice to show and discuss relationships between these molecules and their envi-
ronment, most of all chlorophylls, hence the emergence of the domain approach. The
domain of noexanthin is localized in a C-helix region enriched with chlorophyll b
(Figure 6.8 ). It is a fairly polar domain, since Chl b binding pockets have a few polar ami-
noacids or water and neoxanthin itself is the most polar of all LHCII antenna xanthophylls.
Neoxanthin position in the structure is very unusual since the half of the molecule sticks out
of the monomer interior, making it a very peripheral xanthophyll. One would expect a lower
affinity of binding because of this, however, actually it is not the case. Biochemical work
discovered that this xanthophyll is actually very strongly bound into LHCIIb structure. One
of the reasons for this can be seen in Figure 6.8 (right), that shows a hydrogen bond from
tyrosine Y112 to the hydroxyl oxygen of neoxanthin. Another factor could be a 9- cis con-
formation of the end of neoxanthin that is placed in the hydrophobic interior of the complex.
The cis conformation makes neoxanthin more structurally anchored within the hydrophobic
pocket made by chlorophylls and their phytol tails (notably Chl a 604, b608-609). The
whole domain structure suggests that there should be a strong cooperation in pigment bind-
ing overall in the neoxanthin domain. As if neoxanthin is planted into a special ‘cleft’, as
was defined by Chang, formed by a number of chlorophylls and insures their special separa-
tion along with the aminoacids such as L134, M135, V138 (helix C) and W71 (helix B) and
is in a van der Waals contact with this environment (see Figure 6.8 , left). This tight and
complex arrangement of neoxanthin environment explains the very high specificity of this
Figure 6.8 Structure of neoxanthin-binding domain of LHCIIb showing enrichment in Chl b ( left ) and 9- cis end of the molecule hydrogen bonded to tyrosine Y112 ( right ) in the vicinity of the antiparallel strand of the lumenal loop near helices C and E. Presented in freeware PyMol 0.99. (See Plate 6.8 in colour plate section.)
Rupan_c06.indd 121 8/29/2012 5:37:15 PM
122 The Photosynthetic Membrane
binding site as was shown in a previous paragraph that discussed the resonance Raman
work. Indeed, this site is rather specific for the 9- cis xanthophyll conformation of a very
polar molecule like neoxanthin or violaxanthin.
Lutein 620 (Lutein 1 in the old nomenclature) is localized in the area of a terminal
emitter chlorophylls a 610-612 (Figure 6.9 ) near helices A and B. It is well-bound to
specific aminoacids localized closer to the stromal and lumenal site by strong hydrogen
bonds via hydroxyl oxygen atoms. On the stromal site, two aminoacids, arginine R162
and leucine L164 from the loop between helices A and C both form these bonds. On the
Figure 6.9 Structure of lutein 620-binding domain of LHCIIb showing the terminal emitter chlorophylls a610-612 ( top ) and hydrogen bonding patterns to hydroxyl oxygens of the xanthophyll ( bottom ). Presented in freeware PyMol 0.99. (See Plate 6.9 in colour plate section.)
Rupan_c06.indd 122 8/29/2012 5:37:15 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 123
lumenal site, amonoacids proline P205 (helix E) and glutamine Q197 (helix A) form
similar hydrogen bonds to the hydroxyl oxygen of the β -ring. Numerous site chain ami-
noacid residues of helices A and B form a hydrophobic groove that accommodates lutein
620 and holds it by various van der Waals interactions. Hence, as all chlorophylls and
neoxanthin, this lutein is bound by the two types of forces; hydrophobic and hydrogen
bonds. The latter are likely to be a dominating binding factor that holds lutein at an angle
of 31 o with respect to the membrane plane. The hydrophobic groove assists this position-
ing and is likely to ensure efficient self-assembly of the protein during the assembly in vivo or reconstitution procedure in vitro (see Chapter 4). Since the both luteins are found
to be essential for LHCII assembly and stability they must play a crucial structure-stabi-
lizing role for the complex.
Lutein 621 (Lutein 2 in the old nomenclature) is positioned in a similar manner to
Lutein 620 but on the other site behind helices A and B in a similar hydrophobic grove
made by the site chain aminoacid residues and anchored by the hydrogen bonds from
aminoacids localized on the stromal (n-terminal loop aminoacids N47, W48 and A49) and
lumenal (lumenal loop tryptophan W97 between helixes C and B) (Figure 6.10 ). This
binding arrangement ensures ~33 o tilt of this xanthophyll with the respect to the mem-
brane plane. Hence. we observe symmetry in arrangement of the two luteins around heli-
ces A and B giving a very robust structure of the hydrophobic core of the complex.
Interesting feature of Lutein 621 is that it is localized on the inner site of the monomer.
When the complex is in the trimeric state the ε -ring end of this lutein is facing Chl a 603
that is localized on the neighbouring monomer. The chlorophyll is positioned in such a
way that all its five oxygen atoms are directly facing the ε -ring. Such arrangement is
likely to exert a strong field effect upon lutein 621 with consequences on its absorption
spectrum that will be discussed in Chapter 8.
The fourth xanthophyll is localized closer to the monomer-monomer border; it is in all-
trans conformation and unlike the rest of the xanthophylls does not form any hydrogen
bonds with the protein or other pigments (Figure 6.11 ). Unlike other xanthophylls it forms
a relatively large angle to the membrane plain, 56 o : nearly twice bigger than that formed by
other xanthophylls. The binding pocket is mainly hydrophobic, formed by the phospho-
lipid, Chl b 601 and Chl a 613-614 and hydrophobic aminoacids, most notably, on the
C-terminus of the protein, tryptophan W222 and Phenylalanine F228. Since this xantho-
phyll revealed slight differences in the densities of its end groups it was originally assigned
to antheraxanthin: an intermediate of the xanthophylls cycle, essentially a molecule that is
half violaxanthin and half zeaxanthin (see Figure 5.13 from Chapter 5). Later, it was con-
cluded, that since the LHCIIb preparation that was used for crystallization was mainly
enriched in violaxanthin, the xanthophyll structure represents a mixed binding of violaxan-
thin and antheraxanthin. The latter fact implies that de-epoxidation on at least one end
group of violaxanthin does not change the localization of the xanthophylls within the bind-
ing pocket. Although, for the de-epoxidation of the lumenal-site facing ring the removal of
the xanthophyll would likely to be necessary. The xanthophyll cycle activity will be dis-
cussed further in detail in Chapter 9. Interestingly, although violaxanthin is closely sur-
rounded by chlorophylls b 601, a 613 and a 614 it is unlikely to be energetically coupled to
Rupan_c06.indd 123 8/29/2012 5:37:16 PM
124 The Photosynthetic Membrane
them due to unfavourable mutual orientations of the transition dipole moments. This notion
has been confirmed by Breton and coworkers (Caffari et al ., 2001) who used the method of
excitation fluorescence spectral measurements (see Chapter 5) to show that violaxanthin
does not play the light harvesting function in isolated LHCIIb complex.
Figure 6.10 Structure of lutein 621-binding domain showing the domain chlorophyllsa 602-604 ( top left ), hydrogen bonding patterns to hydroxyl oxygens of the xanthophyll ( top right ) and interaction with Chl a603 localized on the neighbouring LHCIIb monomer ( bottom ). Presented in freeware PyMol 0.99. (See Plate 6.10 in colour plate section.)
Rupan_c06.indd 124 8/29/2012 5:37:16 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 125
Figure 6.11 (bottom) displays the arrangement of all four xanthophylls in the LHCIIb
monomer. There is a certain degree of symmetry in it. The top view clearly displays this
idea. The position of luteins relative to helixes is nearly symmetric, supporting the super-
coil helical structure and building in fact a mixed supercoil of the helical and polyene
structure. Neoxanthin and violaxanthin are clearly peripheral, positioned on the opposite
ends of the complex and asymmetric, mainly due to more perpendicular orientation of
violaxanthin relatively to the membrane plane. Unlike the other xanthophylls, violaxanthin
is positioned far away from membrane-spanning helixes and their hydrophobic grooves
that provide van der Waals binding forces that accommodate xanthophylls in the binding
Figure 6.11 Structure of violaxanthin-binding domain of LHCIIb showing interactions with chlorophylls a 613-614 ( top left ), Chl b601 ( top right ). Below are shown the side ( left ) and top ( right ) views of all LHCIIb xanthophylls arrangement within the complex. Presented in freeware PyMol 0.99. (See Plate 6.11 in colour plate section.)
Rupan_c06.indd 125 8/29/2012 5:37:16 PM
126 The Photosynthetic Membrane
pocket. Such arrangement of violaxanthin as well as the absence of any hydrogen bonds
with the protein environment can explain why the experimentally-determined affinity of
binding of this xanthophyll is the lowest of all LHCIIb carotenoids and why it took some
time to develop gentle membrane solubilization procedures to preserve it from being lost
from the complex. The story of violaxanthin binding to LHCIIb demonstrates difficulties
in structural research of membrane complexes isolated from their natural environment.
Differential affinity of cofactors’ binding is likely to yield controversial results and delay
the progress towards understanding the complete structure of a membrane protein.
Figure 6.12 shows localization of phospholipid (PG) within the structure of LHCIIb. It
is positioned on the interface between the monomers. The bulky hydrophobic structure
forms large hydrophobic contact surface with the protein and chlorophylls of the locus.
This lipid is essential to for trimerization of the complex. Phospholipase treatment that
removes PG was shown to effectively cause monomerization of trimers. Trimeric structure
of LHCIIb ensures a certain order in positioning of all its 42 chlorophylls. Twenty-four
chlorophylls positioned closer to the stromal surface of the membrane form two circular
rings, highlighted in Figure 6.13 . The inner ring made by Chls a 602 and a 603 ensures effi-
cient intermonomer energy transfer, whilst the outer ring collects energy from all chloro-
phylls of the complex, focuses it on the terminal emitter pigments, Chls a 610-612, which
are ready to give it to the neighbouring complexes: LHCs or, indeed, core photosystem II
antennae (see Chapter 3). Lumenal site facing chlorophylls are likely to collect the absorbed
energy and transfer it upstream to the stromal site facing pigments.
6.5 Structure of a Minor LHCII Complex CP29
Recently Chang’s group (Pan et al ., 2011 ) has produced a structure of another LHCII com-
plex, CP29 or LHCIIa. This is one of the minor PSII antenna complexes that is localized
between LHCII trimer and the inner antenna complex CP47 and is always isolated in a
Figure 6.12 Localization of phosphatidylglycerol (PG) within LHCIIb trimer.PG is shown in black and lighter shading. Presented in freeware PyMol 0.99.
Rupan_c06.indd 126 8/29/2012 5:37:17 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 127
monomeric state. As was mentioned earlier in this chapter, the minor antenna complexes
CP24, 26 and 29 have been discovered, characterized and isolated later than the major
LHCIIb trimeric complex. Since the amount of them is much lower than the amount of
LHCIIb and they tend to be much less stable than the latter, the biochemical characterization
and structural work has not progressed that far as for the major light harvesting complex.
Chang’s preparation was largely based on the preparative ion-exchange chromatography
approach first applied by Henrysson and coworkers (1989) for the isolation of CP29. These
group actually first isolated this complex in preparative amounts and characterized it
biochemically and spectroscopically. Large quantities of the isolated complex and very high
purity were key factors that enabled Chang to obtain crystals that diffracted at 2.8 Å (Liu
et al ., 2004 ). The chromatography procedure and further gel filtration step applied to improve
the sample purity as well as the crystallization routine were in fact very harsh and lengthy
treatments resulted in the cleavage of very large N-terminal domain of about 70 aminoacids.
However, this domain is believed not to be involved in chlorophyll binding and the produced
Figure 6.13 Organization of all pigments of LHCIIb trimer. Inner and outer pigment rings are highlighted. Arrows show the likely directions of energy transfer from the trimer. Presented in freeware PyMol 0.99.
Rupan_c06.indd 127 8/29/2012 5:37:17 PM
128 The Photosynthetic Membrane
structure revealed 13 chlorophyll molecules attached, eight Chl a , four Chl b and a mixed
site of a and b at the 610 location, that was assigned to Chl a 610 in the published structure.
The latter is likely to be an uncertainty of not extremely high resolution as well as the effects
on the structure of the preparation and crystallization procedures. Apart from the missing
N-terminal fragment the structure of CP29 apoprotein is remarkably similar to that of
LHCIIb (Figure 6.14 , top). However, all three transmembrane helixes are shorter than those
of LHCIIb, positions and lengths of amphiphilic helixes D and E are slightly altered and
C-terminus is lacking the motif that is involved in trimerization. These differences in the
protein structure affected some pigment binding patterns, but not all. The central ligation by
water of chlorophylls a 604, b 606, b 607 and b 608 is preserved as well as a special dimer of
chlorophylls b 606 and b607 and chlorophylls a 602, 603, 604, 611, 612, 613 and b608.
Nevertheless, the new structure revealed some alterations in pigments. Chlorophylls b 601
and b 605 are missing; chlorophyll a 614 became chlorophyll b 614; chlorophyll b 609 became
Figure 6.14 Structure of CP29 (LHCIIa) complex at 2.8 Å resolution. Top : side and top views of the whole complex; middle : all xanthophylls view; bottom : the putative terminal emitter chlorophylls a . Presented in freeware PyMol 0.99. (See Plate 6.14 in colour plate section.)
Rupan_c06.indd 128 8/29/2012 5:37:18 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 129
a 609 and new chlorophyll a 615 is present at the stromal site of the complex near the termi-
nal emitter locus. This chlorophyll strongly interacts with Chl a 611 forming a close to
H-type dimer, where the centres of chlorine rings are positioned at the record close distance
of only around 7 Å (Figure 6.14 , middle). Now, only two chlorophyll a s, a 604 and a 613, are
localized closer to the lumenal site of the complex. The chlorophyll b population is mainly
positioned near the C helix as in LHCIIb. Only Chl b 614 is moved out of this locus.
The CP29 structure revealed only three xanthophyll molecules, neoxanthin, lutein at 620
location (lutein 1) and violaxanthin at 621 location (lutein 2), replacing lutein 621. The latter
fact is consistent with the previous biochemical evidence. Neoxanthin was found in 9- cis
conformation but more bent than the one of LHCIIb due to rotation around C29 atom result-
ing in a smaller angle between its transition dipole moment and the membrane plane (~30 o )
(Figure 6.14 , bottom). Without the fourth xanthophyll the whole structure of the complex
looks less symmetric than that of LHCIIb. Despite the interesting alterations revealed in the
structure of CP29 and novel details described above, the work left a few unanswered ques-
tions. First is related to the missing N-terminal fragment. It is very large in comparison to the
analogous structures of all LHCII polypeptides and is likely to play a specific yet unknown
role. In addition, the fourth xanthophyll is missing in the structure despite the evidence that
is based on the carotenoid to chlorophyll ratio determinations. The latter suggested this ratio
to be around 0.29, corresponding to four xanthophylls and 13 chlorophylls per CP29 com-
plex as opposed to only 0.23 when there are only three xanthophylls. Furthermore, the rela-
tively high enrichment in chlorophyll b and the absorption spectrum of crystallized CP29 are
not entirely typical for previously reported CP29 preparations, that suggested rather lower
relative content of Chl b . Interesting, however, remains the fact the violaxanthin is bound to
lutein 621 binding pocket. The fact that violaxanthin assumes very effective energy transfer
connectivity to chlorophylls a 602 and 603 and b 606-607 makes it very different from the
violavathin bound to V1 site in LHCIIb. In addition, in CP29 violaxanthin is much stronger
bound to the complex as was discovered in the early biochemical and recent theoretical
modelling work. Therefore, often the question arises of a likelihood of poor availability of
violaxanthin to the enzyme de-epoxidase converting it into zeaxanthin: a key mechanistic
event in the major photoprotective mechanism of PSII (see Chapter 9).
6.6 Comparison of LHCII Structure with the Structure of a Simpler Light Harvesting Complex from Purple Bacteria, LH2
There is a variety of different types of light harvesting complexes in different classes of pho-
tosynthetic organisms. Diversity of antenna types is a result of diversity of types of light
habitats of these organisms. Hence, antenna evolution is a result of constant adaptive selec-
tion processes caused by the simple fact that life forms tend to constantly proliferate in space,
conquering various niches and expanding the borders of conditions suitable for life. In this
respect it is interesting to compare the design of the light harvesting complex of one of the
most oldest and well-studied photosynthetic organisms, a purple bacteria Rhodobacter sphaeroides with the structure of LHCII complex. Figure 6.15 shows the monomeric unit of
Rupan_c06.indd 129 8/29/2012 5:37:18 PM
130 The Photosynthetic Membrane
LH2 complex from this organism. This complex forms a peripheral antenna, as LHCII. The
unit is built of two noncovalently associated apoproteins of much lower molecular weight as
the one of LHCII. In weight, α and β polypeptides are only ~5.8 and ~4.8 kDa, respectively,
as opposed to ~28 kDa of LHCII polypeptide. Both polypeptides form transmembrane
α -helixes that are very hydrophobic. The α -polypeptide also forms a small amphipathic helix
Figure 6.15 Structure of a monomeric unit of LH2 antenna complex from Rhodobacter sphaeroides at 2.5 Å resolution. Top : different site views of LH2, a and b indicate the polypeptides of LH2. Bottom : pigment cluster of LH2: carotenoid rhodopin glucoside (RG), 1 Chl800 and 2 BChl850. Presented in freeware PyMol 0.99.
Rupan_c06.indd 130 8/29/2012 5:37:18 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 131
at its C-terminus. Each unit of LH2 binds only three bacteriochlorophylls, one absorbing at
800 nm (BChl800) and two absorbing at 850 nm (BChl850). There is only one carotenoid,
rhodopin glucoside that is, in fact, a detergent with a long conjugated hydrophobic carbon
chain (see Chapter 3). Therefore the carotenoid is an asymmetric molecule that spans the
membrane and takes part in stabilization of interaction between the two polypeptides of LH2.
All three chlorophylls form a tight special association with rhodopin glucoside’s hydropho-
bic end assisted by their phytol tails (Figure 6.15 , bottom). Such close positioning of these
molecules ensures energy transfer between them and the carotenoid. The arrangement of two
BChl850 resembles of that of a J-type dimer, since their ring structures only partially overlap.
Another striking feature of pigment positioning is that the orientation of the BChl800 ring (as
well as the transition dipole moment) is almost parallel to the membrane plane. Therefore,
even at the level of the monomeric unit one can see signs of a specific pigment order within
the LH2 complex. The order becomes apparent when the structure of the whole oligomeric
LH2 unit is considered. Figure 6.16 shows the structure of the ring that is formed by nine
Figure 6.16 Structure of a complete oligomeric unit of LH2 antenna complex from Rhodobacter sphaeroides at 2.5 Å resolution. Top : LH2 apoprotein; bottom : BChl800 ( left ) and BChl850 ( right ) pigment order. Presented in freeware PyMol 0.99.
Rupan_c06.indd 131 8/29/2012 5:37:19 PM
132 The Photosynthetic Membrane
LH2 monomeric units. Its two polypeptides form two concentration circles; the outer one is
formed by β −polypeptide and the inner by the α . The resulting structure looks very sym-
metrical, more symmetrical then the structure of LHCII trimer. The pigment arrangement is
symmetrical too. Nine BChl800 molecules are arranged in a ring with the equal distances
between them of ~21 Å: a distance for efficient Förster-type energy transfer. Not only the
distance but the orientation of the transition dipole moments is all perfectly uniform and
organized for the nearly optimal energy transfer rate. These features of BChl800 are ensured
by the coordination of magnesium with formyl methionine residue, N-terminal aminoacid of
α −polypeptide and additional robustness is achieved by the hydrogen bond from arginine
R20 of the β −polypeptide.
The order in the arrangement of 18 BChl850 is even more striking. The molecules are
well positioned within the interior between the two concentration circles of α − and β −
polypeptides and firmly coordinated by two histidine residues located on each of these
polypeptides. In addition, the ring carbonyls are hydrogen-bonded by tryptophan W45 of
the α −polypeptide, ensuring further robustness in orientation and positioning. As a result a
very symmetric crown-type arrangement of BChl850 is achieved, enabling a very fast, sub-
picosecond energy transfer between these pigments.
The whole structure of LH2 pigment population looks very well-ordered, more than
that of the LHCII, where the symmetry is held only in the supercoiled helices A and B
and is broken by the introduction of helix C and less ordered pigment binding. The sizes
of LH2 oligomer and LHCII trimer are very similar (~8 nm in diameter each). However,
LHCII is not a hollow particle as LH2. The interior is filled with pigments that form a
far from being symmetric inner circle. The total number of LHCII trimer bound pig-
ments is 54, including carotenoids, whilst LH2 binds only 36 pigments (50% less). On
the other hand, the total molecular weight of the polypeptides required to organize LH2
and LHCII pigments is approximately the same (~90 kDa). It seems that the higher
plants managed to pack more pigments into the light harvesting complex. In addition, it
takes only a few to form a trimeric structure as opposed to the nanomeric one of the LH2.
The structure of LHCII is less symmetric and hence less organized than the one of LH2.
One of the likely explanations is that there was a pressure to increase the cross-section
of antenna without the increase in the space it took in the membrane. The increase in
pigment concentration is a risky venture due to the danger of the concentration quench-
ing that leads to very fast energy dissipation within concentrated pigments, hence
undermines the efficiency of light energy storage within the antenna and the photosystem
efficiency as a whole (see Chapter 5). The nature had to balance between the cross-section
size and the efficiency of the placed pigments at high concentration. The symmetric
arrangement that was utilized by early evolution in purple bacteria has reached its limits
and therefore other solutions have been tried. As a result, the evolved LHCII came up as
less ordered structure, but more solid for it contained a fewer apoprotein subunits,
binding more pigments per volume and with ability to flexibly control its efficiency
(see Chapters 8 and 9). Hence, the increased entropy in the light harvesting design
was a positive evolutionary achievement, that offered more adaptable system, providing
the reaction centre with the right amount of energy required for photosynthesis and the
Rupan_c06.indd 132 8/29/2012 5:37:19 PM
Towards the Atomic Resolution Structure of Light Harvesting Antennae 133
organism as a whole. As will be shown in Chapter 9, the rather careful light harvesting
is indeed vitally required for oxygenic photosynthesis.
References
Anderson , J.M. ( 1980 ) Chlorophyll-protein complexes of higher plant thylakoids: distribution, stoi-chiometry and organization in the photosynthetic unit . FEBS Lett. , 117 , 327 – 331 .
Anderson , J.M. ( 1982 ) The role of chlorophyll-protein complexes in the function and structure of chloroplast thylakoids . Mol. Cell. Biochem. , 46 , 161 – 172 .
Armond , P.A. , Staehelin , L.A. , Arntzen , C.J . ( 1977 ) Spatial relationship pf photosystem I. photosys-tem II, and the light-harvesting complex in chloroplast membranes . J. Cell Biol ., 73 , 400 – 418 .
Bassi , R. and Caffarri , S. ( 2000 ) LHC proteins and the regulation of photosynthetic light harvesting by xanthophylls . Photos. Research , 64 , 243 – 236 .
Bassi , R. , Høyer-Hansen , G. , Barbato , R. , Giacometti , G.M. and Simpson , D.J. ( 1987 ) Chlorophyll-proteins of the photosystem II antenna system . J. Biol. Chem. , 27 , 13333 – 13341 .
Bassi , R. , Sandona , D. and Croce , R. ( 1997 ) Novel aspects of chlorophyll a/b -binding proteins . Physiol. Plantarum , 100 , 769 – 779 .
Butler , P.J.G. and Kühlbrandt , W. ( 1988 ) Determination of the aggregate size in detergent solution of the light-harvesting chlorophyll a/b -protein complex from chloroplast membranes . Proc. Natl. Acad. Sci. USA , 85 , 3797 – 3801 .
Caffarri , S. , Croce , R. , Breton , J. and Bassi , R. ( 2001 ) The major antenna complex of photosystem II has a xanthophyll binding site not involved in light harvesting . J. Biol. Chem. , 273 , 35924 – 35933 .
Henrysson , T. , Schröder , W.P. , Spangfort , M. and Åkerlund , H.E. ( 1989 ) Isolation and characteriza-tion of the chlorophyll a/b protein complex CP29 from spinach . Biochim. Biophys. Acta , 977 , 301 – 308 .
Kühlbrandt , W. , Thaler , T.H. and Wehrli , E. ( 1983 ) The structure of membrane crystals of the light-harvesting chlorophyll a/b protein complex . J. Cell Biol. , 96 , 1414 – 1424 .
Kühlbrandt , W. and Wang , D.N. ( 1991 ) Three-dimensional structure of plant light-harvesting com-plex determined by electron crystallography . Nature , 350 , 130 – 134 .
Kühlbrandt , W. , Wang , D.N. and Fujiyoshi , Y. ( 1994 ) Atomic model of plant light-harvesting com-plex by electron crystallography . Nature , 367 , 614 – 621 .
Liu , Z. , Yan , H. , Wang , K ., et al . ( 2004 ) Crystal structure of spinach major light-harvesting complex at 2.72 Å resolution . Nature , 428 , 287 – 292 .
Machold , O. and Meister , A. ( 1979 ) Resolution of the light-harvesting chlorophyll a/b complex of Vicia faba chloroplasts into two different chlorophyll-protein complexes . Biochim. Biophys. Acta , 546 , 472 – 480 .
Pan , X. , Li , M. , Wan , T. , et al . ( 2011 ) Structural insights into energy regulation of light-harvesting complex from spinach CP29 . Nature Structural Biology , 18 , 309 – 316 .
Peter , G. and Thornber , J.P. ( 1991 ) Biochemical composition and organization of higher plant photo-system II light-harvesting pigment proteins . J. Biol. Chem. , 266 , 16745 – 16754 .
Robert , B. , Horton , P. , Pascal , A. and Ruban , A.V. ( 2004 ) Insights into the molecular dynamics of plant light-harvesting proteins in vivo . Trends in Plant Science , 9 , 385 – 390 .
Ruban , A.V. , Lee , P.J. Wentworth , M. , et al . ( 1999 ) Determination of the stoichiometry and strength of binding of different xanthophylls to the photosystem II light harvesting complexes . J. Biol. Chem. , 274 , 10458 – 10465 .
Ryrie , I.J. , Anderson , J.M. and Goodchild , D.J. ( 1980 ) The role of light-harvesting chlorophyll a/b complex in chloroplast membrane stacking. Cation-induced aggregation of reconstituted prote-oliposomes . Eur. J. Biochem ., 107 , 345 – 354 .
Smith . E.L . and Pickels , E.G. ( 1941 ) The effect of detergents on the chlorophyll- protein compound of spinach as studied in the ultracentnfuge . J. Gen. Physiology , 24 , 753 – 764 .
Rupan_c06.indd 133 8/29/2012 5:37:19 PM
134 The Photosynthetic Membrane
Bibliography
Argyroudiakoyunoglou , J.H. and Castorinis , A. ( 1980 ) Specificity of the chlorophyll-to-protein binding in the chlorophyll-protein complexes of the thylakoid . Arch. Biochem. Biophys. , 200 , 326 – 335 .
Blankenship , R. ( 2002 ) Molecular Mechanisms of Photosynthesis . London : Blackwell Science . Bricker , T.M. ( 1990 ) The structure and function of CPa-1 and CPa-2 in photosystem II . Photosynth.
Res. , 24 , 1 – 13 . Camm , E.L. and Green , B.R. ( 2004 ) How the chlorophyll-proteins got their names . Photosynth.
Research , 80 , 189 – 196 . Chiba , Y. ( 1960 ) Electrophoretic and sedimentation studies on chloroplast proteins solubilized with
surface-active agents . Arch. Biochem. Biophys. , 90 , 294 – 303 . Cinque , G. , Croce , R. and Bassi , R. ( 2000 ) Absorption spectra of chlorophyll a and b in Lhcb protein
environment . Photosynth. Research , 64 , 233 – 242 . Cogdell , R.J. and Isaacs , N.W. ( 1995 ) Crystal structure of an integral membrane light-harvesting
complex from photosynthetic bacteria . Nature , 374 , 517 – 521 . Green , B.R. and Durnford , D.G. ( 1996 ) The chlorophyll-carotenoid proteins of oxygenic photosynthesis .
Annu. Rev. Plant Physiol. Plant Mol. Biol. , 47 , 685 – 714 . Landrum , J. (ed.) ( 2009 ) Carotenoids: Physical, Chemical and Biological Functions and Properties .
Florida International University : CRC Press . McDermott , G. , Prince , S.M. , Freer , A.A. , et al ., ( 1966 ) Two pigment proteins in spinach chloroplasts .
Biochim. Biophys. Acta , 112 , 223 – 234 . Ruban , A.V. , Pascal , A. and Robert , B. ( 2000 ) Xanthophylls of the major photosynthetic light-harvesting
complex of plants: identification, conformation and dynamics . FEBS Lett. , 477 , 181 – 185 . Snyder , A.M. , Clark , B.M. , Robert , B. , et al ., ( 2004 ) Carotenoid specificity of light-harvesting complex
II binding sites: occurrence of 9- cis violaxanthin in the neoxanthin-binding site in the parasitic angiosperm Cuscuta reflexa . J. Biol. Chem. , 279 , 5162 – 5168 .
Thornber , J.P. ( 1975 ) Chlorophyll-proteins: light-harvesting and reaction centre components of plants . Ann. Rev. Plant Phyiol. , 26 , 127 – 158 .
Thornber , J.P. , Markwell , J.P. and Reinman , S. ( 1979 ) Plant chlorophyll-protein complexes – recent advances . Photochem. Photobiol. , 29 , 1205 – 1216 .
Thornber , J.P. and Olson , J.M. ( 1971 ) Chlorophyll-proteins and reaction centre preparations from photosynthetic bacteria, algae and higher plants . Photochem. Photobiol. , 14 , 329 – 341 .
Rupan_c06.indd 134 8/29/2012 5:37:19 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
‘This … whatever-it-was … has now been joined by another … whatever-it-is … and they are now proceeding in company .’
Winnie-the-Pooh (by Alan Alexander Milne)
The previous chapter described in atomic detail the structures of the major and one of the
minor light harvesting complexes of photosystem II. This chapter is dedicated to
the equally-important theme of structural integration of the photosynthetic antenna within
the photosystem. Photosystem II, the heaviest and evolutionary the youngest complex
in the photosynthetic membrane, contains the most convoluted light harvesting antenna.
This chapter shows how the combination of structural and biochemical research has
evolved our current knowledge of the macrostructural organization of the photosynthetic
unit. It has been some time since the photosynthetic unit concept was put forward; how-
ever, it took a few decades to unravel its structure with the precision necessary to under-
stand how the functions and adaptive mechanisms are built in. As was discussed in detail
in Chapter 3 the multi-subunit organization of the photosynthetic membrane complexes is
vitally important for sustaining their optimal ‘working regime’ and is an inevitable conse-
quence of a sequential character of the energy transformation events in the light phase of
photosynthesis. Lowering the entropy of the system; the ability to bind, stabilize and coor-
dinate the cofactors; the requirement for concerted and precise performance of the energy
transformation reactions; the multifunctional performance and the fulfilment of the regula-
tion requirement; are all essential advantages and features of a macrostructural multi-
subunit organization. The processes of photon absorption, excitation energy delivery to the
reaction centre, primary and secondary charge separation and rereduction of the oxidized
Structural Integration of Antennae within Photosystems
7
Rupan_c07.indd 135 8/29/2012 5:36:44 PM
136 The Photosynthetic Membrane
donors are all taking place and fairly coherent within the macrostructure of the photosystem II.
The heterogeneity of light harvesting antenna complexes and the sheer variety of antenna
types in comparison to the reaction centres are indicative of the complexity, specialization
and vital importance placed by evolution on light harvesting processes in photosynthesis
as a primary source of energy for life.
7.1 Light Harvesting Complexes Gene Family
In parallel to the development of biochemical analytical and preparative procedures of
separation and isolation of various LHCII complexes the work on identification of genes
that encode their apoproteins was underway in 1980s. By the middle of 1990s it became
clear that the entire family of nuclear genes exists that encodes a variety of polypeptides of
light harvesting antenna complexes and related proteins of the thylakoid membrane.
Progress in the Arabidopsis genome sequencing revealed at least 15 genes encoding vari-
ous LHCII antenna complexes. This offered rich information about the aminoacid sequences
of LHCII polypeptides that greatly helped the work on LHCII structure determination as
well as understanding of the folding process into the native structure with bound pigments.
Three genes encoded the polypeptides of the major LHCII, Lhcb1, 2 and 3, were identified
called Lhcb1, 2 and 3 (gene name is italicized). It was revealed that homotrimers of LHCII
exist, encoded by Lhcb1 as well as heterotrimers, encoded by Lhcb1 and 2 or Lhcb1 and 3
genes. In fact there are five types of Lhcb1 ( Lhcb1.1, 1.2, 1.3, 1.4 and 1.5 ) and four types
of Lhcb2 genes ( Lhcb2.1 , 2.2 , 2.3 and 2.4 ) that have small sequence variations. The level
of their expression varies a lot, which is not yet explained. In contrast to Lhcb1 and 2 gene
groups there is only one type of Lhcb3 . The assembly of LHCII complexes is a process that
requires N-terminus truncation of the precursor protein sequence. Hence, after such pro-
cessing, mature proteins that are encoded by Lhcb1.1, 1.2 and 1.3 are identical. Lhcb1.4
and 1.5 proteins are different, but only by a small number of aminoacid residues. They are
called Lhcb1 polypeptide isoforms. The role of such variations is not yet clear. Existence
of multiple gene copies makes it difficult to perform gene manipulations, like antisense or
knock-out as described in Chapter 4.
The minor light harvesting antenna genes, Lhcb4 (CP29), Lhcb5 (CP26) and Lhcb6
(CP24) encode Lhcb4, 5 and 6 polypeptides; the apoproteins of CP29, 26 and 24 com-
plexes, respectively. There are three gene copies of Lhcb4 and only one for each, Lhcb5
and 6 . The expression levels of Lhcb4.1 and 4.2 are more than an order of magnitude higher
than those of Lhcb4.3 . The polypeptide sequences of LHCII complexes reveal different
levels of homology. Lhcb1-2, the polypeptides of the major LHCII complex, have closer
similarity than the isoforms of Lhcb4 polypeptides (CP29). The latter is more homologous
to the Lhca subfamily that encodes polypeptides of LHCI light harvesting antenna of PSI.
CP24 polypeptide (Lhcb6) also bears homology to Lhca group. The closest relative of
Lhcb1-3 genes is Lhcb5 that encodes CP26 polypeptide. Interestingly, this polypeptide
possess WYGPDR N-terminal motif that was found essential for the formation of the trim-
eric light harvesting complex structure. Hence, CP26 can potentially form trimers as indeed
Rupan_c07.indd 136 8/29/2012 5:36:46 PM
Structural Integration of Antennae within Photosystems 137
would be shown later in this chapter. Recent studies of the Lhc gene superfamily have sug-
gested the existence, apart from mentioned 15 Lhcb genes, of the four genes of Lhca -
encoding polypeptides, Lhca1-4 that form the four types of PSI light harvesting antenna
complexes. The LHCI antenna polypeptides are related to Lhcb subfamily. Their closest
relatives from the latter are Lhcb4 and 6 of CP29 and CP24 complexes, respectively. Lhca
polypeptides all possess three transmembrane helixes. The additional light harvesting fam-
ily genes are so-called rarely-expressed genes and may play a role different from the abun-
dantly expressed ones. Genes like Lhcb7 (the most analogous to Lhcb5), Lhcb8 (formerly
Lhcb4.3 isoform), Lhca5 and Lhca6 have been recently mentioned in the literature.
Abundance of Lhc polypeptides as well as the existence of multiple subunits of inner
antenna and reaction centre components pose an obvious question: how are they all bound
to each other and what is the shape and significance of the structures that constitute the
photosynthetic unit?
7.2 Toward the Structure of a Complete Photosystem II Unit: Supercomplexes
Work of Staehelin , Miller and Simpson in early 1970s (see Staehelin, 2003 ) on the investi-
gation of the photosynthetic proteins using the freeze-fracture electron microscopy revealed
existence of densely-redistributed particles of various sizes that belonged to photosystems
I and II (similar to those shown on Figure 3.1). The particle areas varied from about 50 to
200 nm 2 . With the largest size identified as corresponding to the PSII complex. It became
clear that in vivo photosystems existed in the form of multi-subunit complexes. However,
freeze-fracture technique could not provide even basic crude structural details of these
macrocomplexes mainly due to the limited resolution (~5 nm) mainly arising from the
thickness of platinum replicas that were actually looked at (see Chapter 4). Even in case of
rarely found crystalline arrangements of PSII particles in the photosynthetic membrane,
only a few structural elements of the particle can be seen using this method. Figure 7.1
shows a fragment of a replica displaying ordered arrays of PSII particles. Arrows point
towards the four structural features within the particle that are relatively regularly repro-
duced. Nevertheless, other particles have less clear symmetry and a fewer if any features.
Hence, whilst the freeze-fracture technique is excellent for the studies of redistribution of
membrane complexes in intact photosynthetic membrane (see Chapter 9) it is not of suffi-
cient resolution to enable detailed structural characterization on the level of even the fairly
large PSII complex.
An obvious conclusion from the lack of adequate methods to map the structure of
membrane-bond photosystem complexes was to separate them from the membrane as indi-
vidual particles. The quest for isolation and characterization of antenna complexes, described
in Chapter 6 revealed the evolution of related biochemical approaches. The fundamental
feature of all of them was the type and concentration of detergent used to solubilize the
membrane and keep hydrophobic membrane proteins in solution. Several types of detergents
Rupan_c07.indd 137 8/29/2012 5:36:46 PM
138 The Photosynthetic Membrane
were used. Initially, ionic detergents SDS and deriphat as well as the nonionic detergent
Triton X100 were employed for this purpose. Unfortunately, these detergents were too harsh
to preserve some pigment binding and oligomerization states of photosynthetic complexes.
Ultracentrifugation or ‘green’ gel electrophoresis techniques that were used for separation of
different complexes normally produced significant amounts of free pigment bands and mono-
meric proteins. For the purposes of purification of individual photosystem components these
approaches were almost fine, apart from the fact that they removed pigments from the com-
plexes hence affecting their true pigment composition. Ionic detergents, in particular, could
remove pigments even at relatively small concentrations under conditions where solubiliza-
tion of proteins was still incomplete. Hence, even for the analytical purposes the search for
a milder solubilization routine was an essential step. Digitonin was another detergent that
was used in the early days of the photosynthetic membrane solubilization. However, its
primary application was to separate different membrane fragments containing photosystems
I and II (see Chapter 6). The molecule of this detergent is very large and contains a group of
glycosidic residues as well as hydrophobic steroid structure. Its solubilization action is con-
sidered to be mild and therefore appropriate for incomplete membrane solubilization at
certain conditions and therefore preservation of membrane fragments. However, even in the
early 1970s some work emerged that used digitonin in combination with the polyacrylamide
gel electrophoresis. Fradkin and coworkers ( 1972 ) reported the existence of heavy pig-
mented protein bands, larger than CP1 and 1a photosystem I bands on Anderson SDS elec-
trophoresis. Hence, it was demonstrated that it was practically possible to sustain the
intactness of highly oligomeric complexes, predominantly PSII, in an isolation procedure.
The next important step in the isolation of oligomeric intact PSII was synthesis and
application of a range of mild glycosidic detergents like octylglucoside (n-octyl- β -D-
glucoside), containing one glycosidic residue (see Figure 3.4) and dodecylmaltoside
Figure 7.1 Freeze-fracture electron microscopy image of the fragment of ordered photosystem II complexes in the photosynthetic membrane. Arrows indicate structural features within a single complex. Bar corresponds to a 50 nm scale.Courtesy of Tomasz Goral.
Rupan_c07.indd 138 8/29/2012 5:36:46 PM
Structural Integration of Antennae within Photosystems 139
(dodecyl- β -D-maltoside and dodecyl- α -D-maltoside), containing two glycosidic residues
as a hydrophilic part and a hydrophobic saturated chain of eight or 12 carbon atoms. These
detergents were smaller and simpler molecules in comparison to digitonin and possessed
relatively short hydrophobic tails. Bassi (1987) used octylglucoside to solubilize PSII-
containing membrane fragments (known as BBY particles, see Chapter 4) and obtained
oligomeric PSII complexes containing reaction centre, core antenna and light harvesting
antenna complexes. It was found that some interactions, particularly those between core
antenna proteins, CP43 and CP47 as well as LHCII and the core antenna were stabilized
via ionic interactions with participation of magnesium cations. Other complexes, such as
CP24, 26 and 29 were associated with PSII via hydrophobic interactions. Therefore, it was
established that not only the weakest, hydrophobic forces (van der Waals) are needed to
maintain the macrostructure of PSII but some stronger, ionic interactions as well. This
work prompted researchers to experiment with glycosidic detergents in order to establish a
procedure that could eventually produce relatively stable photosystem II complex with the
size of antenna matching that of the functionally-determined photosynthetic unit, that is,
~250 chlorophylls per one RCII. Generation of stable PSII macrocomplexes was essential
for structural analysis using either electron microscopy with the single particle image
enhancement analysis or crystallographic studies (see Chapter 4). Detergent solubilization
of the membrane fragments containing PSII was normally followed by either sucrose gra-
dient ultracentrifugation (see Chapter 4, Figure 4.1) or gel filtration procedure. The latter
became more common since it was relatively fast, reproducible and did not require large
amounts of sample. Figure 7.2 shows a typical gel-filtration chromatogram of separation of
160.0
0.3
0.6
Abs
orpt
ion
at 6
70 n
m, r
el.
0.9
1.2
1.5
1.8
18 20 22 24 26
Elution time, min
28 30 32 34 36
PSII
PSIPSIIcore
LHCIItrimer
LHCIImonomer
Figure 7.2 Gel filtration elution profiles of solubilized photosystem II membranes (BBY particles) and isolated LHCII trimers and monomers. Arrows relate the elution time of separately run purified LHCII trimers and monomers.
Rupan_c07.indd 139 8/29/2012 5:36:46 PM
140 The Photosynthetic Membrane
various pigment-protein complexes associated with the PSII-enriched membranes (BBY
particles). The method uses porous gel that traps and slows down the movement of smaller
particles and leaves free large ones. Therefore it works like filtration in reverse, trapping
the smaller and letting the larger complexes elute faster. Therefore, the fastest moving are
oligomeric PSII complexes or supercomplexes (PSII, 19 min elution time). Some minor
presence of PSI complexes is also detected by the shoulder at ~22 min elution time. Smaller
PSII core complexes devoid of light harvesting antenna are eluted at 24 min. Next are
eluted even smaller LHCII trimers followed by monomers (27 and 30 min elution times,
respectively). Denaturing polyacrylamide gel electrophoresis is normally used to analyse
the polypeptide compositions of all fractions. The oligomeric PSII band is identified as
containing minor and some major LHCII complexes apart from the core PSII complexes.
However, since there is significant amount of separate LHCII trimers it is possible that not
all of them are associated with the PSII fraction.
The first single particle images of oligomeric PSII fractions from higher plants using
dodecyl- β -D-maltoside for solubilization of membranes enriched in PSII (BBY frag-
ments/particles) were obtained by Boekema in mid-1990s. Initially, sucrose gradient sepa-
ration procedure was used, which later was replaced by the gel filtration method (Boekema,
1995 ). Figure 7.3 shows the first image of an oligomeric PSII particle (supercomplex) that
contained RCII, core antenna, minor and trimeric LHCII complexes and was ~700 kDa.
The dimensions were ~27 nm long and ~12 nm wide, that corresponds to the area of ~320
nm 2 . This is more than 60% larger than the average reported area of the PSII particles on
EFs freeze fracture membrane surfaces (see previous), meaning that the freeze-fracture
method did not reveal peripheral light harvesting complexes and showed mostly RCII core
complexes. Indeed, LHCII was found to be localized on the complimentary, PFs surface
of the grana membranes (see Chapter 4, Figure 4.5). Remarkably the supercomplex struc-
ture revealed dimeric organization of the photosystem. Further investigations showed that
this particle, named the PSII supercomplex, lacked one of the minor LHCII antenna pro-
teins, CP24. The complex was named C2S2 particle, meaning it contained dimeric core
(C) and two LHCII trimers (S), strongly attached to the core via the two copies of two
types of the minor antenna complexes, CP26 and CP29. The localization of the core com-
plex proteins in the supercomplex map has been a subject of debates and guesses based
mainly upon work using cross-linkers: binary reagents useful for identification of neigh-
bours in the complex oligomeric structure as PSII. The Figure 7.3 caption describes some
of the structure assignments done on the basis of cross-linking experiments. It became
later apparent that the particles seen on the freeze-fracture replicas of PSII membranes
(EFs surfaces) (Figure 7.1 ) corresponded to C2 or PSII core with probably some minor
LHCII antenna complexes only (see Chapter 9 for more detail). The minor antenna com-
plexes seem to be acting as linkers of the trimeric LHCII to the core antenna, CP43 and
CP47 complexes. Trimeric LHCII was found to be more robust and stable and less hydro-
phobic in comparison to the monomeric (minor) LHCs, suggesting that the latter are more
intrinsic complexes and less independent from the supercomplex structure than trimers.
Whilst the assignment of LHCII trimer locations was not difficult to guess, the assign-
ment of the densities corresponding to the minor LHCII complexes was not strait forward
Rupan_c07.indd 140 8/29/2012 5:36:47 PM
Structural Integration of Antennae within Photosystems 141
due to their intrinsic location and small size. Structural studies on PSII supercomplexes
using the method described previously have only revealed the density areas which matched
the estimated size of a monomeric LHC complex. Biochemical analysis of purified super-
complex preparations showed the presence of CP26 and CP29, and it was therefore assumed
that two areas, on either side of the supercomplex, 5 + 6 and 7 + 8, are occupied by these
two proteins (Figure 7.3 ). Since CP26 and CP29 complexes are predicted to have similar
overall shape, it obviously could not be deduced at which of the two potential sites CP26
and CP29 were located. The assignment of CP26 and CP29 in the complex was therefore
based only on the study of crosslinking products, as was already mentioned above. Clearly,
a new methodology was required to solve the minor antenna assignment ambiguity. This
methodology was the reversed genetics approach of gene antisense technique (see Chapter 4
for details) that enabled to eliminate synthesis of Lhcb5 polypeptide, an apoprotein of CP26.
Jansson successfully pioneered this approach on Arabidopsis in 2001 (Andersson et al ., 2001 ). Figure 7.4 shows the key result of this work. The PSII supercomplex structure was
significantly altered in the antisense plants. The density at the tip of the supercomplex
Figure 7.3 First images of dimeric organization of PSII complex associated with minor and trimeric LHCII. 1–9 are various density areas revealed by the single particle analysis. Area 9 was tentatively assigned to LHCII trimer; areas 5–8: to the minor LHCs; area 4 and 2 to CP43 and CP47 complexes, respectively. Areas 1 and 3 were attributed to D1/D2 reaction centre complex. Reprinted with permission from Boekema et al . ( 1995 ). ©1995 National Academy of Sciences, U.S.A.
Rupan_c07.indd 141 8/29/2012 5:36:47 PM
142 The Photosynthetic Membrane
neighbouring to the trimer location was largely absent in the manipulated plants. This den-
sity as originally labelled as densities five and six was proposed to correspond to the miss-
ing CP26 complex. Therefore the densities seven and eight have been assumed to belong to
CP29: all in agreement with the biochemical and cross-linking evidence. Later, creation of
the plants lacking CP24 and CP29 complexes confirmed the previously made structural
assignments.
The most important advance in the early work of Boekema was that the PSII was discov-
ered to be in a dimeric state. However, the knowledge of the complete photosystem struc-
ture with all of the minor and at least four trimeric light harvesting complexes was lacking.
Dekker together with Boekema ( 2005 ) first applied another dodecylmaltoside, dodecyl- α -
D-maltoside, and a more rapid isolation procedure that resulted in partial solubilization of
membranes and generation of a range of oligomeric PSII complexes. The gel filtration
elution profiles they obtained were very similar to that depicted in Figure 7.2 characteristic
of a very pronounced PSII supercomplex band eluted at around 19 min. This fraction con-
tained some particles that were larger than C2S2 complexes and have been assigned to
C2S2M2 particles that contained two cores, two strongly bound (S) and two medium bound
(M) LHCII trimers (Figure 7.5 ). Moreover, the hypothetical reconstituted image of
C2S2M2L2 particle was proposed (L after ‘loosely’ bound LHCII trimer) for the photosys-
tem containing three LHCII trimers per one monomeric RCII complex. Figure 7.5 shows
the image of the largest PSII supercomplex that contained three LHCII trimers per one
reaction centre. Interestingly, the preparations used for this study revealed the presence of
Figure 7.4 PSII supercomplexes (C2S2) from Arabidopsis plants lacking CP26 minor antenna complex: assignment of CP26 localization within the PSII structure (shown by number ‘26’). Scale bar is 10 nm. S is strongly-bound LHCII trimer. Reprinted with permission from Yakushevska et al . © 2003 The American Chemical Society.
Rupan_c07.indd 142 8/29/2012 5:36:47 PM
Structural Integration of Antennae within Photosystems 143
the missing in C2S2 particle minor antenna complex, CP24 that was assigned in the
C2S2M2L2 structure (Figure 7.5 ). The assignment suggests that the binding of this com-
plex depends on the binding of the M trimer, meaning the complex is already present in
C2S2M2 structure.
Even the proposed C2S2M2L2 structure could not explain the full light harvesting
antenna size of PSII that could reach five or sometimes more trimers per one reaction
centre. Further thorough electron microscopic studies of Boekema and Dekker revealed
the existence of yet another macrostructure in the photosystem II containing membranes.
This structure was highly symmetric and suitable for the single particle analysis tech-
nique. Figure 7.6 shows the structure of oligomeric LHCII complex, containing seven
trimers and was called an icosienamer . This structure is a result of averaging of more than
100 projections. It apparently exists in the membrane independently from the supercom-
plex but should be localized in its vicinity in order to enable efficient harvested energy
transfer towards the reaction centre. If, for example, the functional antenna size of PSII
corresponds to five LHCII trimers per one reaction centre or 10 per one dimeric PSII core,
then each C2S2M2 particle should interact closely with approximately one icosienamer.
The icosienamer particle is relatively unstable and may well be of a transient nature due
to the loosely-bound LHCII trimer’s mobility and interactions in the thylakoid membrane.
In general, the existence of loosely bound trimers of LHCII suggests that PSII oligomer
structure is relatively flexible. Such flexibility has important adaptive functional implica-
tions that will be described in more detail in Chapter 9.
After some years of improving electron microscopy instrumental tools as well as perfecting
the methods of preparative isolation and single particle analysis by utilizing the automated
approaches to collect literally tens of thousands of particles, classify them and average the
images, Boekema’s group succeeded in achieving a PSII supercomplex resolution of about
(a) (b)
Figure 7.5 Towards the complete macrostructure of Photosystem II. Discovery of C2S2M2 PSII particle (a) and proposed structure of C2S2M2L2 complex (b). Reprinted with permission from Boekema et al . © 1999 Wiley-Blackwell.
Rupan_c07.indd 143 8/29/2012 5:36:48 PM
144 The Photosynthetic Membrane
1 nm that enables to identify separate helices within LHCII trimer and minor antenna com-
plexes (Figure 7.7 ). The C2S2M2 structure turned out to be the most typical and complete
state in variety of preparations and was taken as a base structure of PSII with attached
peripheral antenna components. It carries all minor antenna complexes, CP24, CP26 and
CP29 as well as two LHCII trimers per monomeric PSII reaction centre complex. The helix
contour shape and orientation makes it possible to map the atomic structures of LHCII
monomers and trimers onto the single particle images so that their accurate orientations
within the macrostructure can be determined. This approach is extremely useful for the
theoretical and experimental studies of the patterns and pathways of the energy transfer
between different topological antenna components of the supercomplex. The structural
advances in the knowledge on PSII paved the path for the progress in accurate quantitative
description of essential antenna events: photon absorption, energy transfer and trapping.
Clearly the role of protein in the supercomplex assembly is central: it does not only carry the
essential functional cofactors, like pigments, it enables and sustains correct protein interac-
tions in order to provide optimal pigment orientations and distances for efficient energy
transfer and its possible regulation.
The existence of PSII in the form of a dimer and arrangement of a large light harvesting
antenna around the core complex still remain subjects of intense research. This aims to
understand the significance and advantages of the dimeric state as well as the way in which
the complete major antenna (five or sometimes more LHCII trimers transferring energy to
each RCII) interacts with the core complex, as well as the reason for ‘loose’ arrangement
of the PSII structure in general.
Figure 7.6 Discovery of the heptameric oligomer of LHCII, icosienamer. The LHCII trimer atomic structures are mapped upon the related icosienamer densities. The particle resolution is high enough to enable correct alignment of each trimer within the oligomeric particle. Reprinted from Dekker and Boekema.© 2005, with permission from Elsevier.
Rupan_c07.indd 144 8/29/2012 5:36:50 PM
Structural Integration of Antennae within Photosystems 145
7.3 Supramolecular Structure of Photosystem I : LHCI
Indeed, the structural flexibility of the PSII peripheral antenna binding can be an essential
entropic giveaway in order to making the system more adaptable to the environmental fac-
tors at certain conditions (see Chapter 9). This ‘loose’ arrangement made the work on the
high resolution atomic structure of PSII (or even C2S2M2 structure) very difficult. Only
the structure of cyanobacterial PSII core with the oxygen-evolving complex was recently
solved by Shen and coworkers (Umena et al ., 2011 ) with brilliant detail (1.9 Å resolution)
providing the key fundamental insights upon the electron/proton transformation and trans-
fer pathways in this photosystem as well as the catalytic heart of the water-splitting com-
plex. Attempts to preserve the supercomplex structure during the crystallization procedure
have been so far unsuccessful. Unlike PSII, the PSI supercomplex has revealed a much
better stability and could be almost routinely prepared by the sucrose gradient centrifuga-
tion or gel filtration techniques. Solubilization of unstacked thylakoid membranes with
dodecyl- β -D-maltoside normally results in formation of a dense band on the sucrose
gradient corresponding to ~0.7 M of sucrose (see Chapter 4, Figure 4.1). This band con-
tains the complete PSI supercomplex with its own peripheral light harvesting antenna,
LHCI. Figure 7.8 (a) shows the 4.4 Å resolution structure of higher plant PSI obtained by
Figure 7.7 The latest macrostructure of Photosystem II C2S2M2 complex at near 1 nm resolution (a) with overlaid crystal structures of its components, core reaction centre complex and monomeric and trimeric LHCII complexes (b). Panel (c) displays identification of LHCII helices on the single particle image analysis using the crystal structure of LHCII. S and M are strongly and medium bound LHCII trimers; C is the area of monomeric PSII core complex. Reprinted from Kouřil et al . © 2012 with permission from Elsevier.
(a) (b) (c)
Helix AHelix B
Helix C
Rupan_c07.indd 145 8/29/2012 5:36:50 PM
146 The Photosynthetic Membrane
Nelson’s group (Ben-Shem et al ., 2003 ) using the X-ray crystallography. This study
revealed that it exists as a monomeric asymmetric particle of approx. Size of 12 × 15 nm
that contains peripheral LHC antenna complexes. Unfortunately, due to the limited resolu-
tion the details of LHCI complexes are not as well-resolved as those of LHCII and CP29.
Interestingly, LHCI antenna complexes are much tighter associated with PSI core complex
and could only be removed from it using the treatment with multi-ionic detergent
Zwittergent-16. The Figure 7.8 (b) shows separation of LHCI from the core PSI complexes
following the Zwittergent incubation of isolated PSI fraction. The sucrose gradient bands
of PSI corresponding to the intact supercomplex, core PSI devoid from LHCI antenna
complexes, LHCI and free pigment zone can be identified using the denaturing gel electro-
phoresis. The molecular mass of all Lhca polypeptides is slightly lower than that of the
majority of Lhcb proteins and varies from 20 to 25 kDa.
Proteins Lhca1 and 4 form a relatively stable dimer: they are closer positioned towards
each other than Lhca 2 and 3 on the structure. All four LHCI complexes have similar design
to LHCII and bind less chlorophyll b (average Chl a/b ratio is ~3.7), similarly to the minor
LHCII antenna complexes. In addition LHCI binds xanthophylls lutein and violaxanthin, but
not neoxanthin, the most polar carotenoid. Unlike LHCII complexes, LHCI bind β -carotene,
the most hydrophobic carotenoid of higher plant peripheral antenna. As will be shown in the
next chapter, polarity of antenna carotenoids/xanthophylls can affect their structural and
functional dynamic properties essential for regulation of light harvesting efficiency.
Figure 7.8 Structure of the photosystem I supercomplex (a) and separation of LHCI antenna from the core PSI complex (PSIc). Presented in freeware PyMol 0.99 (b). Horizontal top panel shows the sucrose gradient tube with separated PSI components. Fp, free pigment zone. Bottom panel shows the SDS PAAG analysis of each of the sucrose gradient fractions. Numbers on the left indicate the positions of molecular weight markers.
Lhca1
Lhca4
Lhca2Lhca3
(a)
16
30
36
50
64
Fp PSIcPSILHCI(b)
Rupan_c07.indd 146 8/29/2012 5:36:52 PM
Structural Integration of Antennae within Photosystems 147
Another feature of LHCI antenna is that it carries a relatively small number of chloro-
phylls compared to the core complex. Whilst the latter carries nearly 110 chlorophyll mol-
ecules, all LHCI binds only 56, meaning that the PSI light harvesting antenna carries only
30% of a total cross-section of the reaction centre. In case of PSII this number reaches
85%. Clearly, the structures of antenna systems of the two photosystems are principally
different. PSII relies upon the highly mobile and relatively independent peripheral antenna.
PSI reaction centre complex incorporates fused and very large antenna and altogether with
relatively small LHCI is robustly built with much lower levels of entropy and excluding
any potential flexibility of the superstructure. Hence PSI design seems to be more solid and
therefore geared better to stably harvest light than the ‘loose’ structure of PSII. Chapter 9
will present a number of considerations that aim to explain the reasons behind the ‘loose’
design of the light harvesting antenna of PSII in detail.
7.4 Photosynthetic Membrane Protein Landscapes
Staehelin’s work was one of the first that provided visual information on the special segrega-
tion of PSI and PSII complexes using the freeze-fracture electron microscopy (see Staehelin,
2003 and Chapter 4 for details). Alternative approach to visualize redistribution of photosys-
tem complexes in the membrane is the negative stain transmission electron microscopy. The
method requires deposition of incubated in solutions of heavy metal salts membranes upon
the carbon-coated grids and their attachment to the surface so that they can be exposed to the
electron beam perpendicular to the membrane plane. In case of the stacked thylakoids of
grana that are virtually three dimensional this is not a straightforward procedure. Analysis of
FPLC preparations of solubilized grana membranes enriched in PSII often results in appear-
ance of membrane fragments containing often only two appressed membranes. This arrange-
ment is more two-dimensional than the whole grana stack and therefore the membrane
fragments can be relatively easily aligned on the grid for negative transmission electron stain
microscopy. Figure 7.9 (a) shows one of such fragments stained with uranyl acetate showing
relatively ordered arrays of PSII. Due to such order these arrays or crystallinity areas can be
analysed using the approach of single particle analysis applied by Boekema to reveal the
structure of the PSII complex (see previously). Accumulation of a large number of such mem-
brane fragments, their proper alignment and image averaging results in generation of signifi-
cantly resolved PSII structure in the crystalline arrays that resembles the structure of C2S2M2
supercomplex described above. Figure 7.9 (b) depicts an averaged image of a membrane frag-
ment clearly showing the intense PSII core densities with structural features within as well as
the structures of S and M trimers (indicated by arrows). The C2S2M2 particle can be easily
traced (dotted line) and has very similar shape and size to the C2S2M2 image of an isolated
PSII (see Figure 7.7 ). Therefore, the membrane fragments of ordered PSII arrays contain the
commonly found C2S2M2 structures of PSII. The work on membrane fragments was a major
advance towards understanding of PSII organization in the intact photosynthetic membrane.
The question arises to whether these fragments represent a typical organization of the
photosystem. This topic remained a subject of many debates for a number of years. Whilst
Rupan_c07.indd 147 8/29/2012 5:36:52 PM
148 The Photosynthetic Membrane
the crystalline fragments of PSII are very useful for identification of the state of PSII in the
membrane it was argued that they are unlikely to represent a typical arrangement of this
photosystem in vivo . Indeed, thorough systematic investigations of freeze-fracture replicas
of photosynthetic membranes (Figure 7.1 ) reveal that the area of these structures occupies
not more than 10% of the total PSII space in the photosynthetic membrane. This value was
recently found to be dependent upon the composition of PSII light harvesting antenna and
will be discussed in detail in Chapter 9. One of the extreme examples of enhancement of
the proportion of the ordered PSII arrays was found in plants lacking the minor antenna
complex CP24. Figure 7.9 (c) shows the image of a PSII membrane fragment where the
C2S2 supercomplex structures form ordered arrays. The C2S2M2 structure is totally absent
in these plants. It is likely that CP24 indeed is responsible for the binding of the M LHCII
trimer to the PSII supercomplex. This minor antenna component is acting as the molecular
glue that ensures attachment of the second LHCII trimer to the supercomplex. Hence, the
earlier discussed idea that the minor PSII antenna can play a role of the linker for the major
LHCII to the core PSII complex seems to be reasonable. The work has simply shown that
CP24 has a specific function of M trimer binding to the supercomplex.
Remarkably, the inability of PSII particle to bind the second LHCII trimer resulted in the
formation of a large proportion of crystalline arrays of the photosystem (up to 30% of the total
PSII) suggesting that the peripheral LHCII antenna acts as an important breaker of the order in
the PSII-containing membrane domain. Therefore, LHCII seems to be the major factor that
defines the dynamic nature of the grana membrane. Indeed fluorescence recovery after pho-
tobleaching (FPAP) experiments on the membranes devoid of CP24 complex revealed that the
protein mobility there is almost two times slower compared to the wild type PSII membrane.
Hence, the ordered arrangement of PSII supercomplexes prevents membrane dynamics with a
likely effect on some of its functions. Naturally, the order here is counterproductive, since the
Figure 7.9 Fragment of the grana membrane containing ordered arrays of PSII (a). (b) Image of the ordered PSII structures produced using the single particle analysis approach. White arrows indicate the densities of LHCII trimers; the white dashed line highlights the contour of C2S2M2 particle. Reprinted with permission from Yakushevska et al . © 2003 American Chemical Society. (c) Ordered arrays of C2S2 particles of the membrane fragment from plants lacking CP24 minor antenna complex. Reproduced with permission from Kovacs et al . ( 2006 ).© 2011 American Society of Plant Biologists.
(a)
(b) (c)
Rupan_c07.indd 148 8/29/2012 5:36:52 PM
Structural Integration of Antennae within Photosystems 149
‘frozen’ membrane is likely to loose its vital functions. Therefore, breaking of order enables
the dynamics of crowded PSII membrane protein landscapes driven by the ambient tempera-
ture (in other words, thermodynamically-driven). Therefore, the nature using the heterogene-
ous multi-subunit structure of light harvesting antenna of PSII has a certain level of control
over the membrane fluidity and hence vital adaptive functions (see Chapter 9).
The next step in the investigation of the in vivo PSII organization was undertaken by
Boekema (2011) who applied cryoelectron microscopy to study several stacked grana mem-
branes. The advantage of cryoelectron microscopy is that it does not use any artificial envi-
ronment or staining procedures to fix the sample. Grana membranes have been isolated from
thylakoids using a gentle treatment with digitonin, a detergent that was used for isolation of
membrane fragments (see previously) and found reasonably mild and noninvasive. As a
result the whole intact grana membranes could be visualized albeit to a lower resolution of
4 nm only (Figure 7.10 a). Nevertheless, this enabled to identify densities of the dimeric PSII
Figure 7.10 (a) Cryoelectron microscopy image of the fragment of PSII membrane obtained from the tomographic reconstruction of grana particle embedded into ice at a 4 nm resolution (top). Bottom: enlarged area of the box (top) containing modelled C2S2M2 PSII particles. The star indicates one of the modelled C2S2M2 complexes. (b) Complementing the spaces between C2S2M2 complexes with LHCII trimers. Reprinted from Kouřil et al . © 2011 with permission from Elsevier.
(a)
(b)
Rupan_c07.indd 149 8/29/2012 5:36:53 PM
150 The Photosynthetic Membrane
core complexes. They were fairly randomly redistributed in the membrane, confirming the
freeze-fracture microscopy data that found only small present of ordered PSII arrays.
Localization and orientation of the PSII dimeric cores was used as initial information to
model upon them the C2S2M2 supercomplex structures. The latter were simply overlaid and
aligned according to the PSII core orientations, as is shown in Figure 7.10 (a). The bottom
panel displays the enlarged membrane area highlighted on the EM image. Remarkably, PSII
complexes are not only randomly oriented but well-spaced from each other. The spaces
between the complexes are likely to be filled mostly with the rest of the LHCII: L-trimers.
Figure 7.10 (b) shows the result of modelling incorporation of the LHCII trimers into empty
spaces between C2S2M2 complexes. After the insertion of LHCII trimers the calculation of
the LHCII/RCII ratio yields approximately 5, which is consistent with the various biochem-
ical and structural evidence. Such organization of PSII should enable relatively efficient
connectivity between the units of photosystems and ensure the effective cross-section cor-
responding to the at least C2S2M2L6 organization of the PSII complex. However, it is fea-
sible to assume that only C2S2M2 structure is the stable ‘core’ of the complete PSII since it
is stabilized by the S and M trimer binding via the minor antenna complexes and the rest of
the trimers are relatively free to diffuse in the membrane (L-type). Hence, the central factor
in the stabilizing the structural heterogeneity of LHCII trimer binding to the PSII complex
is the minor LHCII antenna complexes CP24, CP26 and CP29.
The described cryoelectron microscopy approach is based upon the use of detergent that
still can cause a certain degree of the damage to the grana system and the membrane itself.
In some cases that concern physiologically-related phenomena in the whole of the thylakoid
membrane system the use of detergents is not welcome. For example, detergents can cause
uncoupling, that is, collapse of the proton gradient across the thylakoid membrane etc.
7.5 Robustness of the Light Harvesting Antenna Design: Resurrecting the Structure to Preserve the Function
A question of why the photosynthetic antenna has to be encoded by such relatively large
number of genes seems to be at least partially answered in the previous paragraph. Indeed,
structural work on PSII has revealed some heterogeneity within LHCII complexes. The
minor antenna is more intrinsic to the supercomplex and important in attaching S and M
LHCII trimers to the structure. The existence of the two major antenna pools, one attached to
the supercomplex and the other is loose ensures certain degree of membrane protein mobil-
ity, that is necessary for some adaptive functions. Another, and more striking phenomenon
related to the multi-subunit nature of light harvesting antenna was revealed using the Lhcb2
gene-silencing technique that greatly surprised researchers and highlighted the vital need for
LHCII antenna for PSII. Jansson used Lhcb2 antisense technique to inhibit the expression of
one of the major LHCII polypeptides that builds LHCII trimers, Lhcb2 (Andersson et al ., 2003). His group succeeded to eliminate almost totally Lhcb2 protein (Figure 7.11 ).
Surprisingly, the levels of another major LHCII polypeptide, Lhcb1, dropped to virtually
zero. Hence, they obtained plants lacking the two major polypeptides of trimeric light
Rupan_c07.indd 150 8/29/2012 5:36:54 PM
Structural Integration of Antennae within Photosystems 151
harvesting complex. In the wild-type plants this complex binds around 75% of the total PSII
chlorophyll, a truly major light harvesting antenna. One would expect plants suffer growing
under low light from the shortages of incoming light energy into the chloroplast membrane
and consequently grow much slower and be less productive (biomass, seeds). Another con-
sequence that was expected as a result of the absence of the major LHCII was lack of the
grana structure, since this complex was implied to be a major factor that is involved in the
grana formation (see Chapters 3 and 5 for details).
Growing the Lhcb2 antisense plants under low light environment (150 μ M m −2 s −1 ) enabled
researchers to reveal a number of surprising features. Whilst the total amount of chlorophyll
was reduced (only by ~30%) and plants looked paler than the wild type (Figure 7.11 ) plants
possessed normal photosynthetic capacity measured by CO 2 uptake and normal growth rate
under controlled light environment. In addition and more surprisingly, the antisense plants
showed grana in their chloroplasts (Figure 7.12 ). There was no alteration in the number of
grana or the number of thylakoids in grana stacks. Lhcb2 antisense plants seemed to render the
major LHCII a non-essential PSII component that is not important for the plant performance.
The apparent controversy prompted Ruban and colleagues (2003) to undertake a bio-
chemical and structural investigation of the photosynthetic membrane from Lhcb2 anti-
sense plants. The idea was to find out whether the membrane protein composition was
altered in the antisense plants. Protein analysis of PSII containing membranes revealed an
unusual phenomenon. Whilst Lhcb1 and 2 proteins were almost totally absent in the anti-
sense plants, Lhcb3 and Lhcb5, in particular, were overexpressed by 100 and 500% respec-
tively (Figure 7.13 ). The large increase in the level of CP26 complex could be expected in
Lhcb1
Wild
Wild type
as Lhcb2
Type
Lhcb2
Lhcb3
asLhcb 2
Figure 7.11 Arabidopsis plants lacking the major LHCII polypeptides, Lhcb1 and 2.
Rupan_c07.indd 151 8/29/2012 5:36:54 PM
152 The Photosynthetic Membrane
this case. Therefore preparative biochemistry was a next step towards solving the puzzle of
the Lhcb2 antisense plants.
Isolated thylakoid membranes as well as PSII particles were prepared and subjected to
solubilization with n-dodecyl- α -D-maltoside, a mild detergent preserving macrostructural
organization of PSII (see previously). Both, thylakoids and PSII membranes from antisense
plants revealed the existence of bands corresponding to the elution time of LHCII trimers
(Figure 7.14 ). This fact, was again puzzling since according to the protein analysis the
major trimer-forming polypeptides were absent in these plants. The discovered ‘trimers’
were less stable than trimers of LHCII from the wild type. This was revealed by using
Lhcb
1Lhcb6
Lhcb5
Lhcb4
Lhcb3
Lhcb2
Lhcb1
PsbAWT As
0
100
200
300
Ban
d in
tens
ity (
% o
f wild
type
)
400
500
600
700
Lhcb
2
Lhcb
3
Lhcb
4
Lhcb
5
Lhcb
6
Figure 7.13 Western blot analysis of PSII membranes (BBY particles) of the wild type (wt) and Lhcb2 antisense Arabodipsis plants. Left: photo of the western blot; right: densitographic quantification of protein bands from the western blot. Reprinted by permission from Macmillan Publishers Ltd from Ruban et al . © 2005.
Figure 7.12 Presence of stacked grana thylakoids in Lhcb2 antisense plants.
Rupan_c07.indd 152 8/29/2012 5:36:54 PM
Structural Integration of Antennae within Photosystems 153
slightly higher DM concentration for solubilization, that yielded a much larger ‘monomer’
fraction and strongly depleted ‘trimer’ one (Figure 7.14 ). Therefore, it was concluded that
the trimers of Lhcb2 antisense plants can be broken into monomers even by using very mild
detergent. These trimer fractions were collected and subjected to the polypeptide analysis.
Western blots confirmed the absence of Lhcb1 and 2 polypeptides. Instead, the found trim-
ers were built of Lhcb5 polypeptide with the minor presence of Lhcb3 gene product
(Figure 7.14 ). Therefore, an important conclusion was reached as a result of these studies:
the trimeric structure of LHCII antenna was preserved despite the absence of the Lhcb1 and
2 polypeptides via their replacement by Lhcb5 polypeptide normally forming CP26 minor
monomeric antenna complex. Further analysis of this trimeric fraction revealed its hetero-
geneity. Two types of trimers were prepared using nondenaturing IEF (see Chapter 4): one
type was a homotrimer built exclusively of Lhcb5 polypeptides and the other was a hetero-
trimer built of Lhcb5 and Lhcb3 polypeptides. The latter was found to be more stable than
the former.
Further work on solubilized thylakoid membranes revealed yet another phenomenon: the
presence of loosely associated LHCI complexes with PSI that can be relatively easily
removed from the photosystem by nonionic detergent. Normally, as shown previously, LHCI
can only be removed from PSI core using multi-ionic detergents. Here, it was clearly not the
case. Estimations of the PSI antenna size suggested that the loosely-bound LHCI complexes
0.015 20 25
Retention time, min
30 35
0.5
1.0
Abs
orpt
ion
at 6
76 n
m, r
el.
1.5
2.0
2.5
High DM
as
wt
PSIIs
PSI
PSIIc
PSITrimer
Monomer
LHCII
Lhcb5
Lhcb3
Lhcb2
Lhcb1wt as
Figure 7.14 Gel filtration FPLC chromatograms of solubilized PSII particles with 0.85% (Low DM) and 1.2% (High DM) n-dodecyl α -D-maltoside from wild type (wt) and Lhcb2 ant ise nse (as) Arabidopsis plants. PSIIs and c are PSII supercomplexes and core complexes, respectively. Vertical lines indicate run times of LHCII trimers and monomers, respectively. Bottom runs are of sucrose gradient centrifugation isolated PSI and LHCII complexes. Encircled is a discovered trimeric LHCII band in the antisense plants. Inset: western blots of the ‘trimer’ fractions from the wild-type (wt) and antisense (as) plants.
Rupan_c07.indd 153 8/29/2012 5:36:55 PM
154 The Photosynthetic Membrane
are likely to be ‘extra’ light harvesting units. This could explain their ‘loose’ binding, since
according to the PSI structure (Figure 7.8 ) these extra antenna complexes should interact
with already bound LHCI complexes or the PSI sites that have much lower affinity of LHCI
binding than the original ones. Interestingly, that it was reported that PSI from the green
algae Chlamidomonas contained up to six extra LHCI units in comparison to the higher plant
PSI. It is possible to imagine, that at certain environmental conditions the higher plant PSI
does regulate its LHC antenna size by forming larger and more loosely-bound LHCI com-
plexes. In fact, they can be defined as peripheral LHCI complexes similarly to L-trimers of
PSII, that constitute more then 50% of the whole of LHCII antenna. This consideration draws
an interesting similarity between the light harvesting antenna design of PSI and PSII, a gradi-
ent in LHC antenna binding affinity to photosystem macrostructure. The physiological sense
for such design can be found in ability to effectively regulate the cross-section according to
the environmental conditions (see Chapter 9).
The ultimate evidence that Lhcb2 antisense plants possess trimeric light harvesting com-
plexes came from the structural work based upon electron microscopy combined with the
single particle analysis approaches. Figure 7.15 displays the results of this work. The
C2S2M2 structure was found to be the dominating state of the PSII supercomplex with two
LHCII trimers attached to the dimeric core along with the minor antenna. This structure is
Figure 7.15 The structure of PSII C2S2M2 particle from the Lhcb2 antisense plants (top). Bottom: arrangement of LHCII trimers from the wild-type (wt) and antisense (as Lhcb2) plants in the crystalline arrays of PSII. Reprinted by permission from Macmillan Publishers Ltd Ruban et al . © 2003
Rupan_c07.indd 154 8/29/2012 5:36:56 PM
Structural Integration of Antennae within Photosystems 155
virtually undistinguishable from the structure of C2S2M2 complex from the wild-type.
Hence, the overexpression of Lhcb5 complex made it possible not only to build trimeric
LHCII but also to preserve the structure of the PSII supercomplex. This was apparently a
crucial step towards the preservation of the grana structure and ensured the high photosyn-
thetic performance of the antisense plants described previously. Figure 7.15 also shows the
structure of interacting trimers of C2S2M2 complexes within the crystallinity arrays found
in the mutant plants. The packing of the antisense LHCII trimers seems to be slightly altered
in comparison to the wild-type ones, suggesting the subtle changes in their geometry most
likely due to the presence of Lhcb5 proteins instead of Lhcb1 and 2. Hence, a hint of not
entirely exact organization, that does apparently not alter significantly the PSII performance.
The existence of trimers in the antisense plants suggests a very special requirement for the
LHCII trimeric structure. This could be both functional (in light harvesting) and structural
(in assembly of the PSII macrostructure). The trimerization of LHCII appears to create fea-
tures that are important for the promotion of efficient energy transfer. The cluster consisting
of Chl a 610-612 may be the channel for energy transfer to neighbouring antenna and core
complexes, and the presence of three identical clusters on each trimer could enable efficient
energy transfer within the PSII macrostructure, bearing some similarity to the pigment rings
found in bacterial antenna complexes (see Chapter 6). Figure 7.16 summarizes the structure
of the PSII supercomplex from the Lhcb2 antisense plants. Whilst the core and minor
antenna remain unaffected, the S and M trimers are built of Lhcb3 and, mainly, of Lhcb5
polypeptides. The M and S timers, which are part of the supercomplex, form an intrinsic part
CP26
CP43
CP43
CP47CP47
CP29
CP26
CP29
CP24
D2
D2
D1
D1
Lhcb
3
Lhcb5
Lhcb5
Lhcb
5 Lhcb5
Lhcb
5 Lhcb5
Lhcb3
Lhcb5
LHCIIb
Figure 7.16 Schematic presentation of the organization of PSII supercomplexes from plants lacking the major LHCII polypeptides. D1,2 are reaction centre polypeptides; CP43,47 are the core antenna complexes; CP24,26,29 are the minor LHC antenna complexes; Lhcb3 and 5 are the polypeptides that form the peripheral trimeric antenna complexes.
Rupan_c07.indd 155 8/29/2012 5:36:56 PM
156 The Photosynthetic Membrane
of the macro-organization of PSII in the granal membranes, whereas the remaining trimers
appear to be located in PSII-free membrane regions. In the wild type plants the M trimer
consists of Lhcb1 and Lhcb2, whereas the S trimer is composed of Lhcb1 and Lhcb3. It was
proposed that in as Lhcb2 plants M trimer is a homotrimer of Lhcb5 and S trimer is a het-
erotrimer of Lhcb3 and Lhcb5 polypeptides. The modified plants revealed a specific response
of the light harvesting gene family and photosystem assembly mechanisms to the absence of
the major LHCII polypeptides. The most related minor antenna protein to the Lhcb1-3 poly-
peptides, Lhcb5, possessing a specific trimerization motif (see previously) was overex-
pressed in plants missing Lhcb1 and 2 proteins. The overexpression led to the assembly
system to recognize Lhcb5 as a building block of LHCII major antenna trimeric state. The
complexes were not only assembled but even incorporated in the stoichiometric amounts
into the PSII supercomplex structure, typical of the wild-type plants. The original functions
of the major LHCII; grana stacking and efficient light harvesting have been restored. One
single protein expression levels made the whole difference for the fate of plant development,
photosynthetic performance and survival. Such compensatory phenomenon was called
robustness of light harvesting antenna design. It highlights the sheer importance of the light
harvesting antenna in plants and constitutes one of its central properties.
This chapter aimed to demonstrate the interconnection between the composition of pho-
tosystem antenna complexes and their assembly into the macrostructures and eventually
into the membrane that is ‘packed’ with proteins. The multi-subunit structure of light har-
vesting antenna makes its functions flexible and robust. The antisense work described here
demonstrated the vital fundamental need in the light harvesting antenna for the efficient
photosynthetic performance essential for plant life. Apparently the primary structure of
proteins involved is not only a major determinant of the secondary and tertiary structure but
also the quaternary structure of photosystem complexes and dynamics of the whole photo-
synthetic membrane.
References
Andersson , J. , Walters , R.G. , Horton , P. and Jansson , S. ( 2001 ) Antisense inhibition of the photosyn-thetic antenna proteins CP29 and CP26: implications for the mechanism of protective energy dissipation . Plant Cell , 13 , 1193 – 1204 .
Andersson , J. , Wentworth , M. , Walters , R.G , et al . ( 2003 ) Absence of Lhcb1 and Lhcb2 proteins of the light-harvesting complex of photosystem II- effects on photosynthesis, grana stacking and fitness . The Plant Journal , 35 , 350 – 361 .
Bassi , R. , Høyer-Hansen , G. , Barbato , R. , et al . ( 1987 ) Chlorophyll-proteins of the photosystem II antenna system . J. Biol. Chem. , 27 , 13333 – 13341 .
Ben-Shem , A. , Frolow , F. and Nelson , N. ( 2003 ) Crystal structure of plant photosystem I . Nature , 426 , 630 – 635 .
Boekema , E.J. , Hankamer , B. , Bald , D. , et al . ( 1995 ) Supramolecular structure of the photosystem II complex from green plants and cyanobacteria . Proc. Natl. Acad. Sci. U. S. A. , 92 , 175 – 179 .
Boekema , E.J. , van Roon , H. , van Breemen , J.F.L. and Dekker , J.P. ( 1999 ) Supramolecular organiza-tion of photosystem II and its light-harvesting antenna in partially solubilized photosystem II membranes . Eur. J. Biochem. , 266 , 444 – 452 .
Rupan_c07.indd 156 8/29/2012 5:36:56 PM
Structural Integration of Antennae within Photosystems 157
Dekker , J.P. and Boekema , E.J. ( 2005 ) Supramolecular organization of thylakoid membrane proteins in green plants . Biochim. Biophys. Acta , 1706 , 12 – 39 .
Fradkin , L.I. , Kolyago , V.M. and Shlyk , A.A. ( 1972 ) Gel-electrophoretic fractionation of the digi-tonin-treated barley chloroplasts . Dok. l Akad. Nauk. SSSR , 207 , 453 – 456 .
Jansson , S. ( 1999 ) A guide to the Lhc genes and their relatives in Arabidopsis . Trends in Plant Sci. , 4 , 236 – 240 .
Jansson , S. ( 1994 ) The light-harvesting chlorophyll a/b binding-proteins . Biochim. Biophys. Acta , 1184 , 1 – 19 .
Johnson , M.P . Goral , T.K ., Duffy , C.D.P ., et al . ( 2011 ) Photoprotective energy dissipation involves the reorganization of photosystem II light harvesting complexes in the grana membranes of higher plant chloroplasts . Plant Cell , 23 , 1468 – 1479 , www.plantcell.org American Society of Plant Biologists .
Kouřil , R. , Dekker , J.P. and Boekema , E.J ( 2012 ) Supramolecular Structure of photosystem II in green plants . Biochim. Biophys. Acta , 1817 , 2 – 12 .
Kouřil , R. , Oostergetel , G.T. and Boekema , E.J. ( 2011 ) Fine structure of granal thylakoid membrane organization using cryoelectron tomography . Biochim. Biophys. Acta , 1807 , 368 – 373 .
Ruban , A.V , Wentworth , M. , Yakushevska , A.E. , et al . ( 2003 ) Plants lacking the main light harvesting complex retain photosystem II macro-organisation . Nature , 421 , 648 – 652 .
Staehelin , L.A. ( 2003 ) Chloroplast structure: from chlorophyll granules to supra-molecular architec-ture of thylakoid membranes . Photosynthesis Research , 76 , 185 – 196
Umena , Y. , Kawajkami , K. , Shen , J.-R. and Kamiya , N . ( 2011 ) Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9Å . Nature , 473 , 55 – 60 .
Yakushevska , A.E. , Keegstra , W. , Boekema , E.J. , et al . ( 2003 ) The structure of photosystem II in Arabidopsis : localization of the CP26 and CP29 antenna complexes . Biochemistry , 42 , 608 – 613 .
Bibliography
Andersson , J. , Wentworth , M. , Walters , R.G. et al . ( 2003 ) Absence of Lhcb1 and Lhcb2 proteins of the light-harvesting complex of photosystem II- effects on photosynthesis, grana stacking and fitness . The Plant Journal , 35 , 350 – 361 .
Ballottari , M. , Girardon , J. , Dall ’ Osto , L. and Bassi , R. ( 2012 ) Evolution and functional properties of Photosystem II light harvesting complexes in eukaryotes . Biochim. Biophys. Acta , 1817 , 143 – 157 .
Bassi , R. , Sandona , D. and Croce , R. ( 1997 ) Novel aspects of chlorophyll a/b -binding proteins . Physiol. Plantarum , 100 , 769 – 779 .
Boekema , E.J. , Hankamer , B. and Barber , J. ( 1997 ) Structure and membrane organisation of photo-system II in green plants . Annu. Rev. Plant Physiol. Plant Mol. Biol. , 48 , 641 – 671 .
Camm , E.L. and Green , B.R. ( 2004 ) How the chlorophyll-proteins got their names . Photosynth. Research , 80 , 189 – 196 .
Fradkin , L.I. , Chkanikova , R.A. and Shlyk , A.A. ( 1981 ) Coupling of chlorophyll metabolism with submembrane chloroplast particles, isolated with digitonin and gel electrophoresis . Plant Physiol. , 67 , 555 – 559 .
Green , B.R. and Durnford , D.G. ( 1996 ) The chlorophyll-carotenoid proteins of oxygenic photosyn-thesis . Annu. Rev. Plant Physiol. Plant Mol. Biol. , 47 , 685 – 714 .
Kovacs , L. , Damkjær , J. , Kereïche , S. , et al . ( 2006 ) Lack of the light-harvesting complex CP24 affects the structure and function of the grana membranes of higher plant chloroplasts . Plant Cell , 18 , 3106 – 3120 .
Pichersky , E. and Green , B.R. ( 1990 ) The extended family of chlorophyll a/b -binding proteins of PSI and PSII , in: Proceedings of the VIIIth International Conference on Photosynthesis Stockholm,
Rupan_c07.indd 157 8/29/2012 5:36:57 PM
158 The Photosynthetic Membrane
Sweden, August 6–11, 1989. Current Research in Photosynthesis , M. Baltschffsky (ed.), Vol. 1, pp. 53–556. Kluwer.
Rigoni , F. , Barbato , R. , Friso , G. and Giacometti , G.M. ( 1992 ) Evidence for direct interaction between the chlorophyll-proteins CP29 and CP47 in Photosystem II . Biochem. Biophys. Res. Commun. , 184 , 1094 – 1100 .
van Roon , H ., van Breemen , J.F.L ., deWeerd, F.L. et al . ( 2000 ) Solubilization of green plant thyla-koid membranes with n-dodecyl- α ,D-maltoside. Implications for the structural organization of the Photosystem II, Photosystem I, ATP synthase and cytochrome b(6)f complexes . Photosynth. Res ., 64 , 155 – 166 .
Ruban , A.V. , Solovieva , S. , Lee , P.J. , et al . ( 2006 ) Plasticity in the composition of the light harvesting antenna of higher plants preserves structural integrity and biological function . J. Biol. Chem. , 281 , 14981 – 14990 .
Rupan_c07.indd 158 8/29/2012 5:36:57 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
‘If you want to make a song more hummy, add a few tiddely poms ...’ Winnie-the-Pooh (by Alan Alexander Milne)
In a broader sense, spectroscopy is an analysis based on the interaction between electro-
magnetic radiation and matter as a function of wavelength or frequency. Several spectro-
scopic techniques used for studies of membrane proteins and the photosynthetic light
harvesting antennae in particular, are already described in Chapter 4. Functions of majority
of proteins in nature are not based upon interaction with light; nevertheless, many of them
can also be studied by spectroscopy, though mainly in UV and IR regions. The photosyn-
thetic antenna is the most adequate object for the spectroscopic studies by nature since its
function is actually based upon interaction with light radiation. The pigments of light har-
vesting antenna conceal great deal of important information about their energies, excited
state properties, conformation, orientation, interactions with proteins and each other as
well as the other features that are vital for the antenna function. In addition, some spectro-
scopic methods could give information of a structural character about pigments and the
protein itself. This information can be invaluable in making correct assignments of the
structural elements of protein as well as for understanding how protein works. Hence, it is
not surprising that the literature on spectroscopic research of the photosynthetic membrane
is vast counting literally thousands of papers. Light spectroscopy is a great and, in many
cases, noninvasive tool that can be applied for the studies of isolated complexes, mem-
branes, chloroplasts and even intact leaves. The other major advantage of many spectro-
scopic techniques is selectivity . Indeed, some spectroscopic methods can be applied to very
complex samples, containing thousands of different types of molecules, many of them
Dynamics of Light Harvesting Antenna: Spectroscopic Insights
8
Rupan_c08.indd 159 8/29/2012 5:35:59 PM
160 The Photosynthetic Membrane
optically active in the visible region. Yet, these approaches can specifically identify and
monitor properties of particular types of molecules even if they are very minor components
of the system under investigation. Therefore, not only are spectroscopic methods good for
identification and evaluation of amounts of specific substances in complex samples, they
are also useful in the studies of molecular dynamics that is often connected to the molecu-
lar mechanisms of a variety of biological processes.
Spectroscopic approaches used in studies of the photosynthetic membrane can arbitrar-
ily be divided into the two major classes: passive and active . Passive methods do not alter
the state of the sample during the spectral measurements; whilst active use a number of
factors that alter the sample. Both groups of approaches aim at a certain level of selectivity
or specificity, since the photosynthetic membrane or even the isolated antenna complexes
are very heterogeneous systems, containing variety of pigments. The active group of spec-
tral approaches aims in the majority of cases to enhance selectivity and insightfulness,
gaining more specific and, at the same time, more profound information about the state of
chromophores under investigation. One of the examples of active type of spectroscopy is
light-induced approaches. They can be steady-state, when sample is being measured during
relatively long time (minutes or longer) after or during illumination or time-resolved, when
the fast sample response to light in non-equilibrium state is being recorded. The latter
approach is called transient spectroscopy. The time resolution of this method can vary in
the time scale from seconds to femtoseconds. Other examples of active type spectroscopy
are temperature-, pressure-, solvent-, field (electric or magnetic) induced spectroscopies. In
fact, these are all differential methods that utilize the principle of alteration of a relatively
small population of spectral states or components in the sample, hence gaining selectivity.
8.1 Steady-State Optical Spectroscopy of LHCII : Composition and Order
Among passive spectroscopic methods are absorption, fluorescence, linear and circular
dichroism and many other spectroscopies that simply measure spectra without using any
sample-altering factors during or before the measurements: the sample state remains largely
constant. Figure 8.1 represents the three different types of spectroscopies applied to study
LHCII antenna complex. Absorption spectrum of isolated LHCII contains many bands
reflecting various electronic transitions from the ground to the excited state. This type of
spectroscopy, therefore, gives first of all information on the sample composition. The variety
of transitions originates from the presence of eight chlorophyll a , six chlorophyll b and four
xanthophyll molecules. Absorption of each is represented by several electronic transitions.
Chlorophylls absorb in the blue (Soret) and red regions. Carotenoids absorb in the blue and
possess at least three clearly defined bands (see Chapter 5 for more details). In order to esti-
mate number and maxima positions of absorption spectral components a second derivative
calculation can be applied (see Chapter 4). This simple procedure produces significantly
better-resolved absorption spectrum. It can be seen from the Figure 8.1 (a) that there are at
least five bands in the red region of chlorophyll absorption at this temperature (77 K). The
Rupan_c08.indd 160 8/29/2012 5:36:00 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 161
450
–0.1
–0.05
0
Circ
ular
dis
chro
ism
, rel
. 0.05
–0.1
0
0.1
Line
ar d
ichr
oism
, rel
. 0.2
0
0.1
0.2
0.3
Abs
orpt
ion
0.4
0.5
500 550Wavelength, nm
600 650 700
472
490
438
510
500450
448472
485510 642
676 700650600550500
x(–125)
457415 510 638
Composition
495
485
472440
Chl a Chl b Xanthophylls Chl b Chl a
433
450
650
Order
550 600 650 700
457
640650 678
Order
650
670
676
661
+ =
+ =
(a)
(b)
(c)
Figure 8.1 Absorption (a), Linear dichroism (b) and circular dichroism (c) spectra of isolated trimeric LHCII complex. Absorption and Linear dicroism spectra were recorded at 77K. Circular dichroism spectrum was recorded at room temperature.
Rupan_c08.indd 161 8/29/2012 5:36:00 PM
162 The Photosynthetic Membrane
lower the temperature, the better is the spectral resolution since the bandwidth become pro-
gressively narrower with the temperature fall. Clearly number of chlorophyll bands here
does not much either the number of chlorophylls (14) or number of chlorophyll types (two,
a and b ). It is somewhat in between, meaning that there is clear variety of chlorophyll a or b
forms originating from the environmental effects within the LHCII complex, hence the
number of bands is higher than two. However, some chlorophylls can have similar absorp-
tion maxima, hence the number of transitions observed is less than 14. It also may well be
possible that not all spectral components have been resolved by the second derivative
approach due to a large spectra overlap and relatively broad bandwidth. The Soret band
region reveals even more complex structure compared to the red band. Around 10 bands and
shoulders could be resolved by the derivative method. Group of bands at 440 nm and a band
at 470 nm belong to chlorophyll a and b , respectively. Absorption of xanthophylls clearly
overlaps with chlorophyll b band and stretches up to 510 nm. Assignment of xanthophyll
transitions has always been a big challenge. Selective spectroscopic approaches are required
for this purpose that will be described in Section 8.4 of this chapter.
The linear dichroism spectrum (LD) of LHCII is shown in Figure 8.1 (b). As was described
in Chapter 4 the method uses oriented sample (in the stretched gel) and differential absorp-
tion of light polarized in two planes, perpendicular and parallel to the plane of the sample
orientation. This method provides clues on the order of pigments in LHCII since it reflects
the orientation of their transition dipole moments. The spectral components are better
resolved in this spectrum compared to absorption one. This is largely due to the differential
character of the measurement as well as the existence of pigments (groups of pigments) with
preferential orientations, a sign of order. In LHCII the red-most chlorophyll a ( a 610–612)
(the terminal emitter) transition dipole moment is oriented approximately in parallel to the
particle (membrane) plane (Figure 8.2 ). Therefore, the amplitude of the red-most band in
LD spectrum is dominating (676 nm positive band). Apart from the orientation of individual
a610
a612a611
Figure 8.2 Structure of the LHCII monomer displaying the three chlorophyll a molecules of the terminal emitter, a610, 611 and 612. Short black arrows show the orientations of the chlorophylls’ transition dipole moments. Long grey arrow indicates the orientation of the membrane plane.
Rupan_c08.indd 162 8/29/2012 5:36:01 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 163
pigments the LD spectrum can be affected by transitions originated from pigment-pigment
interactions of excitonic character. The two splitting components can have opposite orienta-
tions of their transition dipoles. This feature can often undermine the amplitude of LD spec-
trum and cause the appearance of spectral components that is difficult to relate to the
structure of the absorption spectrum. The Soret region of the LD spectrum of LHCII dis-
plays a well-resolved structure with four clearly visible bands at 448, 472, 485 and 510 nm.
The three last transitions have their analogues in the absorption spectrum. This suggests that
the transition dipole moments of the pigments responsible for them have similar orientation.
The third spectrum shown in the Figure 8.1 (c) is the circular dichroism spectrum (CD).
This spectroscopy does not require sample orientation and provides useful information
even if measured at room temperature. Differential absorption of the circularly polarized
light is a useful probe of the pigment structural configuration and pigment-pigment interac-
tions. Bands registered in CD spectra can be of different molecular nature. For the simple
isolated molecule CD band arises from intrinsic asymmetry of a molecule. In this case one
electronic transition will show a CD band of the same shape as the absorption. The sign
(‘+’ or ‘−’) will depend upon the handedness of the molecule. When pigments interact to
form dimers or aggregates, CD will be originated from the excitonic coupling between
them. Excitonic interactions give rise to the positive and negative bands of the spectrum.
The CD spectroscopy is another complimentary method to absorption methods reflecting
the order in the LHCII complex. Correct binding of pigments in their pockets, interactions
with the other pigments of the complex (see Chapter 6 for examples) can be detected and
monitored by the CD spectroscopy. This method is very useful in the LHCII reconstitution
work (see Chapter 4) as one of the major tests for the correct assembly of the complex. In
case if the latter is not correctly assembled the CD spectrum will significantly change with
sometimes complete disappearance of structure and amplitude of bands. The CD spectros-
copy is also a prompt and sensitive tool to analyse the oligomerization state of LHCII.
When the complex monomers assemble into the trimeric state a distinctive negative shoul-
der at about 640 nm will emerge along the 650 nm band of chlorophyll b (Figure 8.1 c). In
addition the negative band in the Soret region at 490 nm will broaden revealing the shoul-
der at 510 nm. The relative strength of 678 nm negative band reflects the state of the termi-
nal emitter chlorophylls a 610–612. Their interactions and configuration is important to
ensure their function, efficient reception of excitation energy from all chlorophylls as well
as relatively long excited state lifetime.
Steady state fluorescence spectroscopy of the photosynthetic membrane components is
another widely used tool. As was shown in Chapter 5 it can be used on variety of systems
from isolated complexes to intact chloroplast membranes. This method reflects energy
transfer between antenna pigments, hence can be used for testing the intactness of recon-
stituted antenna complexes in vitro along with the CD spectroscopy. Figure 8.3 displays
77 K fluorescence spectra of intact and denatured LHCII complex. The spectrum of intact
complex is represented by one narrow chlorophyll a band peaking at 680 nm and a struc-
tured vibronic satellite (see Chapter 5). The spectrum of the denatured complex is very
different. It is much broader and contains a strong shoulder of chlorophyll b fluorescing at
~655 nm. The presence of this shoulder indicates poor energy transfer from chlorophyll b
Rupan_c08.indd 163 8/29/2012 5:36:01 PM
164 The Photosynthetic Membrane
to chlorophyll a , hence lack of required order in the ‘programmed solvent’ of LHCII. The
main band broadening is caused by the exposure of chlorophyll a to a variety of microen-
vironments, an inevitable result of the entropy increase and loss of order. The order of the
native LHCII is manifesting from the uniform reproducible arrangement of pigments in
very similar environment of each of the trimer/monomer. When the complexes deteriorate
with the temperature increase (as in Figure 8.3 ), they have more freedom to adopt a multi-
tude of conformations that determine the environment of pigments. These variations in
microenvironment cause variations in the absorption maxima positions that ultimately
cause the integral fluorescence spectrum broadening. Apart from the entropic effect the
broadening is also due to the fact of the energy transfer loss between pigments as in the
case of chlorophyll b (655 nm band) and some short wavelength chlorophyll a fluorescing
around 665–670 nm and contributing to the integral spectrum broadening.
The denaturing experiment indicates that the LHCII protein secondary and tertiary
structures are essential for the correct assembly of pigments into a coherently functioning
system fulfilling the light harvesting antenna function, efficient light energy collection and
transfer towards the terminal emitter chlorophyll. In the denatured LHCII the energy trans-
fer is clearly impaired, hence the light harvesting function is undermined.
The described steady-state spectroscopic methods provide fundamental information that
can be used for developing models of energy transfer between pigments of antenna. These
models use structural data and quantum mechanical simulations of spectra with parameters
taken from the band positions, amplitudes and band widths to assess interaction energies
640 660 680
Intact
Chl b
Denatured
LHCII
0.0
0.5
1.0
Flu
ores
cenc
e, r
el.
1.5
700Wavelength, nm
720 740 760
Figure 8.3 77 K fluorescence spectra of isolated intact (solid line) and denatured (dashed line) LHCII. Vertical short arrow indicates the chlorophyll b fluorescence shoulder. Fluorescence was excited at 435 nm.
Rupan_c08.indd 164 8/29/2012 5:36:01 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 165
between pigments and directionality of the energy transfer within the whole light harvest-
ing complex. This is an ambitious task and the modelling work of this kind remains largely
in progress reflecting the sheer complexity of electronic energy landscapes in light harvest-
ing pigment-protein complexes.
8.2 Time-Resolved Spectroscopy of LHCII : Energy Migration
8.2.1 Time-Resolved Fluorescence Spectroscopy
Spectroscopy with time resolution or time-resolved spectroscopy is an attractive incisive
pool of methods that asses the dynamic behaviour of excitation energy in the photosyn-
thetic pigments, identifying its migration pathways and, in general, the efficiency of
light harvesting antenna. As was described in Chapter 5, one of the major antenna
parameters is the excitation energy lifetime, the time excitation lives in antenna. It is
determined by the excited state lifetime of individual pigments, energy transfer between
them (connectivity) and the presence of dissipative energy traps that can receive energy
from pigments and relatively quickly dissipate it into heat. Chlorophyll fluorescence is
a useful signal that reflects the excited state lifetime (Chapter 4, Eq. 4.8) and can be
relatively easily measured and quantified. Figure 8.4 (a) shows typical fluorescence
decay profile of isolated LHCII trimers. It is basically a redistribution of photons emit-
ted by the sample from the moment of laser light absorption. The laser pulse has to be
much shorter than the fluorescence decay to enable the reasonably high time resolution.
Logarithmic conversion of the fluorescence photon counts gives ideally a linear func-
tion of time (Chapter 4, Eq. 4.9) in case of monoexponential decay, as is shown in the
Figure 8.4 (b). Indeed, the fluorescence decay here is practically monoexponential. The
tangent of the decay trace corresponds to the sum of all radiative and nonradiative decay
rate constants, ( k f + k
nr ). The measured fluorescence lifetime will be reciprocal to this
sum ( τ f = 1/ (k
f + k
nr )). Hence, the experimentally determined fluorescence lifetime con-
tains important information about the nonradioactive fate of the excitation energy in
antenna. In the case of the isolated LHCII trimer the decay is simple and reflects the
lifetime of excitation of the terminal emitting chlorophylls a 610–612. Since the tempo-
ral resolution in the Figure 8.4 fluorescence traces is only ~50 ps, processes of energy
transfer within LHCII pigments that take about 1–2 ps to reach the terminal emitter
cannot be detected. All that is registered is the final stage of energy stabilization on the
terminal emitter that presents the collected excitation energy concentrated on the few
red-most chlorophylls. The fluorescence lifetime is found to be ~4 ns, more than three
orders of magnitude longer than it takes to reach the terminal emitter from the moment
of absorption. Hence, we see the fact of slowing down and storing the energy of light in
light harvesting antenna and making it available for the transfer to the reaction centre.
If the population of isolated LHCII trimers becomes heterogeneous for some reason
(sample denaturation, etc.), then the fluorescence decay becomes more complex and requires
careful analysis in order to determine the number of components and their lifetimes. When
Rupan_c08.indd 165 8/29/2012 5:36:01 PM
2000
Laser pulse
Laser pulse
Fluorescence decay
Fluorescence decay
Linear
Logarithmic
4000
6000
8000
10000
1
10
6 8 10 12 14
Time, ns
16
–4
16000
14000
12000
10000
8000
Flu
ores
cenc
e am
plitu
de, r
el.
6000
4000
2000
0660 680 700
Wavelength, nm
720 740 760
–2024
100
1000
10000
Flu
ores
cenc
e, p
hoto
nsF
luor
esce
nce,
pho
tons
PSII~2.0 ns
~100 psPSI
(a)
(b)
(c)
Figure 8.4 Chlorophyll a fluorescence decay of isolated trimeric LHCII represented in linear (a) and logarithmic (b) scales. Bottom panel in (b) is the difference between experimental and theoretically fitted decay traces. The laser pulse wavelength was 472 nm with decay time of ~70 ps. Fluorescence was detected at 680 nm. (c) Decay-associated spectra of PSI and PSII in isolated chloroplasts. All measurements are taken at room temperature.
Rupan_c08.indd 166 8/29/2012 5:36:01 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 167
the heterogeneity of the sample is caused by the presence of spectrally distinct emitters, that
is, the presence of the blue-shifted chlorophyll of denatured complexes or the presence of a
mixture of antenna complexes with different spectral properties (LHCII, CP43, CP47, PSI,
etc.), that indeed takes place in the intact photosynthetic membrane, it is often useful to
apply the method of the global analysis. Global analysis allows calculation of the decay-
associated spectra (DAS) to see the fluorescence spectral profiles of different lifetime com-
ponents. Figure 8.4 (c) shows a result of a global analysis done on the isolated chloroplast
membranes at room temperature at the conditions of all closed PSII reaction centres (F m , see
Chapter 4). Here the two major distinct spectral and temporal components have been iso-
lated. One component with ~2 nm fluorescence lifetime belongs to the whole of PSII
antenna and the other component of ~100 ps lifetime originates from PSI. Indeed, isolated
PSI has a steady-state fluorescence spectrum that is very similar to the DAS of PSI. The
DAS of PSII, on the other hand, resembles closely the fluorescence spectrum of isolated
PSII membranes. Therefore, the global analysis of the fluorescence decay allows derivation
of spectral features of photosystems without their isolation. Hence, it is nondestructive and
a very informative approach. Lowering the temperature of experiment to 77 K (liquid nitro-
gen) strongly changes fluorescence spectra of photosystems (see Chapter 5, Figure 5.19).
Photosystem I spectrum increases in intensity and strongly red-shifts towards 733 nm.
Photosystem II gains an extra distinct band at 695 nm. DAS spectra taken at the low tem-
perature become more complex carrying information about a number of newly emerged
bands and energy transfer relations between the complexes of photosystems.
The results of time-resolved fluorescence experiments can be useful for the modelling
of the energy migration between various complexes like the PSII supercomplex. Figure 8.5
shows the real topography of the complex, taken from the single particle work described
in Chapter 7, with indications of the possible energy migration pathways between its
components. The modelling of this migration process does not take into account details of
the energy transfer between individual pigments within each complex but simply treats
the process as the excitation hopping between the PSII antenna and reaction centre com-
ponents. Therefore, it is called a coarse-grained model that treats energy migration as a
random walk process within the photosystem superstructure. Naturally, the application of
this approach became possible only relatively recently, after the single particle electron
microscopy has advanced our knowledge about the topology of the photosynthetic com-
plexes in vivo . The model takes into account the number of pigments associated with
different components. It allows determining the excitation hopping time between the
complexes and the trapping time by the reaction centre, both contributing to the average
fluorescence lifetime. Hence, it became possible to estimate the character of light harvest-
ing processes in photosystems defining the type of the photosystem design, migration-
limited (slow energy migration in antenna and fast trapping) or trap-limited (fast energy
migration in antenna and slow trapping).
8.2.2 Time-Resolved Absorption Spectroscopy
Time-resolved absorption measurements have been used for a long time in photosynthe-
sis research. Light-induced changes in absorption spectrum of chloroplasts or even leaves
Rupan_c08.indd 167 8/29/2012 5:36:02 PM
168 The Photosynthetic Membrane
could provide information about various stages of charge separation and energy transfer
in the photosynthetic electron transport chain. In addition, absorption changes due to
electric field effect generated by the charge separation in PSII called electrochromic shift
(ECS) have been monitored. The absorption changes connected to the electron/proton
transport activity are relatively slow, occurring on the timescale of micro and millisec-
onds (see Figure 1.1), hence do not require very sophisticated equipment to be registered.
Events that involve the processes of charge separation in reaction centres and energy
transfer in antennae occur on much faster scale of pico- and even femtoseconds (Figure 1.1
7
19
21
5
2018
17
9
16CP29
14
22 CP2415
13CP47
D1/D2
0
CP4323
CP26
22
16
15
D1/D2
12
CP47 1
CP29
CP243 10
42
68
CP4311
CP26
103
4
9
17
7
19
5
21
Figure 8.5 Modelling excitation energy transfer between different complexes of the PSII C2S2M2 supercomplex. Numbering of the complexes is used for identification of excitation pathways (thick bars). Reproduced from Valkunas et al . with permission of the PCCP Owner Societies.© 2009 The Royal Society of Chemistry/PCCP.
Rupan_c08.indd 168 8/29/2012 5:36:02 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 169
of Chapter 1). Processes that occur within the single photosynthetic antenna complex,
photon capture and energy transfer between individual pigments take place on the subpi-
cosecond timescale and therefore cannot be easily measured using the time-resolved
fluorescence technique described previously. Monitoring the changes in the absorption
spectrum following excitation within the timescale of femtoseconds can give direct infor-
mation about the evolution of excited states of the pigments of the antenna complex.
Performed with spectral resolution this approach can produce transient absorption spec-
tra, a range of temporal cross-sections that tracks the fate of excited states. Figure 8.6
shows the spectrum of absorption changes in isolated LHCII trimers following illumina-
tion with 100 fs pulse at the main red chlorophyll band absorption. The pump light was
of intensity high enough to prompt a relatively large population of chlorophyll a into
excited, S 1 , state. This caused disappearance of a large number of ground states, S
0 , hence
inability of the sample to absorb light photons with wavelength/energy of around S 0 -S
1 as
well as S 0 -S
2 energies. This manifested in the loss of absorption even after 300 fs of the
pump light application at ~675 and 440 nm regions as measured by the white probe light
pulse. The large bleach in the S 0 -S
1 transition region gradually disappears (vertical up
arrow) with relaxation of the first excited state into S 0 . The rate of this process reflects the
chlorophyll a excited state (S 1 ) lifetime. The broad structured positive absorption around
Figure 8.6 Light-induced changes in absorption spectrum of LHCII trimer. The difference spectrum (transient absorption) was measured 300 fs after sample illumination with the 100 fs pump pulse at 675 nm. The grey box highlights the region where xanthophyll S 1 -S n transition could take place provided it receives energy from chlorophyll. Courtesy of Rudi Berera, John Kennis and Rienk van Grondelle.
Rupan_c08.indd 169 8/29/2012 5:36:03 PM
170 The Photosynthetic Membrane
550–600 nm region corresponds to the absorption from S 1 excited states to the range of
higher excited states (S n ) and is called the excited state absorption.
Femtosecond transient absorption spectroscopy requires a complex and expensive
equipment and is not protected from various additional events, such as stimulated emis-
sion, scattering artefacts, and so on. Nevertheless, the method remains an incisive insight-
ful tool to assess the primary light energy conversion events, taking place in the
photosynthetic membrane. This method is therefore unique and promising to aid our
understanding of the molecular energetic design of the light harvesting antenna complex,
the role of single pigments and pigment types in ensuring its remarkable efficiency and
adaptability.
8.3 Spectral and Structural Identity of LHCII Xanthophylls
Whilst chlorophylls possess strong absorption and fluorescence, xanthophylls do not prac-
tically fluoresce. This limits their conventional spectroscopic analysis only to absorption.
However, since there are three different types of xanthophylls attached to LHCII at one
time that differ in absorption and possess three almost equally strong absorption bands,
the identification of these molecules was always a problem. The second derivative absorp-
tion spectrum in the Figure 8.1 (a) reveals at least three xanthophyll bands at 510, 495 and
485 nm. There is also a peak at 457 nm. In order to study the role of these molecules in
light harvesting as well as the significance of their various structures the assignment of
their electronic transitions is of paramount importance. This knowledge provides finger-
print information about each type of molecule and the antenna environment it is associated
with. The essential structural insights obtained for neoxanthin and violaxanthin, described
in Chapter 6, would not be possible to obtain without undertaking the task of development
of the identification methodology. Information about excited states energy levels also
helps to design and interpret kinetic experiments, which probe molecular interactions and
the energetic relationship between xanthophylls and chlorophylls within light harvesting
complexes.
Xanthophylls exhibit strong resonance Raman enhancement. Therefore in the mixture of
spectrally different xanthophylls present in LHCII it seemed to be feasible to achieve a selec-
tive enhancement of the Raman scattering by exciting a single absorption band belonging to
preferentially one xanthophyll species. Moreover, if every xanthophyll of LHCII possesses
a specific resonance Raman spectrum it should be possible to identify the origin of the xan-
thophyll bands in the absorption spectrum (Figure 8.1 ). Indeed the resonance Raman spectra
reveal specific features for all xanthophylls (Figure 8.7 ). Four main regions can be seen in
the xanthophyll Raman spectrum (labelled with a Greek letter ν ). The first and highest fre-
quency region corresponds to C = C stretching vibrations. The second and most complex
region is most influenced by C–C stretching modes coupled to C–H in plane bending/wag-
ging or C–CH 3 stretching vibrations. The third group in the xanthophyll Raman spectrum
reflects CH 3 in-plane rocking vibrations. The fourth and smallest, seemingly featureless
region corresponds to weakly-coupled C–H out-of-plane bending modes. The ν 4 feature
Rupan_c08.indd 170 8/29/2012 5:36:03 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 171
would normally be Raman-forbidden for a fully planar configuration of the xanthophyll
molecule. However, as appears later, these modes could become very strong in molecules,
which adopt distorted configuration due to interactions with their environment. Resonance
Raman spectra of all four LHCII xanthophylls reveal differences in the ν 1 frequency, which
normally depends upon the conjugation number. In addition, the neoxanthin transition is
further upshifted reflecting its cis -conformation. The ν 1 region of this xanthophyll possesses
additional bands at 1120, 1132 and 1203 cm −1 characteristic for the 9- cis configuration. The
ν 3 band frequency also differs in these xanthophylls. Finally, ν
4 is small and featureless in all
isolated pigments.
The identification of xanthophylls in LHCII was not a trivial task and required a gradual
approach using samples of progressively increasing complexity. LHCII was first isolated
containing only the internally-bound xanthophylls, neoxanthin and two luteins. The periph-
eral site, V1, was unoccupied. Figure 8.8 (a) displays dependency of the ν 1 Raman band
position upon excitation into various absorption bands in the structure of the absorption
spectrum. Nearly all transitions in the second derivative spectrum were probed. The ν 1
revealed remarkable dependency upon the excitation wavelength bouncing from the ν 1
positions for isolated neoxanthin and lutein that themselves are weakly dependent upon
excitation wavelength. The highest frequency of ν 1 was obtained for excitations near 485
1000
Ram
an In
tens
ity, r
el.
1100 1200
Wavenumber, cm–1
1500 1525 1550
Zea
Vio
Lut
Neo
ν3
ν4
ν2
ν1
cis-peaks
Figure 8.7 Resonance Raman spectra of isolated LHCII xanthophylls, neoxanthin (Neo), Lutein (Lut), violaxanthin (Vio) and zeaxanthin (Zea). Horizontal double arrows indicate the range of variations in n1 and n3 peak positions. Two vertical arrows indicate spectral fingerprints of a cis-conformation. Reproduced from Ruban, A.V. © 2010 Taylor and Francis.
Rupan_c08.indd 171 8/29/2012 5:36:03 PM
920 930 940 950
Wavenumber, cm–1
Monomer
Trimer
Lut 621
450
–0.03
0.00
0.03
0.06
0.09
0.12
0.15
1524
1525
1526
1527
1528
1529
1530
1531
1532
1533
1534
465 480
Resonance wavelength, nm
495 510 525
Ram
an in
tens
ity, r
el.
960 970
Abs
orpt
ion,
rel
.R
aman
ν1,
cm
–1
Neo
Lut
476
466
485
495
510
457
(a)
(b)
Figure 8.8 (a) Dependency of LHCII trimer resonance Raman ν 1 position upon excitation wavelength compared to the structure of the Soret band absorption spectrum. (b) Structure of the LHCII resonance Raman ν 4 region in different oligomeric states. Reprinted from Ruban, A.V. © 2010 Taylor and Francis.
Rupan_c08.indd 172 8/29/2012 5:36:04 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 173
and 457 nm bands. Since neoxanthin has the highest ν 1 frequency of all the LHCII xantho-
phylls the measurements led to the conclusion that these maxima belong to 0–0 (zero elec-
tron) and 0–1 (first vibrational) transitions of neoxanthin. Moreover, the near 28 nm spacing
between them is in good agreement with that observed for xanthophylls and carotenoids in
general and measured in vitro and in vivo . Resonance Raman spectroscopy has also revealed
the 9- cis fingerprint features at 1124, 1132 and 1203 cm −1 of neoxanthin in LHCII (see
Figure 6.3). In addition, the ν 3 band position for excitation near 485 nm band is centred at
1006 cm −1 , that is also characteristic for neoxanthin, whilst this band for lutein is positioned
at 1003 cm −1 .
Excitation of the resonance Raman scattering in LHCII trimers near the two longer
wavelength bands at 495 and 510 nm produces resonance Raman spectra having the ν 1
position close to that expected for lutein, that is, ~1527 cm −1 . For the excitation wave-
lengths around 466 and 476 nm bands the ν 1 frequency is also found to be near to that of
lutein. Therefore, it is concluded that 510, 495, 466 and at least part of 476 nm band cor-
respond to the absorption of lutein molecules. Since the wavelength difference between the
first two long-wavelength transitions is only 15 nm it is highly unlikely that they originate
from the same pigment, since the wavelength gap between 0–0 and 0–1 transitions is
almost twice larger (see previous). Therefore, it was suggested that two luteins of LHCII
have different absorption spectra. For the 495 nm absorbing lutein, the suitable 0–1 transi-
tion should correspond to the 466 nm band. For the 510 nm or long-wavelength lutein the
0–1 should be located somewhere on the slope of 476 nm band, most likely at around 482
nm. Since the 510 nm band is almost 50% broader than the 495 nm band the second
derivative spectrum is expected to be of reduced amplitude and poorer resolution. Early
studies using the transient absorption spectroscopy have indicated that the pigment absorb-
ing at 510 nm is closely associated with the short-wavelength chlorophyll a molecules.
Monomerization of the LHCII trimer led to a complete disappearance of this 510 nm band
and parallel enhancement and broadening of the 495 nm transition implying the shift of the
510 nm band down to the 495 nm region. These observations allowed the assignment of the
510 nm transition to lutein 621 (Lutein 2). The β -ring of this xanthophyll is involved in
‘sandwiching’ chlorophyll a 604 with neoxanthin (see Chapter 6). Lutein 621 is also facing
some pigments situated on neighboring monomers in the inner site of the trimer. Figure 8.9
shows the lutein 2 ε -ring is in the van der Waals contact with Chl a 603 of the neighbouring
monomer. All polar oxygen groups of this chlorophyll are positioned closely near the ring.
This electronic perturbation can be a very strong effect in the easily polarizable xantho-
phyll molecules and may be the major cause of the 15 nm (more than 600 cm −1 ) red shift.
This explanation would be consistent with a blue shift of the 510 nm band upon mono-
merization of the trimer.
The 510 nm absorbing species in LHCII reveals a strong negative CD band, implying
that the molecule is in a deformed configuration resulting from an interaction with its
environment. In addition, Stark absorption measurements showed that this species pos-
sesses a very large dipole moment. This is also an indicator of its very specific surround-
ings exerting a polarization effect. Resonance Raman is yet another approach to explore
the configuration of this molecule. Measurements of the resonance Raman spectra excited
Rupan_c08.indd 173 8/29/2012 5:36:04 PM
174 The Photosynthetic Membrane
near 510 nm revealed four clearly defined and pronounced bands in the ν 4 region
(Figure 8.8 b). These are fingerprints of a twisted carotenoid configuration, which can be
completely abolished by monomerization of trimers (Figure 8.8 b). Therefore, this method,
for example, is very useful for assessment of the state of LHCII in vivo at various physi-
ological conditions.
The analysis of the LHCII trimer structure suggests that the interaction of Lut 621 with
Chl a 603 could force the lutein molecule to adopt a twisted configuration (Figure 8.9 ). In
addition, strong interaction with a number of aromatic residues, in particular tryptophan
and phenylalanine, which possess relatively large surface areas, could further promote this
distortion. Lut 621 appears to be more distorted along the carbon backbone than Lut 620
(Lutein 1). The fact that the distortion can be seen at 2.72Å resolution suggests its relatively
large magnitude.
Presence of violaxanthin brings additional complexity to the absorption spectrum of
both thylakoid membranes and isolated LHCII. Differential spectral analysis was applied
for identification of xanthophyll cycle carotenoids, violaxanthin and zeaxanthin.
Figure 8.10 (a) displays the absorption spectra of thylakoid membranes measured before
and after conversion of nearly 80% of violaxanthin into zeaxanthin. The measurement at
liquid helium temperature ensured the highest possible resolution of the spectral structure.
The de-epoxidized- minus -epoxidized difference spectrum is similar to a three maxima/
minima component spectrum of zeaxanthin- minus -violaxanthin in solvents. The absorption
spectrum of zeaxanthin is red-shifted relative to that of violaxanthin. This is due princip-
ally to the presence of 11 conjugated double bonds in zeaxanthin relative to only nine in
violaxanthin. As is evident from the difference spectrum, the 0–0 maxima positions of
zeaxanthin and violaxnthin are localized around 510 and 488 nm, respectively. Therefore,
the resonance Raman signals from these xanthohyplls can be separated by selective excita-
tion near these bands. In order to obtain nearly absolute purity of the spectra of these
xanthophylls it was necessary to calculate difference Raman spectra of membranes (also
Figure 8.9 Intermonomer interaction between lutein 621 (Lut 2) and chlorophyll a603 of the LHCII trimer. Inset shows the view of chlorophyll a603 facing the end group of lutein with all polar oxygen-carrying groups.
Rupan_c08.indd 174 8/29/2012 5:36:04 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 175
LHCII) containing violaxanthin or zeaxanthin. These spectra are displayed in Figure 8.10 (b).
The differential Raman method produced spectra similar to those of xanthophyll cycle
carotenoids in pure solvents (compare with Figure 8.7 ). The ν 1 band peaks of violaxanthin
Figure 8.10 (a) Low temperature absorption spectra (Soret region) of thylakoid membranes enriched in violaxanthin (+Vio) and zeaxanthin (+Zea). Dotted line is a zeaxanthin-minus-violaxanthin difference spectrum. Arrows indicate 0–0 electronic transitions of violaxanthin (487 nm) and zeaxanthin (510 nm). (b) Refined resonance Raman spectra of violaxanthin (Vio) and zeaxanthin (Zea) in vivo . Inset shows the zoomed ν 4 region. Reprinted from Ruban, A.V. © 2010 Taylor and Francis.
Wavelength,nm
–0.1
Abs
orpt
ion
(a)
(b)
Wavenumber. cm–1
Ram
an in
tens
ity,r
e.
Rupan_c08.indd 175 8/29/2012 5:36:04 PM
176 The Photosynthetic Membrane
and zeaxanthin spectra are 7 cm −1 apart and in correspondence to the maxima of this band
for isolated zeaxanthin and violaxanthin, respectively. The ν 3 band for zeaxanthin is posi-
tioned at 1003 cm −1 , whilst the one for violaxanthin is up-shifted towards 1006 cm −1 . The ν 4
region in the resonance Raman spectra for violaxanthin and zeaxanthin in vivo reveals a
significant enhancement with the appearance of a number of bands (Figure 8.10 b). The
expanded ν 4 regions in these spectra are shown on the inset in the Figure 8.10 (b). The spec-
trum for zeaxanthin is richer in structure than that for violaxanthin. It contains four bands
and two clearly defined shoulders, and is similar to that of lutein 621 (Figure 8.8 ). The
Raman spectrum of ν 4 for violaxanthin shows only two bands, at 950 and 965 nm, with a
few minor shoulders. The pronounced ν 4 structure is indicative of the xanthophyll distor-
tion in the binding pocket V1. Although the binding site for zeaxanthin in the LHCII has
not been revealed, its strong binding affinity and the complexity of the Raman spectra of
membranes/isolated LHCII shows that this xanthophyll is in a close association with the
complex. Solubilization of photosystem II membranes with detergents and the use of some-
what higher detergent concentrations in the LHCII incubation medium cause a decrease in
the ν 4 amplitude and disappearance of its structural features. Under these conditions, zeax-
anthin becomes largely dissociated from the antenna and it is found to migrate in the free
pigment band on the sucrose gradient. Taken together these data indicate that the in vivo
molecular conformation of the xanthophyll cycle carotenoids relies upon the oligomeric
organization of the antenna. It is interesting to note, the ν 4 region for xanthophyll cycle
carotenoids bound to the minor antenna complexes, CP26 and CP29, reveals little structure
despite the fact that they remain bound in these complexes under higher detergent condi-
tions. Therefore, it is feasible to assume that, the ν 4 fingerprint reflects binding of the xan-
thophyll within a specific site: any dislocation from this site can cause structural relaxation
of the molecule without necessarily inducing its detachment from the protein.
8.4 Plasticity of Light Harvesting Antenna Design: Tailoring the Structure to Optimize the Function
Chapter 7 described a remarkable manifestation of robustness of the LHCII antenna design
using an example of Lhcb2 antisense Arabidopsis plants. In this mutant the normally
monomeric CP26 complex formed trimers and replaced the light harvesting function of
the missing major LHCII antenna complex. This section will describe the findings of some
modifications in pigment composition and states of CP26 trimers that provide interesting
insights into those features of LHCII that ensure its optimized light harvesting function.
The pigment analysis revealed that the homotrimers of CP26 complexes have a Chl a/b
ratio lower than that of the monomeric wild type CP26. This corresponded to the presence
of one extra chlorophyll b molecule in the CP26 trimer. Absorption spectra shown in the
Figure 8.11 (a) clearly reveal a strong enhancement in chlorophyll b band at 650 nm in the
CP26 trimers from the antisense plants in comparison to the monomeric wild type CP26
complex. Calculations based on the increase in the area under the absorption spectrum
also suggest one extra chlorophyll b . Interestingly that the Chl a/b ratio of the CP26/Lhcb3
Rupan_c08.indd 176 8/29/2012 5:36:05 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 177
heterotrimer was even lower than that of the CP26 homotrimer and corresponded to the
heterotrimer composition of two CP26 and one LHCII, Lhcb3-based complex. Treatment
with phospholipase was effective in causing monomerization of the CP26 trimer and the
loss of one chlorophyll b molecule. This implied that the extra chlorophyll b binding in the
CP26 is connected to the trimerization process. The cluster of chlorophylls b 601, 606 and
609 involves pigments in adjacent monomers (see Chapter 6). The phospholipid molecule
that has a key role in the stabilization of the trimer is tightly associated with Chl b 601,
which is not H-bonded at either formyl C-7 or carbonyl C-13 as are other chlorophyll b
pigments. It appears that the inclusion of the phospholipid create the binding pocket for
this chlorophyll. It is suggested that trimerization of CP26 recreates some features of this
pocket and causes an extra chlorophyll b to be bound, enabling it to function efficiently in
energy transfer, hence contributing to an extra absorption cross-section.
400 420 440 460 480
Wavelength, nm
500 520 540
0.0
0.5
1.0
1.5
Abs
orpt
ion
2.0620
0.0
0.5
1.0
1.5
2.0
640 660 680 7003-CP26 Monomer
2-CP26 Trimer
1-LHCII
3
2 1
1”
2”3”
510
(a)
(b)
Figure 8.11 Absorption spectra in the red (a) and Soret (b) regions of isolated major (LHCII) and CP26 complex in trimeric and monomeric forms. 1’, 2’ and 3’ are the corresponding second derivative spectra.
Rupan_c08.indd 177 8/29/2012 5:36:05 PM
178 The Photosynthetic Membrane
The Soret band in the absorption spectra of LHCII and CP26 trimers appear to be also
very similar and in particular their second derivatives display the presence of the 510 nm
absorption band of the same magnitude (Figure 8.11 b). This band, as was shown in this
chapter arises from lutein 621 (Lutein 2), is a characteristic for the trimeric LHCII state
and is clearly absent from the CP26 monomer, which displayed only the lutein band at
~495 nm. Presence of the red-shifted lutein broadens the light harvesting antenna cross-
section, since it can absorb light quanta with a broader range of energies (colour).
Figure 8.12 illustrates the contribution of the red-shifted lutein to the total amount of
absorbed light in the leaf. Since the absorption is not very strong at >500 nm the sun
light passes through the leaf well, so even the mesophyll cell layers situated closer to the
Figure 8.12 Spectra of the sun light and energy absorbed by the LHCII complex in trimeric and monomeric states. Bottom panel shows the relative leaf penetration depth of the sun light of different spectral regions/colour. (See Plate 8.12 in colour plate section.)
Rupan_c08.indd 178 8/29/2012 5:36:05 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 179
back of the leaf can receive it. Appearance of 510 nm absorption band makes sunlight
available for them as well as the upper layer cells that absorb very strongly blue and red
light making it less available for the deeper layers of cells. Hence, 510 nm lutein of
LHCII trimers is important not only for the broadening of the absorption cross-section
but also essential for ensuring light harvesting throughout the whole depth of the leaf.
Calculations suggest that the red-shifted lutein 621 gives approximately 5% of extra
absorption cross-section to the light harvesting antenna. Globally, the extra energy input
given by this pigment into the Biosphere equals to the amount of energy produced by
EU and US altogether.
The Lhcb2 antisense plants lacking the polypeptides of the major LHCII complex
showed not only robust, resilient design of the light harvesting antenna, proving its essen-
tial importance for plant survival but also they demonstrated the antenna plasticity. The
latter is manifested from ability of the antenna protein to adopt extra pigments and mod-
ify the spectral features of existing ones in order to broaden the absorption cross-section,
hence enhancing the light capture capacity of the photosynthetic membrane. Therefore,
the existence of the LHC gene family is an extremely great evolutionary achievement.
The biological function is ensured better when several related genes express similar but
yet distinct proteins that at certain conditions can mimic the functions of each other, a
useful back-up arrangement. The existence of such phenomenon in light harvesting
antenna indicates how important it is in the work of the photosynthetic membrane. In
addition, it is not only the light harvesting function that is ensured by the presence of the
complex gene family, the adaptations to light are also reproduced by the differential
expression of related genes. In the case of Lhcb5 expression employed by the cell in order
to mimic the functions of missing Lhcb1 and 2 proteins, the former is not only trimerized
and incorporated into the PSII supercomplex, it formes the red-shifted lutein (Lutein
621), attaches more chlorophyll b and possesses red-shifted chlorophyll a forms to
enhance the overall cross-section (see the next chapter). In addition, those red-shifted
forms make the novel LHCII antenna spectrally less distinct from PSI antenna, therefore
largely cancelling the spectral requirement of the two photosystems and making state
transitions redundant (see the next chapter). This great response of the LHCII expression
and assembly systems works perfectly, since the Lhcb5-based antenna is not capable of
state transitions at all!
8.5 LHCII Oligomerization: Dynamics of the ‘Programmed Solvent’
8.5.1 Alterations in the Spectral Properties of LHCII
Studies on isolated LHCII complexes mentioned so far have been performed in conditions
of complete solubilization with concentrations of mild detergents enabling them to form
micelles (above critical micelle concentration, cmc ). In this state LHCII trimers are well
separated from each other: the state that is arguably different from that of LHCII in the
studied crystals or, indeed, in vivo , in the protein-crowded photosynthetic membrane (see
Rupan_c08.indd 179 8/29/2012 5:36:06 PM
180 The Photosynthetic Membrane
Figure 3.1h). This fact did not concern those who studied isolated LHC complexes using
variety of biophysical techniques for some time. However, eventually the state of LHCII
crossed the attention of Horton’s group (Ruban and Horton, 1992 ), who systematically
studied and documented an interesting phenomenon of the isolated LHCII fluorescence
decrease when trimers formed oligomers (aggregates) upon removal of a detergent. The
latter process was first achieved by dialysis and later by simple dilution or detergent
removal by hydrophobic resins leading to a decrease in the detergent concentration below
cmc levels. Figure 8.13 shows the comparison of fluorescence lifetime (yield) of isolated
diluted chlorophyll solution, trimeric LHCII and LHCII aggregates, obtained by slow
removal of detergent by resin. The chlorophyll fluorescence lifetime/yield of the LHCII
Figure 8.13 Quenching of chlorophyll a fluorescence lifetime in LHCII aggregates. Bottom : negative stain electron microscopy of LHCII aggregates.
Rupan_c08.indd 180 8/29/2012 5:36:06 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 181
trimer was only 20% lower than that of the diluted chlorophyll, indicating that the
‘programmed solvent’ is very effective in preventing the concentration quenching in
chlorophylls of the complex. When detergent concentration falls below the critical micelle
concentration, LHCII form oligomers/aggregates (Figure 8.13 , bottom). The aggregate size
can vary from tens to hundreds of nanometres. Each particle can contain from several units
to many dozens of LHCII trimers. In the absence of magnesium cations, these aggregates
are two-dimensional, flat particles. Magnesium promotes formation of complex and large
three-dimensional aggregates. However, even the aggregates shown in the Figure 8.13
reveal at least seven times (85%) the quenching of the fluorescence yield. Indeed, rigorous
experiments showed only a loose link between the aggregate size and the fluorescence
decline/quenching. The process was found to be reversible, that is, addition of detergent
caused gradual restoration of the fluorescence lifetime/yield eventually to that of completely
solubilized trimers. It was also shown that the aggregation process did not practically affect
the intactness of the trimeric complex or its properties, confirming strongly reversible
character of the aggregation process. The latter was found to be promoted by a variety of
factors that included magnesium cations, low pH and hygroscopic media such as glycerol.
LHCII aggregation was found to have profound effects on the properties of bound
pigments. First of all, the fluorescence spectrum of the aggregated complex taken at the
liquid nitrogen temperature (77K) revealed a striking feature: a broad long-wavelength
fluorescence band at 700 nm (F700, Figure 8.14 ). This band was used as a fingerprint of
aggregation and found to be reasonably well-correlated with the extent of the fluorescence
quenching. The long wavelength fluorescence was largely absent in the room temperature
fluorescence spectrum of aggregates, indicating it possessed a strong temperature
dependence. Thorough investigation of the latter provided an insight into the structure of
F700 band. It revealed heterogeneity, existence of at least five different emission bands
from 685–700 nm each differently depending upon temperature. It was initially suggested
660 680 700 720
Wavelength, nm
740 760 780
Trimer
Flu
ores
cenc
e, r
el.
F680 F700
Aggregate
LHCII
Figure 8.14 Comparison of the low-temperature (77 K) fluorescence spectra of LHCII trimers and aggregates.
Rupan_c08.indd 181 8/29/2012 5:36:07 PM
182 The Photosynthetic Membrane
that these bands reflect the heterogeneous nature of LHCII aggregates and are likely to
belong to various minor fluorescing chlorophyll associates that are formed in the interface
of interacting trimers within the aggregate. One of the reasons for such a suggestion was
the absence of absorption bands that corresponded to the red-shifted fluorescence. Indeed,
the absorption spectrum of aggregates revealed a little change, partially due to the selective
light scattering artefacts that occur on the relatively large particles of aggregates. In
addition, a small red shift of the major red-absorbing chlorophyll a (terminal emitter) and
small alterations in chlorophyll b and xanthophyll absorption was observed upon
aggregation. Figure 8.15 shows the aggregated- minus -trimer difference spectrum of LHCII
displaying alterations in the mentioned pigments with the largest being the long-wavelength
chlorophyll a (appearance of 681 nm band). Polarized light spectroscopy indicated the
possibility of altering the coupling between some chlorophyll b molecules (645–655 nm
region), slight reorientation of the terminal emitter chlorophylls and xanthopylls (more
parallel to the membrane plane) and change in the conformation of a subpopulation of long
wavelength chlorophyll a (positive circular dichroism band at ~680 nm and negative band
at 438 nm). All mentioned changes observed indicated alterations in chlorophyll
environment of the LHCII trimer, specifically in the terminal emitter locus, Chl a 610–612.
Analysing these early measurements Ruban and coworkers (Ruban et al ., 1992 ) proposed
the formation of chlorophyll-chlorophyll associates that possess very low fluorescence
yield and therefore quench fluorescence of the trimer. Indeed, interpigment associates
often found to possess red-shifted spectra and low fluorescence. The scenario was similar
to that of the concentration quenching discussed in Chapter 5. As if the ‘programmed
solvent’ of LHCII sized its function to dissolve, separate pigments and prevent their
interactions that can lead to the excitation/fluorescence quenching. The latter is obviously
an unwanted effect because it does undermine the antenna function. Shortening of the
excited state lifetime due to nonradiative dissipation will certainly compete with the energy
transfer channel that is essential for light harvesting in the photosystem unit. The ideas of
Ruban have been recently taken further by Holzwarth ( 1995 ) who proposed that the
Figure 8.15 Aggregation-induced changes in the 77 K absorption spectrum of LHCII.
Rupan_c08.indd 182 8/29/2012 5:36:07 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 183
chlorophyll-chlorophyll associates in LHCII aggregates have a charge transfer character.
The latter is characterized by the enhanced coupling between excited and ground states and
therefore can explain the reduced excited state lifetime as well as the red shift and strong
temperature dependence of the fluorescence yield (see previous). Recent experiments by
van Grondelle’s group (Wahadoszamen et al ., 2012 ) confirmed this idea as well as finding
a chlorophyll-xanthophyll charge transfer state in the quenched LHCII and the minor LHC
complexes . These chlorophyll-xanthophyll interactions have been also proposed as a cause
of the enhancement in energy dissipation. The idea comes from the fact that promotion of
chlorophyll-xanthophyll interactions can potentially quench chlorophyll fluorescence
simply because the xanthophyll S 1 excited state lives only about 10 ps, a perfect nonradietive
energy quencher. The only one feature that complicates this possibility is that S 1 is a
symmetry-forbidden state. Hence, it does not reveal any absorption because the transition
dipole moment is zero and therefore the classic energy transfer from the interacting
chlorophyll to this state, at least in the dipole approximation, should not be possible.
Nevertheless, van Grondelle and coworkers (Ruban et al ., 2007 ), using the transient
absorption spectroscopy (see Figure 8.6 ) revealed the opening an energy transfer channel
from chlorophyll a of the terminal emitter (a610-612) to lutein 620 (Lut 1) caused by
LHCII aggregation. It was noted that the energy transfer rate from chlorophyll to lutein was
much slower than the excited state lifetime of the xanthophyll.
8.5.2 Structural Changes within LHCII
The design of LHCII shows a remarkable flexibility manifesting in the existence of a
switch-like property that can alter the efficiency of antenna function. It appears as if the
changes in the LHCII structure upon aggregation promote the formation of multiple energy
dissipation pathways that involve chlorophylls as well as xanthophylls. It is not surprising,
therefore, that LHCII aggregates have become a new model for various insightful studies
during the last 20 years. These studies aimed to gain more information about the nature of
such flexible behaviour of the complex and the physics of the enhanced excited state non-
radiative dissipation (quenching). Some specific/microscopic information about the pig-
ment structural states in the aggregated LHCII was obtained using the resonance Raman
spectroscopy. The method revealed a few striking features, that emerged upon aggregation.
One of them was the alteration in the hydrogen bonding patterns of a specific fraction of
chlorophyll a and b . New hydrogen bonds were fund to form in LHCII aggregates, most
explicitly to the formyl group of chlorophyll b (Figure 8.16 a). Another striking feature that
was revealed was a strong twist-like configurational alteration in neoxanthin and lutein 620
(Lut 1) xanthophylls (Figure 8.16 b). Establishment of hydrogen bond(s) and twisting of
xanthophylls structure reflect some small structural changes within the LHCII protein. The
thermodynamic studies found that they correspond to the enthalpy change of ~85 kJ mol −1
(several hydrogen bonds) and more than 30 times higher than that of kT at the room tem-
perature. However, these energy changes are nearly five times smaller than those that occur
during the unfolding of the complex and they do not manifest in the inhibition of energy
transfer between chlorophyll b and a (compare Figures 8.3 and 8.14 ). Therefore, it was
proposed that the quenching of fluorescence in LHCII corresponded to the new state of the
Rupan_c08.indd 183 8/29/2012 5:36:08 PM
184 The Photosynthetic Membrane
16000
200
Ram
an s
catte
ring,
rel
.
400
600
(a)
(b)
1610 1620 1630
Wavenumber, cm–1
LHCII chlorophyII
1640 1650 1660
Trimer
952
Aggregate
Aggregate
Trimer
1640
LHCII xanthophyll
940
0.0
0.2
0.4
0.6
Ram
an in
tens
ity, r
el. 0.8
1.0
1.2
950 960
Wavenumber, cm–1
970 980
Figure 8.16 Resonance Raman pigment ‘fingerprints’ associated with aggregation of LHCII. (a) Chlorophyll carbonyl region. (b) Xanthophyll n 4 region. Arrows indicate appearance of the new spectral features associated with fluorescence quenching.
Rupan_c08.indd 184 8/29/2012 5:36:08 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 185
complex different from the denaturation and having specific alterations in the pigments
associated with the promotion of their interactions with each other. This situation suggests
that the protein in aggregated state is no longer capable of keeping the pigments apart from
each other (solving) and preventing the establishment of the type of interactions that cause
excited state/fluorescence quenching.
Observation of structural alterations within LHCII pigments prompted a discussion about
their origins as well as the role of the protein aggregation per se in the observed changes. At
first it was believed that the aggregation is absolutely essential for the fluorescence quench-
ing and the changes observed occur on the interface between interacting trimers within the
LHCII aggregate. However, a few lines of experimental evidence emerged recently that
pointed out that the protein aggregation is not the primary cause but rather a consequence of
the trimer/monomer transition into the structural quenching state. Firstly, a high fluorescence
quenching was possible to obtain using high hydrostatic pressure (5–6 kBar) at the detergent
concentration well above the cmc and the absence of LHCII aggregation. The quenching was
reversible and followed by the changes in absorption spectra similar to those shown in the
Figure 8.15 . Secondly, the rate of transition of LHCII into the quenching state was found to
be reciprocally related to the protein concentration, which is opposite to what was expected
if the aggregation was the direct cause of the quenching. Thirdly, the quenching was obtained
in LHCII trimers incorporated into the PAA or gelatine gels to prevent aggregation
(Figure 8.17 a). Gels were incubated in the low detergent buffer to induce quenching. Return
to the high detergent buffer reversed the effect. Whilst it was impossible to move the polym-
erized aggregates of LHCII along the gel by the electric field, in-gel quenched LHCII moved
as quickly as solubilized unquenched trimers (Figure 8.17 b). This experiment suggested that
the quenching of LHCII incorporated into PAAG was not associated with the protein aggre-
gation. This quenching was followed by fluorescence, absorption and circular dichroism
spectral changes resembling those which accompanied LHCII aggregation.
Fourthly, the recovery of LHCII fluorescence quenching induced in gels was strongly
sensitive to the addition of cross-linkers, like glutaraldehyde (Figure 8.17 a). This cross-linker
is able to covalently bind to the two sites of a protein that are closely associated to each other
and strongly restrict its intrinsic movement/conformational dynamics. The cross-linker,
therefore, builds an entire ‘web’ within the protein ‘freezing’ greatly its conformation.
Hence, once again, the fluorescence behaviour of LHCII links to the structural state of the
complex. Finally, the most recent evidence comes from the work that uses His-tag attached
to LHCII. When the tagged complex is immobilized at very low concentration on the
Ni-containing column to completely prevent possibility of aggregation and exposed to the
low-detergent buffer it reveals very strong, reversible fluorescence quenching. All the afore-
mentioned experiments indicate that the intrinsic dynamics of LHCII trimer or indeed mono-
mer is responsible for the switching of it between the dissipative and highly efficient light
harvesting states. The thermodynamic nature of the structural switch within the LHCII seems
to be almost entirely entropically-driven. Indeed, whilst the enthalpy of the transition into the
dissipative state was found to be around 85 kJ mol −1 (see previous), the free energy difference
between the efficient and dissipative states estimated from the high pressure experiments was
only about 7 kJ mol −1 . Whilst the two LHCII states are almost isoenergetic at the given
Rupan_c08.indd 185 8/29/2012 5:36:08 PM
186 The Photosynthetic Membrane
conditions, the switching between them encounters an energy barrier the crossing of which
heavily relies upon the entropic factor.
One of the obvious experiments relating the described phenomenon of fluorescence
quenching in LHCII to its structure was to study crystals that were used to obtain the
atomic model. These crystals were studied using the measurements of fluorescence life-
time (see previously) combined with confocal microscopy. The method, called FLIM,
fluorescence lifetime imaging, was first employed by Ruban and van Amerongen (Pascal
et al ., 2005 ) to study LHCII crystals. The measurements produced images of LHCII crys-
tals that reflected the spatial redistribution of chlorophyll fluorescence lifetime that was
found to be highly homogenous, reflecting the order of LHCII complexes in the crystal and
the absence of damage to the structure. Figure 8.18 shows FLIM image of the typical
Figure 8.17 (a) Induction of fluorescence quenching in LHCII incorporated into PAA gel. (b) Gel electrophoresis run of the in-gel-quenched LHCII showing its high mobility and likely trimeric state.
(a)
Aggregated
Quenchedin gel
Solubilisedunquenched
LHCIIBefore run
Trimers
Aggregates
Run direction
After run(b)
Rupan_c08.indd 186 8/29/2012 5:36:08 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 187
0.8 ns 1.1 ns
864Time, ns
Flu
ores
cenc
e, r
el
200
1000
2000
LHCII trimer
LHCII crystal
Figure 8.18 Quenching of chlorophyll a fluorescence lifetime in a single LHCII crystal using FLIM technique. The image is shown in false colours defining the fluorescence lifetime as presented by the colour lifetime scale below the image. Bottom: average fluorescence decay profiles for trimers and crystals of LHCII. Reprinted by permission from Macmillan Ltd Publishers, Pascal et al . © 2005 Nature Publishing Group. (See Plate 8.18 in colour plate section.)
Rupan_c08.indd 187 8/29/2012 5:36:10 PM
188 The Photosynthetic Membrane
hexagonal crystal used for the structural studies. The average fluorescence lifetime traces
are shown below it. It was remarkable to find out that the fluorescence of LHCII in
crystalline state was significantly quenched with the average lifetime of about 0.86 ns in
comparison to 4 ns of the isolated trimers (Figure 8.13 ). This corresponds to about 78% of
quenching, slightly less than the quenching observed in some LHCII aggregates. The reso-
nance Raman features that accompany quenching in LHCII described previously
(Figure 8.16 ) were all present in the crystals, suggesting that the nature of quenching in
them is similar to that of LHCII aggregates.
A novel technique of the fluorescence measurements was recently employed to
further study the properties of the structural switch within LHCII. This is the single
molecule fluorescence spectroscopy. The method uses confocal microscope to detect
and visualize fluorescence from single molecules. Although the special resolution of the
optical microscope is limited to a few hundreds of nanometres it is possible to see the
broad ‘aura’ of the single LHCII trimer fluorescence depicted as a spot of a fraction of
a micron. Figure 8.19 (a) shows a typical image of the surface where LHCII trimers were
immobilized and illuminated to induce chlorophyll a fluorescence which is registered in
spots originating from single complexes. It was found that even in the presence of high
detergent concentration the fluorescence level of a single trimer reveals occasional
spontaneous rapid decrease and returns back to normal (Figure 8.19 b). This ‘blinking’
of the emission is considered by van Grondelle and coworkers (Kruger et al ., 2011) to
be a reflection of the inherent intrinsic disorder within the LHCII protein. On the one
hand, the complex is very densely compacted with pigments; on the other hand, it is
constantly in a rather dynamic mode responding to the entropy input within and from
the environment. The structural organization of the complex (order) limits the number
of possible accessed conformational states, some of which possess low fluorescence.
Overall, throughout billions of complexes in the macroscopic experiment this blinking
behaviour will be averaged into a certain fluorescence level/lifetime. Interestingly, van
Grondelle and coworkers found that the blinking frequency as well as the fluorescence
intensity of unquenched and quenched states was controlled by a number of factors such
as detergent concentration, pH and, most importantly, the presence of xanthophyll cycle
carotenoids, violaxanthin and zeaxanthin. Low detergent concentration and low pH
enhanced the frequency of occurrence of the low fluorescence states suggesting the
presence of the quenching switch control within a single LHCII complex. It is likely that
these factors affect the entropically-driven energy barrier between unquenched and
quenched fluorescence states. The mentioned factors can, for example, inflict certain
minor structural alterations within the protein that will make more probable or
improbable accessing of certain conformations/fluorescence levels. Hence, the nature
invented a largely self-reliant molecular mechanics that is based upon a several
fundamental principles which include microscopic dimensions, highly cooperative and
semi-rigid entropically-driven dynamic structure, properties of which can be modulated
by cofactors and environmental effects. Once again, a biomolecule displayed a
compromise between order and disorder as well as the great extent of autonomy and
responsiveness in its dynamic behaviour. The significance of the latter will become
apparent in Chapter 9.
Rupan_c08.indd 188 8/29/2012 5:36:11 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 189
8.6 Kinetics of the Collective LHCII Transition into the Dissipative State: Exploring ‘The Switch’ Control
The properties of the transition of LHCII into the dissipative, inefficient state were studied
in a great detail in solution. It was observed that acidification was one of the major driving
factors of this transition. However, at detergent concentration above cmc the fluorescence
06 5 4 3 2
1 0 01
23
Coordinate (μm)Coordinate (μm)
45 6
20
40
60
80F
L (C
ount
s/3
ms)
0
0 5 10 15 20 25
Illumination time (s)
30 35 40 45
20
40
Flu
ores
cenc
e in
tens
ity (
c/10
ms)
60
80
(b)
(a)
Figure 8.19 Single molecule fluorescence spectroscopy of LHCII trimers. (a) Imaging and quantifying fluorescence of single particles. (b) Observing sharp fluctuations in fluorescence intensity within the single LHCII trimer. Reprinted with permission from Kruger et al . © 2011 American Chemical Society.
Rupan_c08.indd 189 8/29/2012 5:36:11 PM
190 The Photosynthetic Membrane
quenching was very small (Figure 8.20 ). Incubation of LHCII in the buffer with detergent
concentration below cmc revealed relatively slow spontaneous fluorescence quenching as
well as made the complex more responsive to acidification that prompted fast transition
into the significantly quenched state (compare traces (1) and (2) in Figure 8.20 ). The iso-
lated LHCII used in the experiments did not contain any violaxanthin or zeaxanthin
attached to the peripheral V1 binding site. The isolation method, isoelectric focussing,
stripped nearly all extrinsic xanthophylls, as their binding affinity was found much lower
than that of the intrinsic xanthophylls, lutein and neoxanthin (see Chapter 6). Experiments
3 and 4 shown in the Figure 8.20 exploited the fact of the empty V1 site and weak binding
of xanthophyll cycle carotenoids there in order to see if their rebinding could affect the
quenching behaviour of LHCII. The results for violaxanthin and zeaxanthin effects were
remarkably contrasting. Whilst zeaxanthin addition slightly accelerated the spontaneous
and pH-induced quenching, violaxanthin significantly inhibited the kinetics and ampli-
tude of both processes. It was noted that also zeaxanthin had an effect on the quenching
kinetics it did not enhance its amplitude. The maximum extent of quenching of 4–5 times
within 1 min after acidification with pH = 5.7 was found to be the same here as in the con-
trol. The discovered ability of the peripherally-bound xanthophyll cycle carotenoids to
modulate ‘the switch’ that changes the LHCII efficiency was a remarkable observation
made by Horton’s group that provided first insights into the physiological relevance of the
quenching behaviour of isolated antenna complexes and the role of xanthophyll cycle in
the photosynthetic membrane.
1 min
+DM Control +Vio +Zea
Low detergentH+
1 2 3 4
Figure 8.20 Induction of quenching in isolated LHCII by acidification (pH = 5.5) at detergent ( b -DM) concentration above (1) and below (2-4) cmc. LHCII was isolated with an empty peripheral V1 xanthophyll binding site. For (3) and (4) violaxanthin and zeaxanthin were added before acidification.
Rupan_c08.indd 190 8/29/2012 5:36:14 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 191
The pH requirement for the observed quenching in LHCII was studied by means of titra-
tions: a broad range of pH was used to induce the quenching, which was then plotted as a
function of pH. Figure 8.21 displays pH titrations for LHCII incubated with violaxanthin
or zeaxanthin. This work showed that the xanthophyll cycle carotenoids mostly effect the
pH requirement for ‘the switch’. Presence of zeaxanthin makes LHCII more sensitive to
acidification with pK, the protein-proton association constant, of about 6.5. Presence of
violaxanthin requires more acidic pH to induce the same amount of quenching as with
zeaxanthin. The pK value of quenching with violaxanthin was about 5.0. These titrations
revealed yet another remarkable property of the LHCII complex, the existence of a mecha-
nism that alters its dynamic behaviour relative to pH of the medium. Affinity to protons was
discovered to be a changeable property of the antenna complex.
Further exploration of ‘the switch’ emerged from the studies of the quenching kinetics
induced at different pH. Not only did the low pH enhance the quenching, it accelerated the
transition into the quenched state. Figure 8.22 (a) displays two quenching kinetics induced
at pH 8.0 (control, spontaneous quenching) and a low pH (5.7). The theoretical fitting of
the experimental data established that the quenching process obeys not exponential but
rather hyperbolic decay kinetics. Reciprocal transformation of the kinetic data confirmed
this discovery, since it produced nearly perfect fits to the linear function of time
(Figure 8.22 b). The gradient of the linearized kinetic functions presented in Figure 8.22 (b)
correspond to the rate constants of the switching process. The hyperbolic quenching kinet-
ics in LHCII (as well as the minor PSII antenna complexes) suggested that the structural
‘switch’ into the dissipative state obeys the binary type of reaction: interaction of the two
40.0
0.1
Flu
ores
cenc
e qu
ench
ing
0.2
0.3
0.4
0.5
0.6
0.7
0.8
5 6
pH
7 8
+Vio
+Zea
Figure 8.21 pH titrations of fluorescence quenching in isolated LHCII with added zeaxanthin (+Zea) or violaxanthin (+Vio). The quenching is a dimensionless parameter, defined as (Fmax-Fq)/Fmax, where Fmax is the initial unquenched level of fluorescence, Fq is the fluorescence level after quenching.
Rupan_c08.indd 191 8/29/2012 5:36:14 PM
192 The Photosynthetic Membrane
identical fluorescence domains/pigments are required to display the hyperbolic kinetics of
the transition into the quenched state. The simultaneous disappearance/quenching of the
two fluorescing or contributing to the fluorescence (transferring energy to the terminal
emitter) domains of pigments was required to explain the observed character of kinetic
behaviour. At present, the identity of putative domains remains unknown.
An attempt was made by Ruban and coworkers to explain the effect of violaxanthin and
zeaxanthin upon the fluorescence quenching in isolated LHCII (Ruban and Johnson,
2010 ). Xanthophyll hydrophobicity as well as the rigidity and orientation of the head
groups have been proposed to be key structural features affecting the behaviour of the
structural ‘switch’ within the complex. These properties could be empirically quantified
using the solubility of the isolated xanthophylls in water/ethanol mixtures. An increase in
the ethanol content decreases polarity and increases solubility of hydrophobic molecules.
00.00
0.05
0.101/F
(t)–
Fu)
Flu
ores
cenc
e, r
el.
0.15
0.20
0.25
0
10
20
30
40
50
60
70
80
90
100
30 60Time /s
90
5.7F(t)
F(t)8.0
8.05.7
(a)
(b)
Figure 8.22 Analysis of LHCII fluorescence quenching kinetics at pH 8.0 (spontaneous) and 5.7. (a) Original data. (b) Linearization of quenching kinetics data and fits with hyperbolic decay function with reciprocal transformation, where Fu is the level of unquenched fluorescence obtained from the hyperbolic fit (for more details see the text).
Rupan_c08.indd 192 8/29/2012 5:36:14 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 193
The solubility titrations for all LHCII xanthophylls are presented in Figure 8.23 . When a
xanthophyll becomes insoluble it aggregates and drastically changes its absorption spec-
trum. Hence, the solubility can be relatively easily quantified in this experiment. It was
found that the most hydrophilic of all LHCII xanthophylls are neoxanthin, then violaxan-
thin. Zeaxanthin was found to be the most hydrophobic of all the xanthophylls. Therefore,
de-epoxidation of violaxanthin was proposed to have a drastic effect on the LHCII
V1-associated xanthophyll hydrophobicity, binding affinity and the binding locus itself.
This structural alteration was proposed to have an influence on the structural ‘switch’ that
controls the efficiency of LHCII antenna. Since the LHCII structure with bound zeaxan-
thin is unknown it is not possible to accurately analyse the mechanistic effect of zeaxanthin
upon the LHCII structure and dynamics.
The role of intrinsic xanthophylls in the dynamic behaviour of the LHCII ‘switch’ was
also explored using the complexes isolated from different xanthophyll biosynthesis
Arabidopsis mutants using the fluorescence lifetime spectroscopy, TCSPC (for the method
details see previous). LHCII complexes containing neoxanthin and violaxanthin only
(NVVV and NVVZ compositions: neoxanthin, two violaxanthins replacing two luteins at
L1 and L2 sites and extrinsically-bound violaxanthin or zeaxanthin) were isolated and
studied in addition to those containing the wild type levels of xanthophylls. Figure 8.24
displays the results of this study. At high detergent concentration the studied complexes
revealed differences in the fluorescence lifetime yield depending on the xanthophyll com-
position. Those that contained more hydrophobic xanthophylls possessed shorter fluores-
cence lifetime, that is, were more quenched, indicating that both peripheral and intrinsic
xanthophylls affect the LHCII structure and hence the chlorophyll excited state lifetime.
At low detergent concentration and low pH, LHCII was ‘switched’ into the quenched
state (aggregated). Again, the extent of quenching depends upon the xanthophyll compo-
sition. More hydrophilic/polar xanthophylls partially inhibited ‘the switch’ whilst more
200
1
2
Dis
solv
ed /A
ggre
gate
d, r
el.
3
4
30 40 50
Ethanol, %
60 70 80
Zea
LutVio
Neo
Figure 8.23 Quantifying differential solubility of LHCII xanthophylls in water/ethanol mixtures. Arrows indicate the percentage of ethanol corresponding to the point of equilibrium between aggregated and dissolved xanthophyll.
Rupan_c08.indd 193 8/29/2012 5:36:15 PM
194 The Photosynthetic Membrane
hydrophobic promoted it. Indeed, the fluorescence lifetime was the shortest, when the
complexes contained lutein and zeaxanthin instead of violaxanthin. The X-axis of the plot
shown in Figure 8.24 was constructed using the xanthophyll hydrophobicity parameter
(H-parameter). This was calculated taking the percentages of ethanol at equilibrium point
between aggregated and dissolved (see Figure 8.23 ) for all xanthophylls of each complex
and averaging them. For example, for the LHCII complex that possessed NVVV xantho-
phyll composition, the H-parameter was calculated as (32 + 44 + 44 + 44)/4 = 41. For
LHCII with NLLZ composition the H-parameter will be (32 + 50 + 50 + 64)/4 = 49. The
generic effect of xanthophylls regardless of their binding site on the LHCII ‘switch’ sug-
gests that the structural change involved could relate to all xanthophyll binding domains.
This is not surprising since the complex is very tightly assembled with helixes and pig-
ments and small alterations/fluctuations in its structure are likely to be reflected upon the
entire assembly.
References
Holzwarth , A.R. ( 1995 ) Time-resolved fluorescence spectroscopy . Methods Enzymol. , 246 , 334 – 362 . Kruger , T.P.J. , Ilioaia , C. and van Grondelle , R. ( 2011 ) Fluorescence Intermittency from the Main
Plant Light-Harvesting Complex: Resolving Shifts between Intensity Levels . J Phys. Chem. B , 115 , 5071 – 5082 .
Figure 8.24 Dependency of LHCII fluorescence lifetime upon xanthophyll composition at high (top) and low detergent concentration and pH = 5.7 (bottom). The x -axis represents the xanthophyll hydrophobicity parameter (for details of calculation see the text).
Rupan_c08.indd 194 8/29/2012 5:36:16 PM
Dynamics of Light Harvesting Antenna: Spectroscopic Insights 195
Pascal , A.A. , Liu , Z. , Broess , K. , et al . ( 2005 ) Molecular basis of photoprotection and control of photosynthetic light-harvesting . Nature , 436 , 134 – 137 .
Ruban , A.V. ( 2009 ) Identification of carotenoids in photosynthetic proteins: xanthophylls of the light harvesting antenna , in: Carotenoids: Physical, Chemical and Biological Functions and Properties . J.T . Landrum (ed.), CRC Press, Florida International University , pp. 113 – 136 . Taylor & Francis .
Ruban , A.V. , Berera , R. , Ilioaia , C ., et al . ( 2007 ) Identification of a mechanism of photoprotective energy dissipation in higher plants . Nature , 450 , 575 – 578 .
Ruban , A.V. and Johnson , M.P. ( 2010 ) Xanthophylls as modulators of membrane protein function . Arch. Biochem. Biophys. , 504 , 78 – 85 .
van Amerongen , H. and van Grondelle , R. ( 1995 ) Transient absorption spectroscopy in study of pro-cesses and dynamics in biology . Methods in Enzymology , 246 , 201 – 226 .
Wahadoszamen , M. , Berera , R. , Ara , A.M. , et al . ( 2012 ) Identification of two emnitting sites in the dissipative state of the major light harvesting antenna . Phys. Chem. Chem. Phys. , 14 , 759 – 766 .
Bibliography
Blankenship , R. ( 2002 ) Molecular Mechanisms of Photosynthesis . London : Blackwell Science . Clayton , R.K. ( 1970 ) Light and Living Matter, Volume 1: The Physical Part . New York : McGraw-Hill . Clayton , R.K. ( 1970 ) Light and Living Matter, Volume 2: The Biological . New York : McGraw-Hill . Garab , G. and van Amerongen , H. ( 2009 ) Linear dichroism and circular dichroism in photosynthesis
research . Photosynth. Res. , 101 , 135 – 146 . Hall , D.O. and Rao , K.K. ( 1995 ) Photosynthesis . Cambridge : Cambridge University Press . Hipkins , M.F. and Baker , N.R. (eds) ( 1986 ) Photosynthesis: Energy Transduction: A Practical
Approach. Practical Approach Series . Oxford : IRL Press Limited . Ilioaia , C. , Johnson , M. , Horton , P. and Ruban , A.V. ( 2008 ) Induction of efficient energy dissipation
in the isolated light harvesting complex of photosystem II in the absence of protein aggregation . J. Biol. Chem. , 283 , 29505 – 29512 .
Kruger , T.P.J. , Ilioaia , C. and van Grondelle , R. ( 2011 ) Fluorescence Intermittency from the Main Plant Light-Harvesting Complex: Resolving Shifts between Intensity Levels . J. Phys. Chem. B , 115 , 5071 – 5082 .
Lakowicz , J.R. ( 2006 ) Principles of Fluorescence Spectroscopy . New York : Springer . O’Connor , D.V.O. ( 1984 ) Time-Correlated Single Photon Counting . London : Academic Press . Landrum , J. (ed.) ( 2009 ) Carotenoids: Physical, Chemical and Biological Functions and Properties .
Florida International University : CRC Press . Novoderezhkin , V.I. , Palacios , M.A. , van Amerongen , H. and van Grondelle , R . ( 2005 ) Excitation
dynamics in the LHCII complex of higher plants: modeling based on the 2.72 Å crystal struc-ture . J. Phys. Chem ., 109 , 10493 – 10504 .
Ruban , A.V. , Calkoen , F. , Kwa , S.L.S. , et al . ( 1997 ) Characterization of the aggregated state of the light harvesting complex of photosystem II by linear and circular dichroism spectroscopy . Biochim. Biophys. Acta , 1321 , 61 – 70 .
Ruban , A.V. , Duffy , C.D.P. and Johnson , M.P. ( 2012 ) Natural light harvesting: principles and envi-ronmental trends . Energy and Environmental Science , 4 , 1643 – 1650 .
Ruban , A.V. , van Grondelle , R. , Horton , P. and Dekker , J.P. ( 1995 ) Temperature dependence of chlo-rophyll fluorescence from the light harvesting complex II of higher plants . Photochem. Photobiol. , 61 , 216 – 221 .
Ruban , A.V. , Horton , P. and Young , A.J. ( 1993 ) Aggregation of higher plant xanthophylls: differences in absorption spectra and in the dependency on solvent polarity . J. Photochem. Photobiol. , 21 , 229 – 234 .
Ruban , A.V. and Horton P. ( 1992 ) Mechanism of Δ pH-dependent dissipation of absorbed excitation energy by photosynthetic membranes. I. Spectroscopic analysis of isolated light harvesting complexes . Biochim. Biophys. Acta , 1102 , 30 – 38 .
Rupan_c08.indd 195 8/29/2012 5:36:16 PM
196 The Photosynthetic Membrane
Ruban, A.V. and Horton , P. ( 1999 ) The xanthophyll cycle modulates the kinetics of nonphotochemical energy dissipation in isolated light harvesting complexes, intact chloroplasts and leaves . Plant Physiol. , 119 , 531 – 542 .
Ruban, A.V. , Lee , P.J. , Wentworth , M. , et al . ( 1999 ) Determination of the stoichiometry and strength of binding of different xanthophylls to the photosystem II light harvesting complexes . J. Biol. Chem. , 274 , 10458 – 10465 .
Ruban, A.V. , Pascal , A. and Robert , B. ( 2000 ) Xanthophylls of the major photosynthetic light- harvesting complex of plants: identification, conformation and dynamics . FEBS Lett. , 477 , 181 – 185 .
Ruban , A.V. , Pascal , A.A. , Lee , P.J. , et al . ( 2002 ) Molecular Configuration of Xanthophyll Cycle Carotenoids in Photosystem II Antenna Complexes . J. Biol. Chem. , 277 , 42937 – 42942 .
Ruban, A.V. , Robert , B. and Horton , P. ( 1995 ) Resonance Raman spectroscopy of photosystem II light-harvesting complex of green plants. A comparison of trimeric and aggregated states . Biochemistry , 34 , 2333 – 2337 .
Ruban , A.V. , Solovieva , S. , Lee , P.J. , et al . ( 2006 ) Plasticity in the composition of the light harvesting antenna of higher plants preserves structural integrity and biological function . J. Biol. Chem. , 281 , 14981 – 14990 .
Ruban, A.V. , Young , A. and Horton , P. ( 1994 ) Modulation of chlorophyll fluorescence quenching in isolated light harvesting complex of photosystem II . Biochim. Biophys. Acta , 1196 , 123 – 127 .
Ruban, A.V. , Young , A. , Pascal , A. and Horton , P. ( 1994 ) The effects of illumination on the xantho-phyll composition of the photosystem II light harvesting complexes of spinach thylakoid mem-branes . Plant Physiology , 104 , 227 – 234 .
Ruban, A.V. , Young , A.J. and Horton , P. ( 1996 ) Dynamic properties of the minor chlorophyll a / b binding proteins of photosystem II - an in vitro model for photoprotective energy dissipation in the photosynthetic membrane of green plants . Biochemistry , 35 , 674 – 678 .
Santabarbara , S. , Horton , P. and Ruban , A.V. ( 2009 ) Comparison of the thermodynamic landscapes of unfolding and formation of the energy dissipative state in the isolated light harvesting com-plex II . Biophys. J. , 97 , 1188 – 1197 .
van Oort , B. , van Hoek , A. , Ruban , A.V. and van Amerongen , H. ( 2007 ) The equilibrium between quenched and non-quenched conformations of the major plant light-harvesting complex studied with high-pressure time-resolved fluorescence . J. Phys. Chem. B , 111 , 7631 – 7637 .
Valkunas , L. , Trinkunas , G. , Chmeliov , J. and Ruban , A.V. ( 2009 ) Modeling of exciton quenching in photosystem II . Phys. Chem. Chem. Phys. , 11 , 7576 – 7584 .
Wentworth , M. , Ruban , A.V. and Horton , P. ( 2001 ) Kinetic analysis of non-photochemical quench-ing of chlorophyll fluorescence. II. Isolated light harvesting complexes . Biochemistry , 40 , 9902 – 9908 .
Rupan_c08.indd 196 8/29/2012 5:36:16 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
‘To know that we know what we know, and that we do not know what we do not know, that is true knowledge ...’
Confucius
The almost-explosive (on the evolutionary scale) emergence of oxygenic photosynthesis
and its success and impact on our Biosphere is a phenomenal event that relies first of all
upon the efficient design and adaptability to the changing environmental conditions of the
molecular machinery of the photosynthetic membrane. The intensity and energy of light
radiation that defines its colour (hv) reveals very large temporal and spatial variations. For
example, the light intensity exposure of plants grown in the deep shade of the tropical forest
corresponds to the daily available photon flux 100 times lower than that available for plants
exposed to direct sunlight. Plants grown in shade environments receive light of a very
different spectral quality/colour from that received by plants grown on the full sunlight. This
is due to the process of filtering of light by canopy, so the light that passes through it becomes
enriched in the far red of the spectrum of sunlight. Plants are also often exposed to rapid and
irregular changes in light intensity. These changes could be caused by clouds shielding the
sun or sudden shading by other plants in crowded communities that often take place in
natural environments. In addition, diurnal changes in light quality and quantity regularly
modulate the light input into the photosynthetic membrane of plants on a day- to-day basis.
It is not surprising, therefore that the evolution selected various multilevel and mechanisti-
cally diverse types of adaptations of the photosynthetic organisms to the only source of
energy, light: a central factor supporting life. Optimization of light input became the central
adaptation that drove remarkable biodiversity of nature and largely determined the evolution
of all life forms on our planet.
Adaptations of the Photosynthetic Membrane to Light
9
Rupan_c09.indd 197 8/29/2012 5:35:13 PM
198 The Photosynthetic Membrane
9.1 The Need for Light Adaptations and their Various Strategies
The efficient harnessing of light energy, even in a very shaded environment, is ensured
by the existence of the light harvesting antenna (see Chapter 5). However, the drastic
fluctuations of light mentioned above create the requirement for mechanisms that
ensure ‘smooth’ inputs of energy into the photosynthetic apparatus for its optimum and
safe utilization. A number of limiting factors, restricting the achievement of this goal do
take place in the photosynthetic membrane. Under low light intensities ( light starva-tion ) the photosynthetic yield will depend upon the efficiency of light energy capture by
antenna pigments and its delivery to the reaction centres. It also relies on the captured
light energy redistribution between photosystem I and II, which operate in series to
form the electron transfer chain from water to NADP. The major fundamental limitation
under elevated light intensities ( light saturation ) arises from differences in the rates of
energy absorption and transfer to the reaction centres of photosystems and subsequent
electron transport. Being much slower than energy transfer, electron transport rates ful-
fil the fundamental thermodynamic requirement; to minimize the uphill reactions and
therefore stabilize energy, which is to be used in the chain of electron/proton transfer
reactions leading to NADPH and ATP synthesis (see Figure 1.1 of Chapter 1).
Maintaining the balanced light energy input into the two photosystems ensures the
optimum working regime of the whole photosynthetic electron transport chain and the
maintenance of the required NADPH/ATP ratio. The photosynthetic light harvesting
antenna efficiently collects light in the shade to feed the reaction centres with energy,
however, an increase in light intensity causes progressive closure of the reaction centres
since they become progressively saturated with energy leading to the reduction of the
fraction of energy utilized in photosynthesis and therefore to the build-up of the
‘unused’ potentially harmful excitation energy in the photosynthetic membrane.
Figure 9.1 summarizes the relationship between the absorbed light energy and the
energy photosynthetic organisms can utilize. The saturation of photosynthetic reactions
with light is inevitable and takes place on its different stages starting from the events
taking place in the photosynthetic membrane, charge separation in the reaction centres,
electron transport and proton gradient formation. Therefore, the light adaptation mech-
anisms are vitally essential to counteract or minimize the previously-described unwanted
effects that undermine the photosynthetic efficiency or even cause the damage to the
photosynthetic membrane.
During evolution plants have developed a multilevel network of adaptation mechanisms
to cope with fluctuations in the light environment (Figure 9.2 ). These can be divided into
the two major groups:
1. Type A adaptations to control light energy input into the photosynthetic membrane, in
other words manage the amount of light absorbed by the antenna pigments (Figure 9.2 ,
managing light absorption );
2. Type B adaptations to deal with the light energy, which has been absorbed by the light
harvesting antenna (Figure 9.2 , managing absorbed energy ).
Rupan_c09.indd 198 8/29/2012 5:35:14 PM
Adaptations of the Photosynthetic Membrane to Light 199
Some type A adaptations work on the level of whole organism. They involve adjust-
ments in the leaf orientation relatively to the direction of incident light. Whilst the
perpendicular orientation will ensure maximum light intensity exposure, nearly-parallel
leaf orientation will greatly minimize it. However, the latter cannot be absolute since there
is always a great deal of light scattered in all directions that is very difficult for the leaf to
avoid. Leaf movements can be of developmental (relatively slow and irreversible), passive
(drought related) and active nature (well-reversible). The latter is based upon the use of a
blue-light absorbing pigments as sensors and the pulvinar motor tissue to drive leaf orien-
tation movements. This adaptive system is very effective in some deep shade-adapted
plants that normally have low photosynthetic rates and are occasionally exposed to high
light. Some desert plants have developed a number of adaptations to increase leaf reflec-
tance and that way they reduce the amount of absorbed light. The A-type adaptations may
include building up inorganic deposits (salt crystals) on the leaf surface or developing
air-filled hairs. As a rule, the efficiency of these protective methods is good but as with the
developmental leaf movements, these adaptations occur on a rather slow timescale.
Type A adaptations occur also on the cellular level. Light absorption can be regulated
by chloroplast movements. This is a relatively fast process, occurring within minutes,
Absorbed energy
Utilised energy
Light intensity
Ene
rgy Excess energy
Low light
High light
Figure 9.1 Light saturation of the photosynthetic energy utilization. In low light the amount of light energy absorbed and the amount utilized in photosynthesis are well-matched. Absorption continues unabated as the light intensity increases but photosynthesis becomes saturated with light. The difference between the amount of light energy absorbed and that utilized in photosynthesis is the ‘excess energy’ which if left unchecked has the potential to harm the photosynthetic membrane.
Rupan_c09.indd 199 8/29/2012 5:35:14 PM
200 The Photosynthetic Membrane
but is capable of controlling the light absorption into the photosynthetic membrane only
by 10–20%. The similarity of the action spectra (dependency of the amplitude of
response upon the wavelength of light) for chloroplast and leaf movements suggests that
they are likely to possess common photoreceptors. Factors like the presence of obstacles
such as large vacuoles and other cellular organelles can limit chloroplast movements.
Generally, adaptations on the cell level or at the level of the whole plant have limited
capacity and promptness of response. In addition, scattering of light in natural environ-
ments as well as within the leaf/cell substantially reduces nearly all type A adaptations.
A most profound and fundamental type of plant adaptation to light occurs at the
molecular level. Both, type A and B adaptations take place here. The type A adaptations,
the regulation of light absorption, occur by long-term control of chlorophyll content in the
photosynthetic membrane – regulation of the light harvesting antenna size and the ratio
Plant adaptations to light
Number ofmembranes
Size of antenna
ChloroplastmovementsChloroplast
number
Plantmetabolism
Chloroplastmetabolism
Photosystems ratioState transitions
NPQ
Leaf orientationLeaf reflectance
Salt depositsLeaf structure
Managing light absorption
Managing absorbed energy
Figure 9.2 Multilevel strategies of plant adaptations to the light environment. Type A : managing light absorption; type B : managing absorbed energy. Three levels of adaptations are presented: organismal (plant), cellular (chloroplasts) and molecular (photosynthetic membrane). Reprinted with permission from Ruban, A.V. © 2009, Landes Bioscience. (See Plate 9.2 in colour plate section.)
Rupan_c09.indd 200 8/29/2012 5:35:14 PM
Adaptations of the Photosynthetic Membrane to Light 201
between the number of units of the two photosystems ( photosystems ratio ). The type B,
adaptations that deal with absorbed light, consists of mechanisms that take place in the
photosynthetic membrane and manifest in dynamic changes ( short-term ) in the
fundamental properties (described in Chapter 5) of light harvesting antenna, absorption cross- section and excitation energy lifetime .
9.2 Long-Term Regulation of the Photosystem Ratio and their Antenna Size: Acclimation
There is no strict temporal criterion to distinguish the long-term from the short-term
adaptation mechanisms. Long-term adaptations are predominantly of developmental nature,
and often are a result of regulation of the complex light-dependent gene expression, occur-
ring on transcriptional, translational and post-translational levels. This process takes days
and weeks and on the level of thylakoid membrane involves significant compositional and
structural alterations. These are A-type of adaptations since they tune the photosynthetic
membrane to the optimum absorption of light. They include a well-coordinated modulation
of the composition of the photosynthetic membrane by adjustments in amount of
light-harvesting antennae, PSII and PSI reaction centres, electron transport complexes and
ATPase. Plants growing in limited light possess low photosynthetic rates that cause the
saturation of the amount of utilized energy (the light saturation curve, see Figure 9.1 ) at very
low light intensities. However, plants grown under high light environment possess much
higher photosynthetic capacity revealing saturation at relatively high light intensities. Some
plant species prefer to grow in shade, others in open spaces. However, the extent of long-
term adaptation of the photosynthetic rate can be remarkably broad in some plant species,
showing that they can be equally successful in growing at a broad range of light intensities.
The adaptive changes in PSI and PSII antenna size by light intensity is a well- documented
and highly conserved phenomenon. In plants, grown under high light intensity the antenna
is always smaller than in those grown in shade. It was found that only loosely bound LHCII
complexes are involved in acclimative modulation of the PSII antenna size. The mechanism
of this process involves the reduction in amount of LHCII trimers by the proteolysis of their
apoproteins. This proteolysis is targeted specifically to the loosely-bound complexes. The
protease responsible for the process is suggested to be of serine and/or cysteine type. It is
an extrinsic, stroma exposed thylakoid membrane associated ATP-dependent enzyme.
It takes up to two days for the enzyme expression/post-translational activation after
exposing plants to high light environment. Once activated, it takes less than a day to
complete proteolysis and reduce the LHCII content by 30%. ‘Wasting’ this amount of
LHCII will release about 320 kDa of the protein mass and 160 Chl molecules per PSII
supercomplex. This is significant enough to justify the consideration for their role in the
chloroplast metabolic pathways. In this connection, the possible role for ELIPs was
suggested, as transient carriers of the free chlorophyll released during LHCII breakdown.
The other long-term acclimative response of the thylakoid membrane to the change in
the light environment (quantity and quality) involves alteration in the ratio between
Rupan_c09.indd 201 8/29/2012 5:35:15 PM
202 The Photosynthetic Membrane
number of photosystem I and II units. For example, shade plant, grown under light filtered
on the forest canopy (far red light enriched) will possess higher PSII/PSI ratio to
compensate for less red light, exciting PSII. Although related to the antenna this is
however rather the result of the electron transfer adaptation than light-harvesting. On the
other hand, all these long-term responses have some common features. First of all, the
long-term adaptations are designed to optimize the whole electron transfer shared by two
photosystems. They are also suggested to have some common signal reception pathways
in the acclimation sequence: factor – receptor – transducer – gene . Although the various
aspects of this chain are not well understood, the most recent work on the electron
transport and light harvesting acclimation suggests the redox state of photosystems as
well as the plastoquinone pool to be the important components of the multiple stress
signalling and transducing mechanisms. Recently it has been suggested that the protein
phosphorylation (see the following), including LHCII, can play the signal transduction
role. A one important function of the long-term alterations in the photosynthetic membrane
structure/composition is that they create an optimum molecular environment for the
functioning of the short-term adaptation mechanisms.
9.3 Short-Term Adaptations to Light Quality: State Transitions
9.3.1 The Phenomenology of State Transitions
Normally, during the short-term adaptations no gene expression is involved. They occur
within seconds and minutes and serve to counteract more fast changes in the light
environment, such as diurnal fluctuations in the light quantity and quality, sunflecks, light
filtering by the canopy and so on. All short-term adaptations are of B -type, since they cope
with the light which energy already is absorbed by the photosynthetic membrane. The
most documented short-term process of adaptation to the light quality resulting in the
imbalance of the energy absorbed by photosystems is known as state transitions . This
process occurs within minutes and is effective at low light intensity, that is, when light is
a limiting factor for the functioning of the photosynthetic membrane (see Figure 9.1 ). The
photosynthetic state transitions evolved to balance the excitation energy flows into the
photosystem I and photosystem II reaction centres. It is the most effective in cyanobacte-
ria and green algae, which normally tend to inhabit low light environments. State transi-
tions also take place in the photosynthetic membrane of higher plants. The cause of this
adaptation is simple: PSI and PSII possess spectrally different antenna systems, with PSI
being longer wavelength photosystem than PSII. Figure 9.3 shows room temperature
absorption spectra of isolated PSII membranes and PSI complexes. PSII possess more
chlorophyll b absorption at 650 nm and blue-shifted chlorophyll a with the maximum at
676 nm. PSI has less chlorophyll b absorption and shifted into the far red chlorophyll a
absorption with the maximum at 681 nm and a long ‘tail’ stretching up to 720 nm. Hence,
at low light, it is essential for the both photosystems to receive balanced input of light
energy; otherwize the one which gets less light would limit the efficiency of the whole
electron transport chain. Diurnal changes in the light quality as well as the periodic
Rupan_c09.indd 202 8/29/2012 5:35:15 PM
Adaptations of the Photosynthetic Membrane to Light 203
changes in the canopy shading can strongly alter the balance of red and far-red light expo-
sure of plants grown in low light environments.
Pulse amplitude modulated (PAM) fluorimetry (described in Chapter 4) can be used to
monitor state transitions and obtain the key parameters of this adaptation process.
Figure 9.4 shows a typical trace of induction of the state transitions in leaf. It is essential
in these measurements to use low light intensity for selective excitation of photosystem
I or II in order to keep the majority of reaction centres in the open state. Before applying
spectrally defined light, a saturation pulse is used to measure the level of maximum
fluorescence, Fm, in order to assess the state of photosystem II reaction centres.
A combination of red and far red lights, defined using glass filters, was applied to the leaf
as actinic continuous illumination. It induced a relatively fast fluorescence increase. This
increase was due to reduction of Q A , Immediately after the rise fluorescence declined
rapidly as a result of the light activation of the electron transport carriers that caused
oxidation of the PSII. A steady-state level, F s I was reached that correspond to State I, a
state of relatively balanced electron transfer flow between the photosystems. After this
induction phase, far red light was turned off, causing a marked increase in the fluorescence
level far above Fo to F s I’. This rise indicates that the electron removal from the photosystem
II has been slowed down leading to the additional reduction of PSII (Q A ). Continuing
illumination with the red light induced a gradual fluorescence decrease in the F s I’ level,
lasting for about 15 min and reaching a steady state level F s II’. This is the manifestation of
the transition from State I to State II, tuning the balance of excitation energy towards the
PSI consequently re-oxidizing the plastoquinone pool and PSII, causing a decrease in
fluorescence. Turning the far red light on in this state causes a small drop of F s II’ to F
s II
0.10
0.00
640 650
Red
Far red
660
Wavelength, nm
PSII PSI
PSI–PSII
670 680 690 700 710
Abs
orpt
ion
Figure 9.3 Absorption spectra of isolated PSII-containing membranes (BBY) and PSI complexes prepared by the sucrose gradient separation as described by Ruban et al . ( 2006 ). Difference between PSI and PSII absorption spectra is displayed by hollow symbols.
Rupan_c09.indd 203 8/29/2012 5:35:15 PM
204 The Photosynthetic Membrane
level. The smaller this drop the more completely state transitions compensate for the
spectral differences between photosystems. In extreme case in State II the PSII redox state
becomes almost insensitive to the spectral quality of excited light. Saturation pulse reveals
a decrease in Fm level, associated with the transition into State II. During the next 15 min
of illumination with both PSI and PSII lights a slow increase in the F s II fluorescence level
to F s I takes place. The use of a saturation pulse in the end of this period reveals complete
restoration of the Fm fluorescence level. Now, turning off the far red light again causes the
rise in the Fs level suggesting the restoration of the spectral difference between the
photosystems typical of State II. One can run another cycle of illumination and reveal that
these transients are perfectly reversible.
Several important parameters of the fluorescence transients related to the state transitions can
be calculated. First is a degree of energy imbalance induced by the removal of the far-red light:
0
s sF I F IIB
F
′−= (9.1)
This is somewhat an arbitrary parameter, which depends on the ratio between red and far-
red light intensities. It is useful in tuning the set-up for the measurements as a standard for
optimum light choice. The imbalance parameter can also be used to assess the effect of
antenna composition and structure on the spectral differences between photosystems,
which affect the efficiency of the linear electron transport rate.
Time, min15
State I State II State IIState I
FsI’
FsII’ FsII
FmIFm
qT
FmII
FsIForfr
ononoff
fr
Flu
ores
cenc
e, r
el.
30 45
Figure 9.4 Pulse amplitude modulated chlorophyll fluorescence measurement of the state transitions in Arabidopsis leaf. Fo and Fm are the fluorescence levels corresponding to open and closed PSII reaction centres, respectively. r and fr are red and far-red continuous lights. F s I and F s I’ are the fluorescence levels at State I with and without far-red light on, respectively. F s II and F s II’ are the fluorescence levels at State II with and without far-red light on, respectively. qT is a reduction in Fm level as a result of the transition into State II.
Rupan_c09.indd 204 8/29/2012 5:35:15 PM
Adaptations of the Photosynthetic Membrane to Light 205
The second state transition characteristic is the level of F m fluorescence drop in State II.
It is called qT and calculated as:
m m
m
F I F IIqT
F I=
�
(9.2)
qT is regarded as a fluorescence decline, not a true quenching, since it reflects the decrease
in the PSII antenna size (see the following). This is normally variable from 0 to 0.25.
A third useful parameter for the quantification of the state transitions is referred to as qS :
−′ ′=
−′s
s s
F I F IIqS
F I F IIs
(9.3)
qS indicates how effectively state transitions compensate electron transport imbalance for
changing quality of light. The parameter varies from 0 to 1, where 1 indicates 100%
efficiency in the efficiency of rebalancing of the electron transport rate after the changes in
the spectral quality of light.
A fourth characteristic of state transitions is the rate of F s fluorescence changes. It can
simply be estimated as 1/ t 1/2
, where t 1/2
is the time required to change F s by 50%. In addition,
F s can be fitted with, for example, an exponential function in order to obtain the value of
the rate constant.
9.3.2 The Molecular Mechanism of State Transitions
In order to understand molecular events in the photosynthetic membrane that enable state
transitions observed by PAM fluorimetry one can employ low temperature (77 K) fluores-
cence spectroscopy. The method is useful since the low temperature fluorescence spectrum
of the photosynthetic membrane shows distinct PSI and PSII emission bands allowing
quantifying energy redistribution between them. Figure 9.5 (a) compares spectra of isolated
chloroplasts in states I and II, normalized to the PSII fluorescence region. In State II the
PSI fluorescence band at around 735 nm is strongly enhanced relatively to that in the
State I. The difference State II-minus-State I spectrum closely resembles that of purified
PSI (see Figure 5.19, Chapter 5). The observed enhancement of PSI fluorescence during
the transition into State II appears to be very similar to the change related to grana unstack-
ing where spillover of energy from PSII to PSI occurs. However, electron microscopy did
not reveal any significant changes in stacking during the state transitions. Moreover, whilst
the state transitions did not have any significant effect on the photosystem II intrinsic effi-
ciency, spillover caused a large decrease in Fv/Fm – PSII yield (φ PSII
, see Chapter 4,
Equation 4.17). These fundamental discrepancies have been resolved by the emergence of
a new molecular model explaining the state transitions: the LHCII phosphorylation mecha-
nism that will be described later.
Rupan_c09.indd 205 8/29/2012 5:35:20 PM
206 The Photosynthetic Membrane
The reason why the PSI fluorescence was strongly enhanced in the State II becomes very
clear when one can measure the excitation fluorescence spectrum for the PSI emission at
735 nm (see Chapter 5 for the theoretical and experimental background). Figure 9.5 (b)
shows the difference State II-minus-State I 735 nm excitation fluorescence spectrum. This
Figure 9.5 (a) 77 K fluorescence spectra of isolated Arabidopsis chloroplasts in States I and II. (II–I) is a difference spectrum between State II and State I. Spectra were normalized at 680 nm. (b) 77 K difference excitation spectrum State II-minus-State I (II–I) and reversed transmission spectrum of isolated trimeric LHCII (for the method details see Chapter 4).
2.0
1.8
1.4
1.2
1.0
0.8
0.6
0.4
0.2
0.0660 680 700
State II
State I
(II–I)
(a)
Wavelength, nm
Flu
ores
cenc
e, r
el.
720 740 760
1.6
1.0
(b)
0.8
0.6
0.4
0.2
0.0450
Flu
ores
cenc
e/(1
-T),
rel
.
500
(II–I)(1-T)LHCII
550
Wavelength, nm
600 650 700
Rupan_c09.indd 206 8/29/2012 5:35:21 PM
Adaptations of the Photosynthetic Membrane to Light 207
difference spectrum reveals the cause of the PSI cross-section increase in the State I. The
spectrum clearly resembles the (1–T) spectrum (reversed transmission) of isolated LHCIIb
complex. Structural features at 435, 660, 670 and 676 nm (chlorophyll a ), and 472 and
650 nm (chlorophyll b ) can be clearly seen in the both types of spectra. The ratio between
chlorophyll a and b in the red and Soret regions indicates that the PSI cross-section is
enhanced in State II due to the coupling of major LHCII complex to this photosystem. No
long-wavelength chlorophyll a forms typical for PSII core complexes (CP47) can be
detected in this experiment, suggesting the absence of spillover, or direct interaction of the
hole of PSII complex with PSI as in the case of grana unstacking. The relative cross-section
increase expressed as a ratio between the area below this difference spectrum and the
excitation fluorescence spectrum of 735 nm band for the State I in the red chlorophyll
absorption region (600–710 nm) was found to be around 25%. Taking into account that PSI
carries 166 chlorophylls 25% of that number would correspond to approximately 42
molecules in additional cross section in the State II. This matches well the number of
chlorophyll molecules in LHCII trimer or three LHCII monomers (42 chlorophylls a + b ).
Assuming the ~20% of PSII antenna decrease as a result of the loss of one LHCII trimer
along with the 25% of the PSI cross-section gain increase in PSI antenna, the total energy
balance change between photosystems will reach 50%. This is a significant alteration that
can compensate for the changes in the light environment, particularly in shade growing
plants, which have larger pool of the peripheral LHCII antenna.
What triggers the energetic coupling between LHCII and PSI in State II observed in the
low-temperature fluorescence measurements? Two major discoveries have been crucial for
a development of the currently accepted state transition model. First is a discovery of
phosphorylation of the chloroplast membrane proteins and second is the enzyme kinase
activation by the redox state of the plastoquinone pool. According to the model, the
imbalance in the energy input into both photosystems is reflected by the redox state of
the plastoquinone pool (see Chapter 3 for the electron transfer pathways in the photosynthetic
membrane), which acts as a governor operating two enzymes, kinase and phosphatase,
which phosphorylate and dephosphorylate some of the LHCII polypeptides, respectively.
The kinase targets threonine or serine residues of the stroma-exposed N-terminus of the
polypeptide. The phosphorylation alters the affinity of a subpopulation of LHCII complexes
to photosystem II causing its detachment and migration towards photosystem I in order to
serve as an additional antenna for this photosystem. The mechanism of Phospho-LHCII detachment from PSII can involve either a generation of a very repulsive negative charge
force brought by phosphate or/and alteration of the conformation of N-terminus (helix
dynamics) upon phosphorylation of LHCII polypeptides. The latter concept, proposed by
Allen (Allen and Forsberg, 2001 ), explores the inherent conformational flexibility of LHC,
discussed previously in this book.
The Figure 9.6 schematically illustrates the state transition mechanism. As a result,
PS II cross-section decreases, whilst that of PSI increases. In addition, since the increase
in the PSI cross section occurs at the expense of chlorophyll b and short-wavelength
forms of chlorophyll a of LHCII complexes it makes PSI antenna less spectrally distin-
guishable from that of the photosystem II facilitating further the balanced redistribution
Rupan_c09.indd 207 8/29/2012 5:35:22 PM
208 The Photosynthetic Membrane
of the excitation energy in the thylakoid membrane. Oxidized plastoquinone acting as
an activator of phosphatase causes removal of the phosphate group from LHCII and
subsequent migration of the LHCII complex towards photosystem II. The LHCII phos-
phorylation model was confirmed by numerous experiments. The effect of redox state
of plastoquinone pool on the kinase has been demonstrated by groups of Allen and
Horton (see the review by Ruban and Johnson, 2009 ). The role of the spectral quality of
light in the phosphorylation of thylakoid proteins has been shown on both, isolated
photosynthetic membranes and leaves. Chlorophyll fluorescence measurements have
confirmed reversible, phosphorylation-related alteration in the energy redistribution
between photosystems, resulting in decrease in PSII and increase in PSI electron trans-
port rates. Various microscopy and biochemistry experiments proved the migration of
phosphorylated LHCII into the stroma lamellae, which carry PSI. It was proposed that
only a subpopulation of the major LHCII, a mobile phosphorylated complex (most
likely L- or M-trimers), migrated towards PSI. This complex was found to be enriched
in the Lhcb2 polypeptide.
Loosely-bound LHCII protein phosphorylation provides molecular mechanism for the
state transitions. However, apart from loosely, there are some medium- and strongly-bound
and minor antenna LHCII complexes as well as D1 and others, which undergo phospho-
rylation under some conditions in the photosynthetic membrane and role of this multiple
phosphorylation in the state transitions is not clearly understood. Phosphorylation may, for
example, be a signal to control the thylakoid membrane energization. The phosphorylation
of CP29 complex was suggested to play an important role in the cold stress adaptation of
the membrane. Clearly, the phosphorylation of the thylakoid proteins is an important
Figure 9.6 The LHCII phosphorylation model of the state transitions. Imbalance in the light energy input into the antennae of photosystems leading to the preferential excitation of PSII causes the reduction of the plastoquinone pool (PQH2). Reduced PQ activates kinase, which phosphorylates polypeptides of LHCII. The phosphorylated LHCII detaches from PSII, migrates towards PSI and incorporates into its antenna system. As a result of this incorporation PSI gains more excitation energy which leads to the increase in the reaction centre (RCI) turnover with the subsequent oxidation of the plastoquinone pool. When PSI gains relatively more excitation light than PSII it oxidizes PQ further. PQ activates phosphatase, an enzyme which dephosphorylates LHCII attached to the PSII. Dephosphorylated LHCII detaches from PSI, and migrates and incorporates into PSI. The different colours of PSI (black) and PSII (light grey) antennae highlight their spectral difference.
Rupan_c09.indd 208 8/29/2012 5:35:22 PM
Adaptations of the Photosynthetic Membrane to Light 209
phenomenon and should be widely investigated with respect of the signal transduction,
protein conformation, membrane dynamics and the adaptation mechanisms involved.
One mechanistic question deserving a particular focus is what is the oligomeric state of
the migrating phospho-LHCII complex, a trimer or a monomer ? It has been previously
suggested that the LHCII phosphorylation causes its monomerization, detachment from
PSII and migration towards PSI in the monomeric state. Migration of a smaller, monomeric
complex with an altered conformation allowing recognition of PSI is an elegant scenario
explaining the promptness, precision and effective reversibility of the state transitions.
However, recently, electron microscopic evidence has emerged suggesting that in State II
PSI interacts with a particle closely resembling an LHCII trimer. Figure 9.7 (a) shows the
schematic representation of the result obtained by the Boekema’s group (Kouril et al ., 2005 ) showing a single PSI complex interacting with the single LHCII trimer. This
presentation illustrates the data obtained using the electron microscopy combined the
single particle analysis (see Chapter 4 for the method details) on the digitonin-solubilized
membranes isolated from plants where the State II transition was induced by light.
A docking site around a domain of PSI subunits A, H, I, K and L has been proposed for
LHCII. The binding was interpreted as weak and non-specific.
In addition to the electron microscopy analysis, the question about the oligomerization state
of migrating phospho-LHCII was addressed by analysing the Soret region of the calculated
additional cross-section spectrum of PSI in State II. Figure 9.7 (b) displays the Soret band of
this spectrum and its second derivative as well as excitation fluorescence spectra for the
LHCIIb in trimeric and monomeric states. The second derivative spectrum shows maxima
corresponding to chlorophylls and xanthophylls (see Chapter 8 for details). A band at 510 nm
corresponding to Lutein 621 (Lutein 2) absorption is clearly seen. This band is present
exclusively in LHCII in the trimeric, not monomeric state as evident from the comparison of
their fluorescence excitation spectra. If the phospho-LHCII interacting with PSI would exist
in the monomeric state the cross-section increase spectrum would not show 510 nm band.
Therefore, the excitation spectral analysis of the state transitions on isolated chloroplasts made
it possible to not only identify and quantify LHCII interaction with PSI during the state
transitions but also helped to define in situ its state of oligomerization as a trimer.
9.3.3 Chromatic Adaptations in Plants Lacking the Polypeptides of the Major LHC II Complex
The significance of keeping a balance of excitation energy input into photosystems was
highlighted by experiments on Lhcb2 antisense plants ( as Lhcb2) lacking the two major
LHCII polypeptides, Lhcb1 and 2 (see Chapters 7 and 8 for an introduction to Lhcb2
antisense plants). Figure 9.8 shows a typical PAM fluorimetry of the state transitions in the
antisense leaf (for details of the method see the Figure 9.4 legend and the text). The state
transitions were completely inhibited (qT = 0, qS = 0), as was anticipated since the polypeptide
that undergoes phosphorylation, Lhcb2, was missing in these plants. What was surprizing is
the fact that the imbalance parameter, IB, was found to be drastically reduced in comparison
Rupan_c09.indd 209 8/29/2012 5:35:22 PM
210 The Photosynthetic Membrane
to the wild-type plants (IB as = 0.1 vs. IB wt = 0.65). Indeed, the response to the far-red light
in the antisense plants was much smaller than that of the wild-type (Figure 9.4 ). This indi-
cates some alterations in the photosystems antennae composition/structure that reduced the
spectral differences between them (see Figure 9.3 ). Further experiments have revealed that
significant compensatory adjustments took place in the photosystem II antenna of as Lhcb2.
Figure 9.7 (a) Scheme illustrating interaction of the phospho-LHCII trimer with PSI supercomplex based upon the electron microscopy and single particle analysis work of Kouril and coworkers (2005). Presented in freeware PyMol 0.99. (b) The Soret band 77 K F735 excitation fluorescence spectral difference, State II-minus-State I (II–I), and its second derivative (2nd derivative). The solid and dashed lines represent excitation fluorescence spectra of isolated LHCII trimers and monomers, respectively (detection wavelength was 680 nm). Vertical line highlights the 510 nm band characteristic for the LHCII trimer and absent in the complex in the monomeric state.
(a)
Lhca1
Lhca4
Lhca2Lhca3
Phospho-LHCII
(b)
1.4
1.2
1.0
0.8
0.6
0.4
0.2
0.0
420 440
(II–I) Monomer510
Trimer
(II–I) 2nd derivative
460 480
Wavelength, nm
Flu
ores
cenc
e, r
el.
500 520 540–0.2
Rupan_c09.indd 210 8/29/2012 5:35:22 PM
Adaptations of the Photosynthetic Membrane to Light 211
The major LHCII trimers were still present in the antisense pants but built of Lhcb5 and
Lhcb3 proteins. Close comparison of the spectral properties of these trimers and the timers
isolated from the wild-type revealed not only a significant decrease in the chlorophyll b
absorption but also a shift towards longer wavelengths of the spectrum of chlorophyll a
(Figure 9.9 a). These differences made PSII antenna of antisense plants effective in capturing
less red and more far red photons and therefore made it similar to the PSI antenna.
Furthermore, a significant increase in the PSI antenna size caused by an increased amount of
LHCI complexes took place. This was a first observation that LHCI antenna can be consider-
ably upregulated. The excitation fluorescence spectroscopy of isolated PSI revealed the
functional increase in cross-section by approximately 20% (Figure 9.9 b). However, this fig-
ure is probably much higher taking into account the removal of a large proportion of the
peripheral LHCI from PSI during its purification in the mutant. PSI antenna in the antisense
plants gained more chlorophyll b and blue-shifted chlorophyll a with additional LHCI units
and therefore became more blue-shifted: the response completely opposite to that of the PSII
antenna, as described previously. Therefore, the spectral alterations in antennae of photosys-
tems in the Lhcb2 antisense plants significantly decreased chromatic differences between
the two photosystems. This makes the photosynthetic membrane less sensitive to the changes
in spectral quality of light as was clearly indicated by the dramatically decreased imbalance
parameter in the state transition measurements shown in Figure 9.8 . Absence of ability to
perform the state transitions seems to be compensated by the decrease in the spectral differ-
ences between PSI and II antennae in as Lhcb2 plants. Alleviation of these differences is yet
another demonstration of how flexibly the photosynthetic antenna can respond to dramatic
alterations in the polypeptide composition ensuring the principle of robustness .
Figure 9.10 illustrates the antenna adjustments in the as Lhcb2 plants. The state transi-
tions are absent and compensated by the decreased PSII antenna (compare to the Figure 9.6 ),
which is less spectrally different from the PSI antenna (highlighted by the same grey colour
of the antennae of the both photosystems). Photosystem I antenna is increased with more
LHCI units attached.
Flu
ores
cenc
e, r
el.
rfr fr Off On
5 min
Figure 9.8 Absence of the state transitions in Lhcb2 antisense Arabidopsis leaf. For experimental details, see Figure 9.4 .
Rupan_c09.indd 211 8/29/2012 5:35:23 PM
212 The Photosynthetic Membrane
9.3.4 Future of State Transitions Research
State transitions remain one of the most interesting topics in photosynthesis research.
Invention of new experimental approaches is likely to ignite a new wave of discoveries in
this field. Development of various microscopies, suitable for studies of the membrane
structure and dynamics in vivo can be very promising in elucidating the mechanism of the
phospho -LHCII delivery to the PSI; that is, migration character, rates, role of the membrane
composition and macrostructure, character of interaction of the phospho -LHCII with PSI.
Availability of various protein and pigment (xanthophyll) antenna mutants provides a rich
Figure 9.9 (a) 77 K absorption spectra of isolated LHCII trimers from the wild-type (solid line) and Lhcb2 antisense (dashed line) Arabidopsis leaves. (b) 77 K reversed transmission (solid lines) and F735 fluorescence excitation (dashed lines) spectra of isolated PSI from the wild-type (wt) and Lhcb2 antisense ( as ) plants.
(a)
0.25
0.20
0.15
0.10
0.05
0.00640
wt
as
660
Wavelength, nm
Abs
orpt
ion
680 700
(b)
1.0
0.8
0.6
0.4
0.2
0.0640
as
as
wt
wt(1-T)
Excitation
1-T
/Flu
ores
cenc
e, r
el.
660
Wavelength, nm
680 700 720
Rupan_c09.indd 212 8/29/2012 5:35:24 PM
Adaptations of the Photosynthetic Membrane to Light 213
field for experimentation, which could help to determine what factors govern detachment,
migration and energetic coupling to PSI of the phospho -LHCII and roles of the immobile
PSII antenna complexes and LHCI in the state transitions. Important physiological
questions regarding the state transitions are waiting to be addressed. Among them are
possible effect of LHCII antenna size and composition; effect of membrane fluidity and
protein density; effect of the xanthophyll cycle activity; effect of PsbS; effect of the change
in the photosystem stoichiometry and PSII connectivity; the role of state transitions in plant
survival under the light starvation regimes in natural environments. These and other new
approaches should engender a greater understanding of the role of the state transitions in
the context of the fundamental adaptive responses of the photosynthetic membrane and
indeed the life of the plant as a whole.
One important aspect of the state transitions and LHCII phosphorylation is interaction
with the long-term adaptation mechanisms, their role in the cyclic electron transport and
interaction with the other short-term adaptation mechanisms. As mentioned previously, the
state transitions should be particularly effective under low light, where the thylakoid
membrane accumulates large PSII antenna and, basically due to the presence of the loosely-
bound LHCII. This population is also a substrate for phosphorylation, therefore in low-light
grown plants the extent of the state transitions or phosphorylation-induced energy
redistribution between photosystems is the highest. It can be rationalized that the shade-
grown plants are appropriately better prepared for sudden fluctuations in the light quality,
which can originate from the sunflecks and changes in shading from the other plants
(movements due to wind, diurnal change in the angle of sun beams etc.). On the other hand,
in plants grown under high, saturating light (Figure 9.1 ), where state transitions lose their
role, the loosely-bound LHCII antenna is reduced. Therefore, large peripheral LHCII
antenna along with the long-term increase in PSII/PSI ratio (see previous) will constitute
an adequate basis for more flexible adaptation to the sudden energy imbalance between
photosystems. Combining ecophysiological experiments with some genetic manipulation
approaches, designed to specifically under- or overexpress certain components of
the thylakoid membrane seems to be a way forward towards shedding more light upon the
Figure 9.10 The model illustrating compensatory adjustments in both photosystem I and II antennae as a response to the lack of Lhcb1 and 2 polypeptides of the major LHCII complex. Lack of the state transitions is compensated by the reduced PSII and increased PSI antenna sizes. In addition, in the as Lhcb2 plants, PSII antenna absorption is red-shifted in comparison to that of the wild-type plants. PSI antenna absorption, on the other hand, shifted more to the blue, since it is more enriched in chlorophyll b -containing LHCI complexes. Similarity of PSI and PSII antennae colouring (both in grey) indicates their similar spectral properties (compare with the Figure 9.6 ).
Rupan_c09.indd 213 8/29/2012 5:35:24 PM
214 The Photosynthetic Membrane
molecular mechanism and significance of the state transitions and protein phosphorylation
in the natural plant habitats.
9.4 Short-Term Adaptations to Light Quantity
In high light, the energy balance between photosystems is not a problem. However, at
increasing light intensity the photosynthetic reaction centres become progressively
saturated (closed), resulting in a reduction in the fraction of energy utilized in photosynthesis
and the subsequent build-up of ‘unused’, potentially harmful, excitation energy in the
photosynthetic membrane (Figure 9.1 ). Build-up of this energy can cause various
detrimental effects on the organism, particularly on the delicate photosynthetic machinery.
The excess excitation energy in the antenna systems can cause photoinhibition , a sustained
decline in the photosynthetic efficiency and productivity, associated with the damage of the
photosynthetic reaction centres. The reaction centre of the PSII is more susceptible to
the damage than the reaction centre of PSI because of the very strong oxidation potential
of the P680 (+1,17 V) needed to oxidize water (see Chapter 3). Under some conditions,
when electron donation to P680 is less efficient than oxidation, an increase in the P680 +
lifetime will occur. The powerful oxidant P680 + will inevitably oxidize nearest pigments
and aminoacids, causing their degradation and the subsequent D1 degradation will follow.
This type of damage is called donor side photoinhibition . In other circumstances, when
acceptor side is less efficient, a radical pair is formed. The recombination of this pair will
lead to the P680 triplet formation. In this state P680 can interact with the atmospheric
triplet oxygen, causing the formation of very reactive singlet oxygen, which in turn will
bleach P680 leading to the degradation of D1. This type of photodamage is called acceptor side photoinhibition Therefore, regardless of the damage scenario, the number of active
PSII units will be decreased and because of the slow D1 repair the decline in electron trans-
fer will last for some time even when excess light is no longer present. The excess energy
accumulation is very dangerous for wild and particularly openly cultivated plants, exposed
to full sunlight. This is becoming an important problem for agriculture; the cost of
photodamage is very high. The need to avoid photoinhibition has therefore created a strong
selective pressure for mechanisms that reduce excess energy accumulation in high light
environments. Therefore the study of molecular mechanisms of photoprotection is crucial
and the rest of this review will deal with them. These are fundamental, molecular
mechanisms designed by evolutionary process to supply the basis for the photosynthetic
light utilization flexibility, regardless the place of plant habitat, some of them are very
effective and prompt responses, achieved within minutes or even seconds.
9.4.1 Control of Excess Light Energy in Photosystem II – The Phenomenon of Nonphotochemical Chlorophyll Fluorescence Quenching (NPQ)
Excess light energy in the photosynthetic membrane generated under high illumination
conditions can be controlled. This adaptation mechanism emerges from the very heart of
Rupan_c09.indd 214 8/29/2012 5:35:24 PM
Adaptations of the Photosynthetic Membrane to Light 215
the energy transformation events depicted and explained in Figure 1.1 of Chapter 1, taking
place in the photosynthetic membrane. The scheme shown in Figure 9.11 illustrates the
fundamental principle of the light harvesting and, hence, the excess energy control in the
photosynthetic membrane. The excess light have to be controlled over the sequence of
energy transformation events in the photosynthetic membrane. In the light phase of photo-
synthesis, overproduction of ATP (NADPH) will cause the accumulation of protons in the
intrathylakoid membrane space ( lumen , see Chapter 3), which in turn will lead to inhibition
of a number of key electron transport enzymes (Cyt b/f and the oxygen evolving complex
of PSII) causing reduction in electron transport rates. Indeed, as with respiratory control in
mitochondria, the photosynthetic membrane possesses photosynthetic control as a feedback
mechanism for balancing ATP (NADPH) production with electron transport. However, no
matter how efficient photosynthetic control is, the path of photon to electron energy conver-
sion requires an additional control loop. This requirement is based on the fact that the light
capture and delivery of energy to reaction centres by antenna is a very efficient process that
is not directly limited by the reaction centre turnover rate. The essential feedback control exists in the form of the lumen proton effect upon the PSII antenna (Figure 9.11 ). Protonation
of some aminoacid residues of PSII light harvesting complexes causes the formation of an
additional nonradiative energy dissipation channel in PSII that competes with reaction
centres for excitation. This competition leads to downregulation of antenna efficiency that
relieves the photosynthetic membrane from excess light. This feedback process can be
monitored in the form of the PSII antenna chlorophyll fluorescence yield decline under
conditions of excess excitation energy accumulation in the photosynthetic membrane and is
called nonphotochemical chlorophyll fluorescence quenching, qN, or NPQ.
Chapter 4 has already introduced qN with the PAM fluorescence analysis technique,
explaining how qN/NPQ parameters are calculated and illustrated the time course typi-
cal of the short-term adaptation that is reversible and occurs within the minutes time
scale (see Figure 4.15). Figure 9.12 shows parallel monitoring of chlorophyll fluores-
cence by PAM and 9-aminoacrydine fluorescence of isolated chloroplasts. The latter is
used to measure the level of the proton gradient across the photosynthetic membrane,
ΔpH (described in Chapter 4). The ΔpH establishment is induced by actinic light (AL)
and causes the decline in the fluorescence level of 9-aminoacrydine. The recording
shows that ΔpH forms faster than chlorophyll fluorescence quenching, qN. It takes
Photosystem II E.T.
NPQ
ATP
NADPH
ΔpH
Figure 9.11 Scheme depicting the feedback control of light harvesting in plants. PSII absorbs light and produces electrons (ET) which are transported through the thylakoid membrane to produce NADPH and drive formation of Δ pH for ATP synthesis. Built up Δ pH exerts control over PSII via regulation of the excitation pressure in LHCII antenna (NPQ).
Rupan_c09.indd 215 8/29/2012 5:35:24 PM
216 The Photosynthetic Membrane
about 10 s to reach maximum for ΔpH whilst quenching of Fm’ (the onset of qN) takes
hundreds of seconds (several minutes). After about 5 min an inhibitor of PSII electron
transport (DCMU: blocks plastoquinone (PQ) binding site QB) prevents electrons leav-
ing PSII and causes complete reduction of Q A acceptor. The latter ‘closes’ reaction cen-
tre and prompts chlorophyll fluorescence rise to the maximum. As a result, the whole
electron transport of the photosynthetic membrane stops causing the collapse of ΔpH
that is registered by recovery of 9-aminoacrydine quenching within ~10 s. The chloro-
phyll fluorescence quenching, qN, also recovers, but on a slower time scale and not
always to the initial level, Fm. If the Fm“ < Fm, this indicates the onset of photoinhibi-
tion or some slowly reversible components of qN that are related to photoprotection (see
following). The quickly reversible component of qN, qE, is normally used as a measure
of the short-term photoprotective response of the photosynthetic membrane to the high
light exposure. Figure 9.13 demonstrates how important qE is for the protection of PSII.
The yield of PSII is measured with and without qE: the uncoupling agent, nigericin,
prevents formation of ΔpH and hence qE. The excess light illumination for ~1 h caused
a strong irreversible reduction in the PSII yield (Fv/Fm) from 0.8 to <0.4. This means
that within one hour moderate illumination destroyed more than 50% of PSII reaction
centres. The yield recovery will take place on the timescale of hours since it requires
replacement of the damaged reaction centre components, mainly the D1 protein, by a
newly-synthesized one. The long-term damage to the RCII undermines overall plant
growth and development.
Figure 9.12 Simultaneous measurements of ∆pH (9-aminoacrydine fluorescence quenching) and chlorophyll fluorescence quenching induced by actinic light (AL, 1000 m Mm −2 s −1 ) illumination. Chlorophyll a fluorescence levels at the conditions of all open (Fo) or closed (Fm) RCII, steady-state at actinic light (Fs), quenched by NPQ (Fm’) and recovered by the inhibitor of PSII, DCMU (Fm”) are indicated.
Rupan_c09.indd 216 8/29/2012 5:35:25 PM
Adaptations of the Photosynthetic Membrane to Light 217
The differences in kinetics of ΔpH and qN indicate that the processes are not entirely
tightly interconnected. The ΔpH effect on qN is considered as a trigger type, which only
initiates or ignites the process of quenching formation within the PSII antenna: a quenching
site . Antenna response to the trigger is somewhat delayed, suggesting that there are other
events that should happen at the site in order to form qN. Hence, a change in the site is
anticipated, that forms a quencher , that begins to compete with RCII for the excitation and
therefore lowers the excess energy in the photosynthetic membrane, protecting it from the
photodamage. Trigger , site , change and quencher are four key elements that constitute the
molecular mechanism of qN. The term NPQ is now more often used to refer to the nonpho-
tochemical quenching in general and its photoprotective component, qE, that is often called
photoprotective NPQ. Both terms, qE and protective NPQ , are equally appropriate to name
the photoprotective component of qN in general. As far as the calculation methods used,
qE-type is usually the yield of the process (Fm″ - Fm′)/Fm″, whilst protective NPQ is
Fm/Fm′ - Fm/Fm″ and characterizes the power of the process relatively to the sum of the
rates of other dissipative channels in antenna: k D /(k
f + k
d ) (see Chapter 4 for details). In
most cases Fm“ < Fm, meaning the dark recovery of NPQ is never complete. Later we will
discuss the multiple factors that prevent this recovery.
9.4.2 The Molecular Components and Processes Involved in NPQ
To understand the molecular mechanism of NPQ requires identification of proton-interacting
complex(es) of antenna and their aminoacids, identification of effect(s) on the structure
0.8
0.6
0.4
0.2
0.00 20 40 60
Time, min
+ Uncoupler
Control
ΦP
SII
Photoinhibition
80 100 120
Figure 9.13 The photoprotective effect of NPQ. The actinic light was switched on at the zero time on the time scale. Following ~1 h illumination PSII yield was promptly restored in the dark to normal, ~80%, indicating that the light did not cause any sustained photoinhibitory damage. However, when Δ pH was inhibited with the uncoupler nigericin to prevent the formation of NPQ, a significant sustained decrease in PSII yield took place following illumination, indicating the onset of the photoinhibition (highlighted by the down arrow).
Rupan_c09.indd 217 8/29/2012 5:35:26 PM
218 The Photosynthetic Membrane
protons inflict as well as finding out of identity and the process of activation of trap(s) of
the excess energy in antenna. As shown in Figure 9.12 , acidification of the thylakoid lumen
is crucial for NPQ. It is possible that some lumen-exposed or closely-localized to the lumen
site aminoacid residues, mainly aspartates and glutamates, of LHCII complexes are
involved in the process of proton binding. The research is underway to link NPQ to the
protonation of these residues. It is not entirely clear whether the protonation process is
specific or is of generic character that involves multiple proton-binding sites. The question
of protonation inevitably addresses the question of the site, which antenna complex (or
indeed complexes) is/are involved in NPQ? The rest of this chapter will present a current
mechanistic understanding of the molecular events underlying photoprotective NPQ (qE).
9.4.2.1 The Site of qE
The knowledge that qE occurs in the light harvesting antenna came from several spectro-
scopic and biochemical studies:
1. qE was found to be associated with a significant decrease in LHCII fluorescence when
all PSII reaction centres are open (Fo quenching);
2. qE was discovered to persist if samples were frozen to 77 K;
3. It was associated with quenched fluorescence bands originating from LHCII com-
plexes. Spectral analysis of qE and qP showed that different emitting bands are
quenched: qP preferentially quenches the PSII core fluorescence (685 and 693 nm
bands) and qE quenches 680 and 700 nm bands that belong to LHCII;
4. The time-resolved fluorescence recorded for leaves was consistent with quenching
taking place in the antenna;
5. Direct measurement of heat emission in the qE state showed it to occur promptly that
can only happen in antenna complexes;
6. Mutant plants lacking the most of LHCII antenna possess much reduced levels of qE;
7. Cross-linkers that bind to protein blocked qE in the same way as restricted the transi-
tion of isolated LHCII from efficient to protective states (see Chapter 8);
8. qE and isolated trimeric LHCII responded in the same way to a number of factors such
as pH, antimycin A, dicyclohexylcarbodiimide (DCCD), tertiary amines and magne-
sium;
9. qE was found to be almost entirely dependent upon the presence of exclusively LHCII
antenna-bound xanthophylls, lutein and zeaxanthin;
10. The kinetics of qE were greatly dependent upon the presence of PsbS protein that is
not a part of PSII core complex and is rather relatively randomly redistributed in the
photosynthetic membrane.
Summarizing the facts listed above on the origins of qE one can conclude that the process
occurs in the light harvesting antenna and depends apart from the trigger , ΔpH, upon a few
factors: zeaxanthin (lutein), PsbS protein and the state of LHC aggregation. All these fac-
tors will be discussed in the following sections in order to gradually build the picture of our
current understanding of the molecular mechanism of qE and other NPQ components.
Rupan_c09.indd 218 8/29/2012 5:35:26 PM
Adaptations of the Photosynthetic Membrane to Light 219
9.4.2.2 The Role of Zeaxanthin in qE
Demmig-Adams et al . (1990) made one of the major breakthroughs towards understanding
the mechanism of qE. This group provided the first evidence of a connection between the
xanthophyll cycle and NPQ before the details of PSII antenna composition and structure
have been revealed. The xanthophyll cycle was discovered by Sapozhnikov in 1957 and its
properties and enzymatics were initially characterized by Yamamoto and Hager (Yamamoto
et al ., 1962 ; Hager, 1966 ). The cycle involves two enzymes, the de-epoxidase and the
epoxidase, which reversibly interconvert violaxanthin and zeaxanthin (see Figure 5.14 for
xanthophylls’ structure comparison). In leaves it takes minutes to induce the synthesis of
zeaxanthin from violaxanthin but hours for the back reaction. Therefore, zeaxanthin accu-
mulated in light remains present in the dark for some time, when qE is absent. The work
of Demmig-Adams showed that the conversion of violaxanthin into zeaxanthin, induced
by the formation of Δ pH in high light, strongly enhanced NPQ. They suggested that zeax-
anthin may be the pigment responsible for quenching (see the following for a further
discussion of the origins of NPQ quenchers). Figure 9.14 shows two PAM fluorescence
induction curves obtained on a spinach leaf induced by two consecutive illumination peri-
ods of 5 min each interrupted by 10 min darkness. This is a method of application of cycles
of light and darkness in order to see the photosynthetic membrane response and capacity
to form NPQ. Indeed, in the natural environments light exposure can be intermittent; hence
Figure 9.14 Influence of zeaxanthin upon NPQ formation in leaves. All fluorescence induction terms as in Figure 9.12 . The Fm level dark recovery after the first illumination cycle (Fm") is indicated by a vertical arrow. qI is the amount of irreversible quenching after 10 min darkness. qN – Zea is the amount of quenched Fm in the absence of zeaxanthin. qN + Zea is the amount of quenched Fm promoted by the presence of zeaxanthin.
Rupan_c09.indd 219 8/29/2012 5:35:26 PM
220 The Photosynthetic Membrane
the experiment shown in Figure 9.14 is aimed to model it. The leaf was dark-adapted and
did not contain any zeaxanthin or antheraxanthin (an intermediate containing only one
epoxy group, hence half molecule is violaxanthin and half is zeaxanthin). In the first 3 min
of the first illumination cycle qN formed in the total absence of zeaxanthin (qN -Zea
) but was
only about 0.4 or when expressed as NPQ – ~0.67. After the third illumination minute qN
increased further starting the second, slower formation phase that correlated with emer-
gence of zeaxanthin (see the inclined arrow). The Fm ’ quenching was followed by the
quenching of Fo. Indeed, after turning off actinic light, the Fo ’ level was registered slightly
lower than Fo. After 10 min in the dark the major part of qN has recovered (qE). The
remaining quenching corresponded to qI and was about 0.2. The PSII yield, φ PSII
or Fv/Fm
was reduced from 0.8 to about 0.7. This reduction is significant and could be caused either
by photoinhibition ( damage of some RCII) or the presence of sustained photoprotective
NPQ. The second illumination cycle revealed three very important features of NPQ
( summarized in Figure 9.15 ):
1. the amount of ΔpH-triggered qN is much higher in the presence of zeaxanthin reaching
70% that corresponds to NPQ ~2.3. Hence, the power of NPQ in the presence of zeax-
anthin rose by more than three times;
2. the quenching was almost 100% reversible, indicating that the amount of qI was much
lower compared to that induced in the first illumination cycle;
3. it formed much faster (but relaxed much slower) than in the first illumination cycle.
The three described features of the NPQ behaviour during the second illumination cycle
suggest that NPQ only partially depends upon zeaxanthin but is greatly enhanced in its
presence. In addition in this experiment qI was largely dependent upon zeaxanthin-related
NPQ component implying its rather photoprotective and not photoinhibitory nature. Further
investigation of zeaxanthin-dependent qI revealed that it consists of two components, one is
Figure 9.15 Maximum fluorescence levels in the dark (Fm) and after 5 min illumination (∆pH) with violaxanthin or zeaxanthin (Fm ’ ). Zeaxanthin slowed down the dark recovery of Fm ’ (for details see the Figure 9.14 legend).
Rupan_c09.indd 220 8/29/2012 5:35:26 PM
Adaptations of the Photosynthetic Membrane to Light 221
sensitive to uncouplers and the other is not. Simultaneous measurements of Δ pH and NPQ
revealed that the uncoupler-sensitive component of zeaxanthin-dependent qI persists for
relatively long periods in darkness and is not associated with the bulk Δ pH. Therefore, a
new aspect of photoprotective quenching in the antenna was revealed: namely that the lon-
gevity of the photoprotective state in the darkness could vary depending upon zeaxanthin
concentration and pre-illumination history. The modulation of qI by zeaxanthin led to the
possibility that it may originate from the same site and the same process that underlies qE.
It was found, for example, that conditions promoting the zeaxanthin-dependent qI compo-
nent caused a concomitant decrease in qE, as if qE was in fact becoming less and less
reversible. This idea is consistent with the observed acceleration of NPQ formation coupled
to strong deceleration of its recovery induced by the presence of zeaxanthin. An extreme of
such behaviour of NPQ when it became gradually totally irreversible even after addition of
an uncoupler, was discovered in a diatom alga Phaeodactylum and also in plants exposed to
high light and low temperature conditions. Summarizing the observations on the irreversible
in the dark component of NPQ we can conclude that its nature is complex and it consists at
least of the following sum: qI + qZ + qH + , where qI is a photoinhibition-related component;
qZ is the zeaxanthin-dependent and ΔpH-independent component and qH + is the uncoupler-
sensitive component promoted by the presence of zeaxanthin.
Observations of the relationship between NPQ and the xanthophyll cycle activity
described here found some explanations in the biochemical and spectroscopic studies on
PSII light harvesting antenna described in Chapters 6–8. This work revealed that all
xanthophyll cycle carotenoids of PSII are associated with LHCII antenna. Almost all of
them are bound to the major LHCII complex peripheral site V1. Their affinity of binding to
this site is much lower than in the rest of xanthophylls, therefore they are easily accessible
for the enzymes of the xanthophyll cycle. Most strikingly, in vitro fluorescence quenching
experiments on isolated LHCII showed very strong amplification effect of zeaxanthin
(Figure 8.20, Chapter 8). pH titrations of the quenching induced in isolated LHCII and the
ΔpH titration profiles of qE in isolated chloroplasts in the presence of violaxanthin or zeax-
anthin revealed similarities. Figure 9.16 shows these pH-dependencies. In both, isolated
LHCII and chloroplasts zeaxanthin affected the quenching in such a way that it became
more responsive/sensitive to acidification. Whilst with violaxanthin pK for protonation was
within 5.5 for the both, in vivo and in vitro experiments, zeaxanthin shifted it to 6.5–6.8 by
>1 pH unit. This is a remarkable manifestation of a control of NPQ by the xanthophyll cycle.
The mechanism of this control is based upon the alteration of LHCII antenna sensitivity to
the lumen protons. Interestingly, in the absence of zeaxanthin under somewhat low lumen
pH conditions the amount of nonphotochemical quenching becomes very similar to that in
the presence of zeaxanthin. This indicates that zeaxanthin is not indispensable for NPQ.
There are two specific features in the pH dependency of the quenching in vivo . First, is that
the xanthophyll cycle seems to have stronger effect here in comparison to that on isolated
LHCII. Indeed, the + Vio and + Zea titration curves are further apart for chloroplasts in
comparison to those of LHCII. Second, for in vivo case the shape of titration curves with
violaxanthin and with zeaxanthin differs. For violaxanthin-containing chloroplasts the shape
is sigmoidal , whereas for zeaxanthin-containing chloroplasts it is rather hyperbolic . This
Rupan_c09.indd 221 8/29/2012 5:35:26 PM
222 The Photosynthetic Membrane
behaviour is indicative of the presence of allosteric control in the activation of qE. Similar
effect was also observed on isolated LHCII complexes but to a lesser extent. pH titration
experiments enabled Horton and coworkers (Ruban and Horton, 1999 ) to suggest that the
xanthophyll cycle plays a regulatory role in qE with zeaxanthin acting upon LHCII as an
allosteric activator, not a direct chlorophyll excitation quencher, by making the complex more
sensitive to pH, in other words promoting the proton-antenna association constant, pK. Later,
the model suggesting the molecular mechanism underlying this effect on the level of the single
LHCII monomer will be presented. The allosteric model of qE explained reduced levels of
quenching observed in dark-adapted leaves ( up-arrow , Figure 9.16 ) and enhanced levels of qE
in the second illumination cycle and, most importantly, much slower recovery of the quenching
in the presence of zeaxanthin. Indeed, as indicated in Figure 9.16 , in the darkness followed by
the second illumination cycle ( down-arrow ) zeaxanthin-enhanced antenna sensitivity to
protons would inevitably lead to the reduction in recovery rate since qE would still be present
at relatively high levels of lumen pH. The differences in lumen pH sensitivity of the photo-
synthetic antenna during and after illumination caused by the xanthophyll cycle activity
manifest a hysteresis in PSII adaptation to high light. Hysteresis provides a mechanistic base
for the photosynthetic membrane memory to illumination. In low light, the amount of zeaxan-
thin will be very low making NPQ not very sensitive to ΔpH. Brief exposure to a moderately
high light will induce qE of somewhat low amplitude. The levels of photoprotection and tran-
sient PSII yield decline will be low. The light harvesting antenna will be geared for efficient
collection of light photons and PSII yield will be high on average. Increase in the ambient light
4
Chloroplasts
Flu
ores
cenc
e qu
ench
ing
Chloroplasts
LHCII
+Zea
+Vio
65
pH
7
Figure 9.16 Effect of the xanthophyll cycle carotenoids on the nonphotochemical quenching pH-titration curves. Solid lines : NPQ in vivo, lumen pH was estimated using the 9-aminoacrydine method. Arrows indicate the relationships between NPQ and lumen pH at the conditions of dark-adapted state with violaxanthin (up arrow) and after induction of zeaxanthin formation (down arrow). Dashed lines : pH titrations of fluorescence quenching in isolated LHCII trimers.
Rupan_c09.indd 222 8/29/2012 5:35:27 PM
Adaptations of the Photosynthetic Membrane to Light 223
intensity, frequency and duration of exposure would cause gradual accumulation of zeaxan-
thin. The photosynthetic antenna would gradually become sensitized to light, the levels of
attained NPQ would become higher and the quenching recovery in the low light would become
slower. This would lead to conditioning of the photosynthetic membrane to a photoprotective
mode that would manifest in more frequent and even sustained accumulation of nonphoto-
chemical quenchers in light harvesting antenna leading to the decline in the PSII yield. The
hysteresis in PSII is therefore a way to economically harvest light and enable the most efficient
and safe photosynthesis in chloroplast membranes. In addition, temporal separation of the
trigger (ΔpH) effect and the change in antenna that produces qE makes the membrane response
to light smooth, avoiding frequent dramatic alterations in the electron transport rates and
generation of NADPH and ATP. Indeed, as far as the light is not of a dangerous intensity and
duration it is being efficiently used by PSII with its effective antenna. When the light begins
to threaten the reaction centres, the antenna becomes gradually inefficient, damping the excess
energy. Zeaxanthin accumulation puts the PSII antenna more on alert, ready to collapse into
the photoprotective state with high light exposure, which in turn lowers the PSII efficiency and
slows down the photosynthetic rates. However, the safety seems to be of a paramount impor-
tance for the photosynthetic membrane and the productivity is being firmly traded for it.
9.4.2.3 The Role of PsbS Protein in qE
Apart from the light harvesting complexes, a 22 kDa protein with four very hydrophobic
transmembrane helixes, called PsbS, was discovered to have a dramatic effect on qE. The
group of Niyogi isolated the mutants lacking this protein and found that they possessed
no rapidly-forming or relaxing NPQ: qE. The protein does not bind pigments and there-
fore is not likely to play a direct role in the photoprotective process. It was established
that PsbS possesses the two lumen-exposed glutamate residues which are essential in sens-
ing luminal protons. When the two glutamate residues on PsbS were mutated in
Arabidopsis plants ability to form qE was lost. Hence it was proposed that the protein
plays a role of a transducer of the trigger’s (ΔpH) action upon the antenna. This is a likely
scenario since PsbS was not found to be associated with the PSII supercomplex but rather
freely redistributed in the photosynthetic membrane. PsbS enhances qE even in the
absence of zeaxanthin and unlike the latter accelerates NPQ recovery. Hence, the action
of this protein is rather of a catalytic character: enhancing the dynamic range of NPQ,
basically, a qE-maker . Investigation of the structure of the PSII membranes by the freeze-
fracture microscopy combined with FRAP microscopy and detergent solubilization tech-
niques revealed a few specific effects of PsbS. Several striking features have been
discovered as a result of these studies. Firstly, PsbS affected the rigidity of the grana
membrane, its resistance to detergent solubilization and could accelerate the grana stacking
process induced by magnesium cations. Secondly, the absence of PsbS greatly enhanced
the occurrence of ordered semicrystalline arrays (see Figures 3.1 g, 7.1, 7.9) of PSII com-
plexes. Figure 9.17 (a) shows nearly two times enhancement of the occurrence of the
ordered PSII arrays in plants lacking PsbS. In the plants overexpressing the protein these
arrays were totally absent. Finally, PsbS decreased protein mobility in the grana
membranes as was first detected by Mullineaux and coworkers (Goral et al ., 2011) using
Rupan_c09.indd 223 8/29/2012 5:35:27 PM
224 The Photosynthetic Membrane
the FRAP microscopy. Figure 9.17 (b) shows that the percentage of mobile protein in the
membrane in the dark for the mutant lacking PsbS was decreased, consistent with
the occurrence of semicrystalline arrays of PSII that are likely to enhance the membrane
rigidity. FPAP experiments also revealed that the onset of NPQ was followed by a strong
decrease in the protein mobility. The difference in this mobility between dark-adapted
and illuminated membranes with NPQ was the highest in plants overexpressing PsbS and
the lowest in those lacking the protein (Figure 9.17 ). These observations indicated an
existence of a structural change in the membrane that leads to the establishment of the
Figure 9.17 (a) Percentage of the membrane area occupied by the ordered PSII arrays in the grana, detected by freeze-fracture electron microscopy in the wild-type and PsbS-less (npq4) Arabidopsis plants. (b) Percentage of the mobile chlorophyll-protein fraction in the grana membranes of dark-adapted (D) and pre-illuminated to form NPQ (L) intact Arabidopsis chloroplasts. Courtesy of Tomasz Goral and Conrad Mullineaux.
(a)
(b)
Rupan_c09.indd 224 8/29/2012 5:35:27 PM
Adaptations of the Photosynthetic Membrane to Light 225
photoprotective state and a crucial role of PsbS in enabling this change as if the protein
acted as a ‘lubricator’ allowing PSII complexes to rearrange. It is, however, still not clear
why PsbS exerts this effect upon the protein mobility and whether its involvement in the
proposed structural change in the photosynthetic membrane is more specific than an
entropy-driven diffusion process.
9.4.2.4 The Role of LHCII Antenna Dynamics in qE: The Model of qE-Related Structural Changes within the Photosynthetic Membrane
The presence of a strong quenching in LHCII complexes upon their aggregation triggered
by low detergent concentration and low pH, modulation of this quenching and the aggrega-
tion process by the xanthophyll cycle carotenoids and sensitivity to activators (tertiary
amines, magnesium) and inhibitors (antimycin, cross-linkers) of qE suggested that its
mechanism involves aggregation of LHCII in vivo . In addition, qE was found to be accom-
panied by the changes in absorption, resonance Raman and fluorescence spectra that occur
during LHCII aggregation. Horton and Ruban ( 1992 ) proposed the LHCII aggregation
hypothesis for the control of light harvesting in the photosynthetic membrane of chloroplasts.
The ‘LHCII aggregation model’ shown in Figure 9.18 consists of the four different states
LHCII
Deepoxydation
Pro
tona
tion
Hypothesis
IV
II
III
heat
heat
heat
heat
I
Violaxanthin
Zeaxanthin
Figure 9.18 The LHCII aggregation model for NPQ. According to the Horton and Ruban ( 1992 ) model there are four different structural/functional states in the LHCII antenna, I, II, III and IV. I corresponds to dark-adapted, violaxanthin-containing unquenched state. Illumination causes violaxanthin de-epoxidation and protonation of LHCII, both driving the system into the deeply quenched state IV by promoting LHCII aggregation. Violaxanthin inhibits LHCII aggregation. If zeaxanthin is not formed LHCII will be only partially aggregated and quenched (III). After qE relaxation the antenna will still contain zeaxanthin and therefore remains partially aggregated and quenched (II), since it takes much longer for the epoxidation of zeaxanthin back into violaxanthin than for the relaxation of Δ pH. All four states therefore have different degrees of heat dissipation proportional to the degree of aggregation.
Rupan_c09.indd 225 8/29/2012 5:35:27 PM
226 The Photosynthetic Membrane
of the LHCII antenna. The state I corresponds to a dark-adapted violaxanthin- containing
unquenched antenna. Illumination causes violaxanthin de-epoxidation and protonation of
the LHCII protein(s), both driving the system into the deeply quenched state IV by promot-
ing LHCII aggregation. Violaxanthin inhibits LHCII aggregation. If zeaxanthin is not formed
LHCII will be only partially aggregated and quenched (III). After qE relaxation the antenna
will still contain zeaxanthin and therefore remains partially aggregated and quenched (II),
since it takes much longer for the epoxidation of zeaxanthin back into violaxanthin than for
the relaxation of Δ pH. All four states therefore have different degrees of heat dissipation
roughly proportional to the degree of aggregation. Interestingly, the well-known small
absorption change at 535 nm associated with qE was found to originate from a red-shifted
zeaxanthin and violaxanthin. This shift takes place when the xanthophylls form J-type or
head-to-tail aggregates and can only take place during the promotion of interactions
between LHCII units: an aggregation process. Therefore the measurement of absorption
around 535 nm represents an only alternative to fluorescence method for monitoring the
establishment of the photoprotective state in the grana membrane.
The aggregation model of qE was not only consistent with many physiological, spectro-
scopic and biochemical observations but also explained the origins of zeaxanthin-dependent
qI components, the kinetic behaviour of qE, and the role of zeaxanthin as an allosteric
modulator of qE. The control of the sensitivity of qE to Δ pH by the xanthophyll cycle is a
process of great significance since in high light it allows qE formation at subsaturating levels
of Δ pH, which simultaneously allow high electron transfer rates, while in low light qE
is switched-off at levels of Δ pH which are still sufficient for ATP synthesis. Indirect estimates
of Δ pH in vivo suggest that the steady state levels of Δ pH are relatively low, explaining the
low levels of qE observed in the absence of zeaxanthin in vivo . Another important aspect of
the LHCII aggregation model is that it remains the only model that explains large variations
in NPQ levels observed among various plants and algae, since the fluorescence of LHCII
during the aggregation process, can be quenched up to 20 times. Therefore, the LHCII antenna
was proposed to possess an inherent property for the control of excitation energy density in
the photosynthetic membrane and for the fine regulation of qE sensitivity to the Δ pH.
The phenomenon of LHCII antenna aggregation in the photosynthetic membrane goes
beyond the qE mechanism. Formation of large aggregates of LHCII has been documented
in overwintering evergreen plants as a result of their long-term adaptation (acclimation) to
cold and high light. The process was followed by the appearance of a long wavelength
fluorescence characteristic of aggregated LHCII around 700 nm registered at 77 K (see
Chapter 8). LHCII aggregation has also been observed in plants grown under a CO 2 starva-
tion regime and with delayed senescence. The phenomenon of antenna protein aggregation
in the photosynthetic membrane seems to be of a universal regulatory significance and its
primary studies laid the foundation for various structural and spectroscopic studies deter-
mined to underpin the dynamics of the photosynthetic membrane landscape and its role in
the regulation of the light phase of photosynthesis.
Although the LHCII aggregation model has been supported by various experiments
discussed above it is only recently that the process of structural reorganization of PSII
Rupan_c09.indd 226 8/29/2012 5:35:28 PM
Adaptations of the Photosynthetic Membrane to Light 227
antenna has been visualized using electron microscopy approaches. It has been known
for a long time that the organization and lateral redistribution of photosynthetic com-
plexes in the thylakoid membrane depend upon cations. Magnesium is particularly cru-
cial for stabilization of grana stacking and the lateral segregation of PSI from PSII, as
well as the assembly of PSII–LHCII supercomplexes. Upon illumination formation of
Δ pH leads to neutralization of point charges on the lumen-exposed surface of the thyla-
koid membrane, resulting in displacement of bound magnesium cations and their diffu-
sion into the stromal space. Barber ( 1982 ) suggested that the alteration in charge
distribution brought about by Δ pH formation could cause alteration in the lateral interac-
tions and aggregation state of thylakoid membrane proteins. Holzwarth’s group
(Miloslavina, 2008) provided indirect spectroscopic evidence suggesting that upon for-
mation of qE part of the major LHCII undergoes separation from the PSII supercomplex
and aggregation. Bassi (Bassi et al ., 2009) obtained biochemical evidence suggesting
that the dissociation of a part of the PSII–LHCII supercomplex containing LHCII, CP24
and CP29 complexes occurred under NPQ conditions. Bassi’s group also found struc-
tural evidence using biochemistry and negative stain electron microscopy of isolated
thylakoid membranes that the distance between PSII core complexes decreased under
NPQ conditions in detergent solubilized grana membranes, implying that the onset of the
photoprotection involved a reorganization of the PSII antenna. Ruban ’s group obtained
ultimate structural evidence based upon freeze-fracture electron microscopy of intact
chloroplasts displaying clustering of PSII core units as well as LHCII antenna aggrega-
tion upon qE formation (Johnson et al ., 2011 ). Figure 9.19 shows the LHCII patterning
in the photosynthetic membrane based upon the analysis of the freeze-fracture electron
microscopy image using the image-processing software. The onset of the proton gradient
and violaxanthin de-expoxidation caused gradual change in LHCII coordinates so that
the particles formed progressively enlarging clusters: evidence of aggregation. The men-
tioned structural findings provided direct support of the hypothesis proposing LHCII
aggregation as a process underlying NPQ, and that Δ pH and de-epoxydation of violaxan-
thin to zeaxanthin cooperatively drives it. Moreover, the data shown in Figure 9.19 sup-
port the idea that qE and zeaxanthin-dependent qI have a common nature, LHCII
aggregation. Crucially, the structural alterations observed by Ruban’s group (Johnson et al ., 2011 ) induced by illumination occurred on a timescale consistent with the formation
and relaxation of qE. These data therefore provide the first direct link between the struc-
tural changes in PSII antenna and qE in intact, unsolubilized thylakoid membranes. The
observed clustering of LHCII complexes in the membrane is consistent with the FRAP
microscopy that revealed significant decrease in the protein mobility as shown in
Figure 9.17 . Indeed, clustering/aggregation of proteins cause formation of large areas
where protein mobility is almost absent as it is in the case of formation of ordered sem-
icrystalline arrays of PSII (see Figure 9.17 ).
The remarkable consistency between biochemical, structural and fluorescence micros-
copy experiments enabled Ruban and co-workers (Johnson et al ., 2011) to produce a
model presented in Figure 9.20 that summarizes all mentioned experiments regarding
the change in PSII–LHCII macro-organization underlying qE. In the qE state part of the
Rupan_c09.indd 227 8/29/2012 5:35:28 PM
228 The Photosynthetic Membrane
PSII–LHCII supercomplex containing more loosely-bound trimers (L and M) and minor
antenna complexes CP24 and CP29 is dissociated, a phenomenon that relies upon the
presence of PsbS. This reorganization leads to the aggregation and partial special segre-
gation of LHCII from PSII. Unfortunately the resolution of the freeze-fracture work
precludes specifically assign the exact redistribution of each mentioned LHCII complex
or indeed PsbS to be known with certainty. This will remain a subject for the future
structural research using novel microscopy approaches. Zeaxanthin’s role in the qE
model is to promote the LHCII aggregation, as followed from the microscopy results
shown on Figure 9.19 . The higher aggregation state, the harder would be to return PSII
antenna system back to the light harvesting mode, hence the deceleration effect of zeax-
anthin upon the NPQ recovery kinetics. On the contrary, according to the model, PsbS
protein as an enhancer of fluidity should promote both, the formation and recovery of the
structural change underlying qE thus explaining its different from zeaxanthin effect upon
the process.
Experiment
VioLHCII
I
Zea
II
Vio + ΔpH
III
Zea+ΔpH
IV
Figure 9.19 Patterning of LHCII particles in the photosynthetic membrane determined by freeze-fracture electron microscopy (each LHCII trimer was fitted with a 50 nm 2 circle using image recognition software and their positions are presented in the figure), the four states of organization were observed in dark-adapted chloroplasts (Dark Vio, analogous to state I in the LHCII aggregation model), chloroplasts frozen immediately after 5 min illumination at 350 μmol photons m −2 s −1 in the absence of zeaxanthin (Light Vio, analogous to state III), chloroplasts frozen immediately after 5 min illumination at 350 μmol photons m −2 s −1 in the presence of zeaxanthin (Light Zea, analogous to state IV) and chloroplasts frozen following 5 min illumination at 350 μmol photons m −2 s −1 in the presence of zeaxanthin and a further 5 min dark adaptation (Dark Zea, analogous to state II). Reprinted from Ruban et al . © 2012, with permission from Elsevier.
Rupan_c09.indd 228 8/29/2012 5:35:28 PM
Adaptations of the Photosynthetic Membrane to Light 229
9.4.2.5 The Molecular Basis of qE Regulation
The changes in the lateral LHCII distribution were found to be accompanied by significant
conformational alterations, the thylakoid membrane became thinner. Figure 9.21 (a) shows
thin section negative stain electron microscopy of stacks of chloroplast grana membranes
where PSII is localized. The four micrographs correspond to the four states in the aggrega-
tion model of qE. Proton gradient as well as zeaxanthin will cause a significant decrease in
the membrane thickness as well as the space between stacked thylakoids. These observa-
tions are consistent with the model proposed by Packer (Murakami and Packer, 1970 ) of
the photosynthetic membrane response to the establishment of ΔpH. Figure 9.21 (b) illus-
trates this model. The flux of protons into lumen causes the countercurrent of magnesium
cations into the stromal compartment to balance the charge brought by protons. Membrane
components undergo dehydration and conformational changes in response to the proton
flux. The membrane loses water and becomes more hydrophobic and thinner. These
changes were found to be reversible and remarkably followed not ΔpH but rather NPQ
kinetics. This observation suggested a strong relationship between the changes in mem-
brane geometry and NPQ. Since LHCII is the major component of the grana membrane and
De-epoxidation
Dark / low light Excess light
Δ pH
PSII minor antenna
LHCII trimer
PSII core
Zeaxanthin
Violaxanthin
LHCII aggregate(quenched)
Figure 9.20 Scheme depicting the current knowledge regarding the structural reorganization of the PSII–LHCII macrostructure occurring in the NPQ state. Dissociation of the part of light harvesting antenna from PSII supercomplex leads to the reorganization and aggregation of LHCII complexes. Reproduced with permission from Johnson et al . © 2011 American Society of Plant Biologists. (See Plate 9.20 in colour plate section.)
Rupan_c09.indd 229 8/29/2012 5:35:28 PM
230 The Photosynthetic Membrane
undergoes significant later rearrangements as shown earlier, the observed changes in the
membrane shown in Figure 9.21 are likely to involve enhancement in the antenna hydro-
phobicity. The synthesis of a most hydrophobic xanthophyll, zeaxanthin, resulting from
ΔpH formation further promotes this change. In addition, the LHCII aggregation process
itself enhances the average hydrophobicity of the protein.
In addition to the enhanced hydrophobicity of the grana membrane by protons and zeax-
anthin the role of PsbS as a cofactor of qE was further confirmed by the experiments that
used diaminodurene (DAD) and phenazine metasulfate (PMS) to enhance Δ pH across the
membrane in plants lacking this protein. Remarkably, these agents induced the rapidly-
forming and relaxing NPQ in the npq4 mutant. The pK of qE in the absence of PsbS (but
with zeaxanthin) was ~4.5 in comparison to 6.5 in the wild-type. It became clear that PsbS
simply is an efficient enhancer of antenna sensitivity to protons. The fact that qE can be
(a)
I
III IV
II
Figure 9.21 (a) The grana membrane ultrastructure studied by the thin section negative staining electron microscopy corresponding to the four states of the NPQ model shown in Figure 9.18 : I: dark + violaxanthin; II: dark + zeaxanthin; III: light + violaxanthin; IV: light + zeaxanthin intact spinach chloroplasts. Chloroplasts were fixed by glutaraldehyde and embedded in resin. Ultrathin-sections (~70 nm thickness) were cut and stained with uranyl acetate.
Rupan_c09.indd 230 8/29/2012 5:35:29 PM
Adaptations of the Photosynthetic Membrane to Light 231
obtained without PsbS suggests that the quenching process itself is independent of this
protein. Altered PSII–LHCII organization present in plants lacking PsbS (discovered in the
studies described in the previous paragraph) somehow shifts the Δ pH versus qE titration
curve to a lower pK, increasing the cooperativity of the process. Thus in the absence of
PsbS a larger Δ pH driving force (i.e. a more acidic lumen) is required to trigger the
reorganization of the PSII–LHCII macro-structure associated with qE (as discussed in the
previous paragraph). qE cannot be observed in npq4 plants simply because of the relatively
low levels of Δ pH that occur in natural conditions (pK of ~5.5–5.8).
But what is the mechanism of the effect of xanthophylls’ hydrophobicity and PsbS upon
the affinity of the LHCII structure for protons? The answer lies in the fact that apparent
pKa of amino acids strongly depends upon their environment. Hydrogen bonding, steric
Figure 9.21 (cont’d) (b) The model of the ∆pH effect on the photosynthetic membrane geometry and properties. Adapted from Murakami and Packer.© 1970 American Society of Plant Biologists.
(b)
Conformationalchanges
H2O
RH
Dehydration
130 – 135 Å
100 – 110 Å
Mg2+
H+H+
Outside(stroma)
Inside(lumen)
Increasedhydrophobicity
Decreasedthickness
Rupan_c09.indd 231 8/29/2012 5:35:32 PM
232 The Photosynthetic Membrane
hindrance and the dielectric constant of the environment all affect the pKa of amino acids.
For example, the pKa of the carboxyl group on aspartate can be as low as 2.4, in water
environment due to hydrogen bonding, while in hydrophobic environment the pKa can be
as high as 6.4. The shift of qE sensitivity to Δ pH in the presence of hydrophobic xantho-
phylls such as zeaxanthin and hydrophobic proteins such as PsbS can be explained in this
way. The proximity of numerous acidic amino acid residues on the lumenal side of LHCII
(and CP29, see Chapter 6) to the xanthophyll binding domains provides a possible explana-
tion of the ability of xanthophylls to influence their pKa. Indeed, zeaxanthin binding shifts
the isoelectric point of CP26 to higher values. The careful regulation of the qE versus Δ pH
titration curve by xanthophyll de-epoxidation and PsbS is essential to maximize the
efficiency of photosynthesis (Figure 9.22 ). Since, the experimentally determined pKa of
the lumenal side of the thylakoid membrane is as low as 4.1, factors such as PsbS and
zeaxanthin which raise the pKa will allow efficient qE at lower values of Δ pH than
would otherwise be required but impossible to attain in vivo . The scheme presented in
Figure 9.23 explains the role of zeaxanthin and PsbS in qE by regulation of the sensitiv-
ity of the LHCII system to protons. Without zeaxanthin and PsbS the pK for LHCII
protonation is very low (~4.0) and therefore the complex(es) remain(s) unprotonated and
qE is absent. The isoelectric point of PsbS is much higher than that of LHCII at ~6.0 thus
the protein responds to even low levels of Δ pH. Protonation of PsbS is known to promote
Z V
Physiological lumen pH~5.5–5.8
Z+PsbS V+PsbS
LHC
II reorganisation
Lumen pH
80.8
0.6
0.4
0.2
qE
0.00 1 2
Δ pH
3 4 5
7 6 5 4 3
Figure 9.22 ∆pH titrations of qE in intact Arabidopsis chloroplasts containing veaxanthin and PsbS (Z + Psbs), violaxanrthin and PsbS (V + PsbS), lacking PsbS but containing zeaxanthin (Z) and lacking PsbS and containing violaxanthin (V). The average lumen pH in vivo is marked by a dashed arrow.
Rupan_c09.indd 232 8/29/2012 5:35:32 PM
Adaptations of the Photosynthetic Membrane to Light 233
the observed reorganization of the PSII–LHCII macrostructure in excess light leading to
LHCII aggregation and this in turn may increase the pK for LHCII protonation by
making the complex more hydrophobic when it aggregates.
The pK for the activation of the violaxanthin de-epoxidase is ~6.0 and the formation of
zeaxanthin then further promotes LHCII aggregation such that the pK is further shifted up
to ~5.7–6.2 allowing protonation at moderate levels of Δ pH thus amplifying qE. Hence,
hydrophobicity and aggregation (reorganization) of the PSII antenna are mutually enhancing
processes favouring the establishment of its quenching conformation. As was demonstrated
in Chapter 8, aggregation of LHCII complexes is not obligatory requirement for the
induction of quenching in vitro .
Hence, the nonphotochemical quenching originates from the individual complexes by
formation of the quenching pigments within the LHCII structure. This means that the
observed in vivo cooperative nature of qE in the absence of zeaxanthin and/or PsbS arises
from the tendency of the protonated LHCII conformation to aggregate. As LHCII begins to
aggregate so the hydrophobicity of the structure and thus affinity for protons increases, thus
proton binding is cooperative. By promoting aggregation zeaxanthin and PsbS thus reduce
the cooperativity of the proton binding equilibrium.
Tuning the photoprotective response is ecologically important, since different light envi-
ronments require different light-tracking strategies within a light harvesting system. LHCII
with more hydrophilic xanthophylls and faster NPQ recovery would be more desirable at
very frequent but low amplitude fluctuations of light intensity. On the contrary, LHCII
carrying hydrophobic xanthophylls with the tendency for NPQ with slow recovery would
LHCII
LHCII
H+
qE
Hydrophobicity Aggregation
PsbSVDE
4.0 6.06.0
>6.0
Figure 9.23 Scheme explaining the effect of PsbS and xanthophyll cycle on the pKa of qE-active residues in LHCII. The pKa of LHCII is ~4.0, too low for qE activation by physiological lumen pH values 5.5–5.8, however PsbS and violaxanthin de-epoxidase have a pKa of ~6.0 and thus bind protons, together they trigger the aggregation of LHCII increasing the hydrophobicity of the environment of the qE-active residues and shifting the pKa to ~6.0 thus activating qE at physiological lumen pH values. Reprinted from Ruban et al . © 2012, with permission from Elsevier.
Rupan_c09.indd 233 8/29/2012 5:35:33 PM
234 The Photosynthetic Membrane
be better suited to slower but stronger fluctuations in light environment. The xanthophyll
cycle fulfils the LHCII tuning role in vivo .
9.4.2.6 Formation and Identity of qE Quencher(s)
We have so far discussed the site and change in the PSII membranes associated with the
establishment of Δ pH and qE state. The change is apparently important to study in order to
understand, first of all, the principles of qE regulation as a basis for the light management
by plants on the molecular level. It became apparent that aggregation of LHCII antenna in
the membrane is an important process, largely thermodynamically driven, that is essential
for maintaining the fine balance between antenna efficiency and photoprotection. This
regulation ensures optimal electron transfer regime in PSII and hence productivity of the
light phase of photosynthesis. Another important aspect of nonphotochemical quenching is
what are the events in the individual protonated LHCII antenna complexes that lead to
quencher formation on the atomic scale? In other words, the question of what is the qE
quencher and how it is ‘born’ in the antenna as a result of protonation followed by the
antenna rearrangements and aggregation remains to be discussed.
Unfortunately, the full atomic picture of changes in protein that create the quencher is
not available yet. The structure of a quenching state of LHCII exists (see Chapter 8),
however, no structure is available of LHCII in highly fluorescent, unquenched state or, at
least, the one with the bound zeaxanthin instead of violaxanthin. There are a few lines of
evidence that revealed some structural alterations within individual LHCII complexes
associated with the onset of NPQ. First, is that cross-linkers were found to inhibit the
process in vitro as well as in vivo (see previously and also Chapter 8). These reagents bind
to various aminoacids of protein, interlinking them within the structure that causes liter-
ally ‘freezing’ it in a particular structural state. Second, the high hydrostatic pressure was
discovered to promote the quenching in isolated LHCII that is likely due to an effect on
the protein. Thirdly, thermodynamic studies of the quenching formation in LHCII in vitro
and qE yielded energy parameters (activation energy, etc., see Chapter 8) indicative of
protein dynamics on the energy scale that corresponds to a several hydrogen bonds.
Fourthly, resonance Raman spectroscopy revealed a specific conformational change in
neoxanthin that reflects some structural alterations within the protein during the onset of
quenching in vitro and in vivo .
The quencher identity was researched by various spectroscopies of isolated LHCII
dynamics. Only a few specific features associated with both, quenching in isolated LHCII
and qE have been revealed. Both types of quenching were characterized by the appearance
of the red-shifted Chl a band(s) absorbing above 680 nm and a decline in absorption of a
several bands belonging to xanthophylls. Time-resolved fluorescence spectroscopy revealed
that qE and quenched state of LHCII are both characterized by red-shifted room tempera-
ture fluorescence components. Based on the spectral changes described it was proposed that
the qE quencher originates via the promotion of pigment–pigment interactions within the
LHCII complex. Homo- or heterodimers of chlorophyll have been proposed to be involved
in the quenching. Indeed, chlorophyll associates, permanent or transient, were known to
Rupan_c09.indd 234 8/29/2012 5:35:33 PM
Adaptations of the Photosynthetic Membrane to Light 235
possess very low fluorescence yield and similar spectroscopic features to those observed in
aggregates of LHCII (see Chapter 5). The concentration-type of quenching that the LHCII
design was evolved to conquer emerged at NPQ state, when the protein structure was altered
by protonation. Figure 8.2 of Chapter 8 shows the configuration of Chl a610–612 in the
terminal emitter locus – likely candidates for the proposed quenching Chl–Chl associations.
There are a few other chlorophyll dimers that can be found in the LHCII structure that may
well represent the qE quencher. The mechanism of quenching in chlorophyll dimers can be
of a charge transfer character since the quenching in vivo and in vitro is associated with the
red-shifted fluorescence with a strong temperature dependency discussed above and in
Chapter 8. At the moment, the theoretical work is being carried out to find out if chlorophyll
associates can be accounted for the quenching in LHCII.
Apart from chlorophylls, the excitation energy can be taken and quickly dissipated
from the terminal emitter by xanthophylls. The physical mechanism of xanthophyll
action as excitation quenchers in LHCII antenna was proposed to involve S 1 (2Ag)
state. The S 1 possesses an extremely short lifetime (~10 ps) likely due to the crossing
of its potential energy surface with that of the ground state (at a so called conical inter-
section). The short lifetime and close proximity of the S1 state energy to that of the
lowest excited state of chlorophyll in the Qy band arguably makes xanthophylls ‘natu-
ral born quenchers’. However, the S 1 state has the same spatial symmetry as the ground
(S 0 or 1Ag) and, in accordance with the selection rules for electronic transitions, is
dipole-forbidden resulting in the absence of the absorption. This complicates the
energy transfer relations with chlorophyll and remains a challenging subject for exper-
imental and theoretical studies. However, excitonic coupling of xanthophylls to chlo-
rophylls have been detected that was correlated with qE quenching. Excitonic coupling
is realized between two pigments when the exciton transfer integral coupling the two
molecules (a measure of the energy interaction between the electronic transitions of
the two molecules) is much greater than the dephasing energy (a measure of the inter-
action between a molecule and its environment). Two pigment molecules are said to be
excitonically coupled if excitation energy can be coherently transferred between them.
The molecular dimer then behaves as a single quantum mechanical entity and the exci-
tation is delocalized across both molecules. In principle, such excitonic interactions
could result in low-lying states that possess more carotenoid than chlorophyll character
showing enhanced coupling to the ground state, thus making them efficient quenchers.
It is possible however that a distortion of the xanthophyll brought about during quench-
ing could allow direct excitation of S 1 by removing the symmetry restriction that makes
the state forbidden.
Currently there are two models proposed involvement of xanthophylls in NPQ. The first
model is based upon the structural dynamics of the minor LHCII complex, CP29. It
suggests that zeaxanthin converted from violaxanthin at lutein 2 site of CP29 complex
forms a quenching association with the two chlorophylls, a 603 and b 609 (Figure 9.24 a).
Similar scenario was proposed to take place in the other minor antenna complexes, CP24
and CP26. When two molecules are excitonically coupled the lowest lying excited states
mix resulting in two delocalized excitonic states and additionally two charge transfer states
Rupan_c09.indd 235 8/29/2012 5:35:33 PM
236 The Photosynthetic Membrane
which correspond to the hole (the positive part of the exciton) and the electron being local-
ized to individual molecules within the dimer. For a homodimer, that is, one for which the
individual molecular excited states have very similar excitation energies these charge trans-
fer states lie above the excitonic states. Conversely a heterodimer composed of molecules
with very different excitation energies the charge transfer states generally lie below the
excitonic states. Under certain circumstances it is energetically favourable for the charge
transfer state to dissociate via charge separation into an anion and a cation. The hole and
electron that make up the exciton are no longer bound together and the exciton is destroyed,
charge recombination between the anion and cation follows and the energy is dissipated as
heat. A xanthophyll radical cation signal with a rise time of ~11 ps, attributed to zeaxanthin,
was detected in the qE state upon chlorophyll excitation by Fleming and coworkers (Holt
(a)
CP29–V + H+= (CP29–Z – H+)
Z
b609
a603
LHCll–V/Z + H+= (LHCll–V/Z–H+)
a610
a611
a612Lut1
Neo
(b)
Figure 9.24 Atomic structure level models of possible NPQ sites. (a) The minor LHCII quenching model propose that protonation of the PSII minor antenna complexes leads to a conformational change leading to formation of a xanthophyll–chlorophyll quenching interaction between zeaxanthin bound at the lutein 621 site and chlorophylls a603 and b609. (b) The major LHCII quenching model propose that protonation of LHCII leads to a conformational change causing a quenching interaction between the lutein bound at the lutein 620 site and chlorophylls of the terminal emitter, a610–a612. Neoxanthin distortion is a spectroscopic signature of this conformational change.
Rupan_c09.indd 236 8/29/2012 5:35:33 PM
Adaptations of the Photosynthetic Membrane to Light 237
et al ., 2005 ) using transient absorption spectroscopy (for the method details see Chapter 8).
The same zeaxanthin cation signal was observed in isolated PSII minor antenna complexes
and was shown to be dependent in the case of CP29 on the presence of chlorophylls a603
and b609 in close proximity to the xanthophyll bound into lutein 621 site (Figure 9.24 a). It
was thus suggested that the charge transfer state forms by delocalization of the electron
across the two chlorophylls. Recently, lutein cations have also been detected in the PSII
minor antenna proteins and these have been suggested to play a role in quenching, particu-
larly under circumstances when zeaxanthin is absent.
The second model of xanthophyll involvement in qE is based upon the major LHCII (but
does not principally exclude the minor antenna) (Figure 9.24 b). The model proposes small
conformational alteration within the monomeric unit of the complex that causes twist in
the neoxanthin molecule (shown by the bent hollow arrow) and simultaneous (cooperative)
movement of lutein bound to L1 site (shown by three straight arrows). Since this lutein is
very closely located to the terminal emitter locus containing Chl a 610–612 it is proposed
that protonation that causes the change in the protein structure brings lutein close enough
to these pigments (almost at the van der Waals contact) to act as the terminal emitter chlo-
rophyll excited state quencher. Transient absorption studies on LHCII aggregates performed
by van Grondelle’s group (Ruban et al ., 2007 ) also revealed the transient population of a
xanthophyll S 1 state upon chlorophyll excitation (see Chapter 8). The position of the S
0 –S
2
bleach in the TA kinetics indicated that the species involved was lutein 620 (Lutein 1)
rather than zeaxanthin which was absent from the prepared complexes. According to the
model shown in Figure 9.24 (b) the conformational switch in LHCII structure opens a
channel for energy transfer from chlorophyll to the lutein S 1 state. Such a mechanism
would invoke incoherent coupling between the states for which the coupling between
molecules is much weaker than the coupling of each molecule to its local environment (the
opposite limit to excitonic interactions). Transfer of energy between them is thus said to
occur ‘incoherently’, hopping from one to another while at any time being localized on a
single molecule, the short lifetime of the xanthophyll S1 state in this case making it an
efficient quencher. Förster ( 1948 ) classically described incoherent energy transfer between
dipole-allowed states, via interactions between the transition dipole moments of each
molecule. By this logic, Förster transfer to the forbidden xanthophyll S 1 state cannot occur.
Generalized Förster theory, however, which takes into account the size of the molecule
does permit transfer to and from forbidden states. Alternatively there is the exchange inter-
action-mediated Dexter mechanism that describes the incoherent transfer of energy
between two molecules whose electronic orbitals closely overlap, allowing electron
exchange (see Chapter 5).
Discussions about the exact photophysical origins of the quencher thus remain the sub-
ject of great debate in the NPQ field. New approaches in quantum mechanical modelling of
the excited states of carotenoids and chlorophylls should provide new insights in the future
into the complex interactions of these molecules. While, new experimental techniques such
as femtosecond stimulated Raman spectroscopy may reveal new details of the fates of
excitation energy in quenched systems.
Rupan_c09.indd 237 8/29/2012 5:35:34 PM
238 The Photosynthetic Membrane
9.4.3 Future of qE Research
Four key elements of qE: trigger , site , change and quencher were defined and discussed
here in their connection with dynamics and regulation of this process. It must be said that
there exist several important points in qE research to be addressed in order to build a
complete picture of the mechanism of this outstanding, intriguing, complex and long
investigated process. Among them are the following: is there a specific complex respon-
sible for qE or can the process take place in all LHCII complexes, major and minor?
Could genetic manipulation approaches help to solve this question? Is there only one qE
quencher or several? What is (are) the precise photophysical mechanism(s) of quench-
ing? How effective is the qE process in the photoprotection of photosystem II and for the
crops in general? Is the work on mutations in antenna pigments and proteins feasible for
the use in agriculture? In our view, the answers to these questions may not be as clear cut
as one desires. For instance, while qE appears to be a single process that is regulated in a
rather complex way, one cannot exclude that the quenching process itself may originate
from a nonspecific environmental effect that is felt by all pigments. The fact that
the quenching can exist in both, minor and major antenna complexes, and the evidence
implicating different sets of pigments in quenching is consistent with such a view.
The future development of new mechanistic approaches and further integration of the
disciplines of biology, chemistry and physics could shed light upon these and other
important questions related to the one of the most remarkable mechanisms of photo-
protection and regulation of the light phase of photosynthesis.
References
Allen , J.F. and Forsberg , J. ( 2001 ) Molecular recognition in thylakoid structure and function . Trends in Plant Sci. , 6 , 317 – 326 .
Barber , J. ( 1982 ) Influence of surface charges on thylakoid structure and function , Ann.Rev. Plant Physiol ., 33 , 261 – 295 .
Demmig-Adams , B. ( 1990 ) Carotenoids and photoprotection: a role for the xanthophyll zeaxanthin , Biochim. Biophys. Acta , 1020 , 1 – 24 .
Hager , A. ( 1966 ) DieZusammenhange zwischen lichtinduzierten xanthophyll-umwandlungen und Hill-reaktion . Ber. Dtsch. Bot. Ges. , 79 , 94 – 107 .
Holt , N.E. , Zigmantas , D. , Valkunas , L. et al . ( 2005 ) Carotenoid cation formation and the regulation of photosynthetic light harvesting . Science , 307 , 433 – 436.
Horton , P. and Ruban , A.V. ( 1992 ) Regulation of photosystem II . Photosynth. Res. , 34 , 375 – 385 . Horton , P. , Ruban , A.V. and Walters , R.G. ( 1996 ) Regulation of light harvesting in green plants .
Annu. Rev. Plant Physiol. Plant Mol. Biol. , 47 , 655 – 684 . Johnson , M.P. , Goral , T.K. , Duffy , C.D.P. et al . ( 2011 ) Photoprotective energy dissipation involves
the reorganization of photosystem II light harvesting complexes in the grana membranes of higher plant chloroplasts . Plant Cell , 23 , 1468 – 1479 .
Kouril , R. , Zygadlo , A. , Arteni , A.A. et al . ( 2005 ) Structural characterization of a complex of photo-system I and lightharvesting complex II of Arabidopsis thaliana . Biochemistry , 44 , 10935 – 10940 .
Miloslavina , Y. , Wehner , A. , Lambrev , P.H. et al . ( 2008 ) Far-red fluorescence: a direct spectroscopic marker for LHCII oligomer formation in non-photochemical quenching . FEBS Lett. , 582 , 3625 – 3631 .
Rupan_c09.indd 238 8/29/2012 5:35:34 PM
Adaptations of the Photosynthetic Membrane to Light 239
Murakami , S. and Packer , L. ( 1970 ) Light-induced changes in the conformation and configuration of the thylakoid membrane of Ulva and Porphyra chloroplasts in vivo . Plant Physiol. , 45 , 289 – 299 .
Ruban , A.V. , Berera , R. , Ilioaia , C. et al . ( 2007 ) Identification of a mechanism of photoprotective energy dissipation in higher plants . Nature , 450 , 575 – 578 .
Ruban A.V. ( 2009 ) Plants in light . CIB , 2 , 1 – 6 . Ruban , A.V. and Horton , P. ( 1999 ) The xanthophyll cycle modulates the kinetics of nonphotochemical
energy dissipation in isolated light harvesting complexes, intact chloroplasts and leaves . Plant Physiol. , 119 , 531 – 542 .
Ruban , A.V. and Johnson , M.P. ( 2009 ) Dynamics of the photosystems cross-section associated with the state transitions in higher plants . Photosynthesis Research , 99 , 173 – 183 .
Ruban , A.V. , Johnson , M.P. and Duffy , D.D.P. ( 2012 ) Photoprotective molecular switch in photo-system II . Biochim. Biophys. Acta , 1817 , 167 – 181 .
Ruban , A.V. , Solovieva , S. , Lee , P.J. et al . ( 2006 ) Plasticity in the composition of the light harvesting antenna of higher plants preserves structural integrity and biological function . J. Biol. Chem. , 281 , 14981 – 14990 .
Sapozhnikov , T.A. , Kransovskaya , A.N. and Maevskaya , A.N. ( 1957 ) Change in the interrelationship of the basic carotenoids of the plastids of green leaves under the action of light . Dokl. Acad. Nauk USSR , 113 , 465 – 467 .
Yamamoto , H.Y. and Nakayama , T.O.M. and Chichester , C.O. ( 1962 ) Studies on the light and dark interconversions of leaf xanthophylls , Arch. Biochem. Biophys. , 97 , 168 – 173 .
Bibliography
Ahn , T.K. , Avenson , T.J. , Ballottari , M. et al . ( 2008 ) Architecture of a charge-transfer state regulating light harvesting in a plant antenna protein . Science , 320 , 794 – 797 .
Anderson , J.M. , Chow , W.S. and Park , Y.I. ( 1995 ) The grand design of photosynthesis: Acclimation of the photosynthetic apparatus to environmental cues . Photosynth. Res. , 46 , 129 – 139 .
Anderson , J.M. , Chow , W.S. and Goodchild , D.J. ( 1988 ) Thylakoid membrane organisation in sun/shade acclimation . Aust. J. Plant Physiol. , 15 , 11 – 26 .
Barber , J. ( 1995 ) Molecular-basis of the vulnerability of photosystem-II to damage by light , Aust. J. Plant Physiol. , 22 , 201 – 208 .
Betterle , N. , Ballottari , M. , Zorzan , S. et al . ( 2009 ) Light-induced dissociation of an antenna het-ero-oligomer is needed for non-photochemical quenching induction . J. Biol. Chem. , 284 , 15255 – 15266 .
Förster , T. ( 1948 ) Zwischenmolekulare Energiewanderung und Fluoreszenz , Ann. Phys. , 437 , 55 – 75 . Gilmore , A.M. , Matsubara , S. , Ball , M.C. et al . ( 2003 ) Excitation energy flow at 77 K in the photo-
synthetic apparatus of overwintering evergreens . Plant Cell Environ. , 26 , 1021 – 1034 . Ilioaia , C. , Johnson , M. , Horton , P. and Ruban , A.V. ( 2008 ) Induction of efficient energy dissipation
in the isolated light harvesting complex of photosystem II in the absence of protein aggregation . J. Biol. Chem. , 283 , 29505 – 29512 .
Jahns , P. and Krause , G.H. ( 1994 ) Xanthophyll cycle and energy-dependent fluorescence quenching in leaves from pea plants grown under intermittent light . Planta , 192 , 176 – 182 .
Johnson , M.P. and Ruban , A.V. ( 2010 ) Arabidopsis plants lacking PsbS protein possess photoprotec-tive energy dissipation . Plant J. , 61 , 283 – 289 .
Kloppstech , K. ( 1997 ) Light regulation of photosynthetic genes . Physiologia Plantarum , 100 , 739 – 747 . Koller , D. ( 1990 ) Light-driven leaf movements . Plant Cell Environ. , 13 , 615 – 632 . Kramer , D.M. , Sacksteder , C.A. and Cruz , J.A. ( 1999 ) How acidic is the lumen? Photosynth. Res. ,
60 , 151 – 163 . Li , X.P. , Björkman , O. , Shih , C. et al . ( 2000 ) A pigment-binding protein essential for regulation of
photosynthetic light harvesting . Nature , 403 , 391 – 395 .
Rupan_c09.indd 239 8/29/2012 5:35:34 PM
240 The Photosynthetic Membrane
Li , X.P. , Muller-Moule , M. , Gilmore , A.M. and Niyogi , K.K. ( 2002 ) PsbS-dependent enhancement of feedback de-excitation protects photosystem II from photoinhibition . Proc. Natl. Acad. Sci. U.S.A. , 99 , 15222 – 15227 .
Mehler , E.L. , Fuxreiter , M. , Simon , I. and Garcia-Moreno , E.B. ( 2002 ) The role of hydrophobic micro-environments in modulating pKa shifts in proteins . Proteins Struc. Funct. Genet. , 48 , 283 – 292 .
Melis , A. ( 1991 ) Dynamics of photosynthetic membrane-composition and function . Biochimica Et Biophysica Acta , 1058 , 87 – 106 .
Noctor , G. , Ruban , A.V. and Horton , P. ( 1993 ) Modulation of Δ pH-dependent nonphotochemical quenching of chlorophyll fluorescence in spinach-chloroplasts . Biochim. Biophys. Acta , 1183 , 339 – 344 .
Oh , M.-H. , Moon , Y.-H. and Lee , C.-H. ( 2003 ) Increased stability of LHCII by aggregate formation during dark-induced leaf senescence in the Arabidopsis mutant, ore10 . Plant Cell Physiol. , 44 , 1368 – 1377 .
Oquist , G. and Huner , N.P.A. ( 2003 ) Photosynthesis of overwintering evergreen plants . Annu. Rev. Plant Biol. , 54 , 329 – 355 .
Powles , S.B. ( 1984 ) Photoinhibition of photosynthesis induced by visible-light . Ann. Rev.Plant Physiol. Plant Mol. Biol ., 35 , 15 – 44 .
Ruban , A.V. and Horton , P. ( 1995 ) An investigation of the sustained component of nonphotochemical quenching of chlorophyll fluorescence in isolated chloroplasts and leaves of spinach , Plant Physiol. , 108 , 721 – 726 .
Ruban , A.V. and Johnson , M.P. ( 2010 ) Xanthophylls as modulators of membrane protein function , Arch. Biochem. Biophys. , 504 , 78 – 85 .
Ruban , A.V. , Lavaud , J. , Rousseau , B. , et al . ( 2004 ) The super-excess energy dissipation in diatom algae: comparative analysis with higher plants , Photosynth. Res. , 82 , 165 – 175 .
Ruban , A.V. , Young , A. and Horton , P. ( 1994 ) Modulation of chlorophyll fluorescence quenching in isolated light-harvesting complex of photosystem-II . Biochim. Biophys. Acta , 1186 , 123 – 127 .
Ruban , A.V. , Young , A. , Pascal , A. and Horton , P. ( 1994 ) The effects of illumination on the xantho-phyll composition of the photosystem II light harvesting complexes of Spinach thylakoid membranes . Plant Physiol. , 104 , 227 – 234 .
Tikkanen , M. and Aro , E.-M. ( 2012 ) Thylakoid protein phosphorylation in dynamic regulation of photosystem II in higher plants . Biochim. Biophys. Acta , 1817 , 232 – 238 .
Siffel , P. and Vacha , F. ( 1998 ) Aggregation of the light-harvesting complex in intact leaves of tobacco plants stressed by CO2 deficit , Photochem. Photobiol. , 67 , 304 – 311 .
Weis , E. and Berry J.E. ( 1987 ) Quantum efficiency of Photosystem-II in relation to energy-dependent quenching of chlorophyll fluorescence . Biochim. Biophys. Acta , 894 , 198 – 208 .
Rupan_c09.indd 240 8/29/2012 5:35:34 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
Numberless noisy weathercocks rattled and sang of mutation . from Evangerline: a tale of Acadie, Henry W. Longfellow
10.1 Science and Society
The relationship between science and society has always been uneasy. Academic science
first emerged in Europe under the wing of religious institutions promoted by their spiritual
and cultural desires. Natural science appeared later, when the society realized its sheer
potential to enrich and empower. However, the thirst of man for knowledge is a rather
ancient instinct if not evolutionary. One can argue that the ‘wonder’ reflex has been
developed to an advantage of survival, aiding exploration and proliferation of humans in
the natural environment and shaping the emerging ability for abstract thinking. The
reaching for knowledge is therefore an important inherent and objective attribute of human
life for the individual as well as societal. In a way, this attribute is as rightful and objective
as religion having an institutional status of the human nature. Society despised science and
scientists in times when it felt in danger of them and cheered and supported research
activities when it wanted to exploit their results in medicine, architecture, warfare,
agriculture and other spheres of its life. Society witnessed great power of science in
industrial revolution, militarization and cure of diseases. Fruits of science, therefore,
altered the face of human history and likely to alter the face of the whole evolution of our
Biosphere. The relationship between science and society is a crucial determinant of man-
kind’s fate. One of the major reasons why it became possible for our planet to sustain an
What is in it for Plant, Biosphere and Mankind?
10
Rupan_c10.indd 241 8/29/2012 5:34:52 PM
242 The Photosynthetic Membrane
enormous population growth is science. The reason for a great technological progress is a
progress in natural sciences. The latter, in turn, relies upon the former and the willingness
of society to support certain research areas for its benefits. It feels as if the science is an
eternal flame, an inexhaustible carrier of energy and society is a manager of this energy as
well as its customer. The progress in the particle physics would not be the same if not
driven be the defence purposes of society. The Large Hadron Collider would not have been
built if there was no visible practical outcome expected from it. Science owes society for
the possibility to carry on research otherwise unthinkable. The modern science became a
part of various industries, collective, dependent, directed: more organized and civilized
than in the times of inquisition. The opportunities in research for many are great and the
challenges are unprecedented.
The major problems society wants natural sciences to address in modern days are
health , food , peace and climate . The sequence in which these four are listed reflects per-
haps the order of their importance for society. Naturally, medical sciences are champions
in fundraising. Food and defence research follows. The investment in understanding the
environmental changes seems to be less crucial; however, it may well turn out to be the
most important priority of all. The understanding of the impact of man on the environment
and its consequences is not straight-forward and full of controversies. Hence, the research
support is needed. The society acts, however, as a very busy manager, trying to solve
‘burning’ issues (health, etc.) leaving others for later, perhaps when they themselves
become ‘burning’. However, whilst the average health of mankind is such that its popula-
tion is on a steep rise, the global character of environmental changes has a chance to lead
to its dramatic decline and death of our civilization. Some argue that the observed global
warming is a process caused by man. A solid fundamental research is needed to predict
the rate and consequences of this process and, most importantly, avert its detrimental for
the all life on our planet effect. If man is responsible it is also our moral duty to safe the
richness and beauty of the world we live in. Hence, the promotion by society of basic
natural sciences could be of enormous help, provided society will allow that. In the sci-
ence of photosynthesis and, in particular, Sun energy capture, one could see a great power
that could be used to save the planet Earth’s Biosphere and teach the future generations to
live in harmony with it.
10.2 Energy Balance of Photosynthesis: A Wasteful Process?
Photosynthesis is by far the major process that supplies energy to Biosphere. Hence, it is
the major source for battling entropy and sustaining life on Earth (see the Chapter 1). Life
simply cannot exist without the input of energy and with it and adequate environmental
conditions it can be fairly autonomic, evolving for millions of years, learning ways to adopt
and proliferate in space. The events in the photosynthetic membrane relate only to the light
phase of the process (see Figure 3.7, Chapter 3) ending with the synthesis of ATP and
NADPH. The dark phase uses their energy to produce glucose. The whole process of pho-
tosynthesis is a remarkable cascade of energy transformation reactions that deals with a
Rupan_c10.indd 242 8/29/2012 5:34:52 PM
What is in it for Plant, Biosphere and Mankind? 243
range of types of matter: photons , electrons , protons , molecules (see Figure 1.1, Chapter 1).
Hence the energy losses are inevitable and could be large. It is important, however, to point
out that some of the losses are avoidable and some are not necessarily unwelcome. The
following paragraphs will analyse each type of loss, explaining their nature and potential
variability. The question of energy balance seems to be a major question related to the
importance of photosynthesis for the mankind and the Biosphere.
In order to assess the light energy utilization efficiency by nature it is of advantage to
show its whole path from the Sun to glucose , the final product of photosynthesis. The
efficiency of the photochemical process of CO 2 assimilation is limited due to the losses on
the way of transformation of the energy of redox-reactions in the photosynthetic membrane
in to the chemical energy stored in glucose. The losses are around 68% as highlighted by
the grey band on the light energy efficiency diagram depicted on the Figure 10.1 . These
losses can be assessed as following. A minimum eight photons of the energy matching the
absorption of PSII and PSI reaction centres (680 and 700 nm) are required to fix one mol-
ecule of CO 2 . To fix six molecules of CO
2 in order to build one molecule of glucose,
C 6 H
12 O
6 (see Equation 1.2, Chapter 1), it would take for photosynthesis 48 such photons:
24 with the energy of 176 kJ mol −1 (680 nm) and 24 with 182 kJ mol −1 (700 nm) totalling the
energy of 8592 kJ mol −1 . However, 1 Mol of glucose stores only 2801 kJ of energy. Therefore,
the efficiency of the photochemical synthesis of glucose in the process of photosynthesis is
about 32%. Hence the inevitable losses of energy storage in the process of photosynthesis
as we know it are about 68% (Figure 10.1 ). These losses cannot be reduced unless someone
could improve Nature itself and come up with a better photochemical system possessing
higher efficiency.
However, out of 100 000 TW of available solar energy, only about 100 TW are stored in
Biosphere by photosynthesis. This means that the efficiency of the process in nature is 0.1%,
that is to say, some 300 times lower than the calculated efficiency of the photochemical
synthesis of glucose. Why is that? Why photosynthesis is such a wasteful process in the
‘real life’? Why nature did not invent a better one? Contemplating on this point makes one
realize that life’s ‘ambitions’ to concur the space and adapt to various conditions could also
do with having better, more efficient ways of gaining energy from the environment. Instead,
life in the Biosphere became rather extremely diverse then economic, with complex rela-
tionships between its different forms. Interestingly, mankind often tended to trend this
diversity for efficiency and power, as well as the rate of development. This led first to the
huge economic boom within the recent 100 years resulting now in approaching energy and
environmental crises.
Let us consider some other factors that undermine so greatly the efficiency of photosyn-
thesis. Figure 10.1 represents the light energy losses in the photosynthetic membrane, plant
as well as in the environment (atmosphere). The arrowed horizontal lines highlight the
levels of energy remaining after a certain type of loss has occurred. The vertical arrows
show their approximate variation ranges. The line above the photosynthetic CO 2 assimila-
tion losses of ~68% marks a relatively low level of energy on the energy bar on the right
with 0.28 fraction of the unity (highlighted by the thick grey line). The latter corresponds
Rupan_c10.indd 243 8/29/2012 5:34:52 PM
244 The Photosynthetic Membrane
to the level of light energy that enters the plant. This level itself is extremely variable and
is determined by the two types of factors that cause: (a) constant light losses due to the
absorption in the upper atmosphere and by gases and (b) variable light losses due to light
scattering in clouds and absorption by canopy. The (b) is variable because the transient
nature of the factors that cause them (see Chapter 9). Whilst the constant light losses in
atmosphere are about 20%, the variable losses could reach one or even two orders of
magnitude (dense canopy in the tropical forest, water absorption in aquatic photosynthesis,
etc.). The variable light losses greatly determine the evolution and diversity of not only
plants but all photosynthetic organisms, causing divergent and often independent
development of the photosynthetic light harvesting antennae as well as the mechanisms
that cope with the variable or even sudden high light exposure, like NPQ (Chapter 9).
Transient losses of light represent the environmental factor providing photosynthetic
organisms with physiological challenge that plants have to face. Clearly these losses should
inevitably affect the global energy storage in the Biosphere by various organisms having
variable share of 100 000 TW of light available from the Sun.
spectral availability
excitation energy delivery
electron/proton transportand CO2 assimilation
respiration processes,growth,etc.
constant lossestransient losses
clouds upper atmospheregasescanopy
~47%
1.00
0.70
0.37
0.28
0.090.05
~24%
~68%
~30%
~20%up to 99%
scattering in tissue/cell/chloroplast
Env
ironm
ent
Pla
nt
Str
oma
Ph
oto
syn
thet
ic m
emb
ran
e
Lig
ht
har
vest
ing
Figure 10.1 Light energy losses in the process of photosynthesis in Nature.
Rupan_c10.indd 244 8/29/2012 5:34:53 PM
What is in it for Plant, Biosphere and Mankind? 245
Light energy losses in the plant itself (below the thick grey line) start from the losses due
to light scattering in the photosynthetic tissues, in cells and chloroplasts themselves until
light reaches the photosynthetic membrane. These losses are approximately about 30%.
Next loss of light energy comes from the fact that the photons of different energy (colour)
are differently absorbed by the photosynthetic pigments (see Chapter 5). This means that for
plants mainly blue and red photons are photosynthetically competent or active. Hence, the
name of the spectrum of light used in photosynthesis: PAR or Photosynthetically Active Radiation . Figure 10.2 shows the Sun radiation spectrum near the surface of Earth and a
spectrum of PAR that could be actually used by plant (dotted line). Calculations show that
the fraction of PAR is about 53%, hence the loss in the photosynthetic efficiency is about
47% of the light available after scattering in tissue, and so on. There is not much room for
variations in the fraction of PAR in higher plants, however, the parameter varies among dif-
ferent photosynthetic organisms simply because the differences in their pigment types,
hence the absorption spectra of their photosynthetic membranes. The loss of 47% of this
energy level lowers the efficiency to the level of 0.37 (0.7 × 47%). From this point light
enters the light harvesting antenna. As was previously explained, the photosynthetic antenna
is a great evolutionary achievement of nature, enabling the existence and survival of the
photosynthetic organisms in very low light environment. It is because of antenna the PAR is
almost a half of the sunlight spectrum, not just a small fraction of it, since the antenna broad-
ens the absorption cross-section of the photosynthetic reaction centres. An interesting exam-
ple of the spectral broadening of photosynthetic cross-section was discussed in the Chapter
8 (Figure 8.12). In plants lacking the major polypeptides of the LHCII complex, CP26 minor
antenna complexes formed trimers, mimicking the oligomeric state of the native LHCII. The
formation of trimers shifted the absorption of one of the lutein molecules (Lut 621) to the
red by 15 nm. This apparently small change increased the spectral cross-section of the newly
built PSII antenna. Hence, the described oligomerization process of antenna proteins is
Figure 10.2 Spectra of available energy from the Sun near the surface of Earth (solid line) and typically utilized in photosynthesis of higher plants (dashed line).
Rupan_c10.indd 245 8/29/2012 5:34:53 PM
246 The Photosynthetic Membrane
essential for ensuring the interception of light of a broader spectral range. This contributes
little to the total cross-section of PSII reaction centre but globally, 5% of extra captured
energy would be ~5 TW of energy: the value corresponding to the combined US and EU
yearly energy demands. A small adjustment on the molecular nanoscale can easily have a
large impact on the scale of the entire Biosphere. Therefore, the knowledge of the funda-
mental principles of design and functioning of the photosynthetic membrane is crucial for
our understanding of the impact of plants and other photosynthetic organisms upon the life
on our planet.
The next loss of light energy occurs in the photosynthetic antenna after absorption of
PAR. This loss is due to the fact that although the antenna is tuned to have a broad spectral
cross-section, only energies that correspond to approximately 680 and 700 nm absorption
of PSII and PSI reaction centres can be utilized. Figure 5.18 in Chapter 5 clearly illustrates
this point and indicating Δ E as the energy loss incurred in a process of energy transfer in
the antenna first to the terminal emitter and then to the reaction centre . This loss in the
photosynthetic membrane is estimated to be around 24% (Figure 10.1 ) and is solely due to
the organization and types of photosynthetic pigments. The vertical arrow corresponding to
the variability of these losses points mainly downwards indicating that the 24% is a basic
minimum and can be significantly larger in certain cases. Chapter 9 described the phenom-
enon of saturation of energy trapping in PSII reaction centres due to the limited turnover
rate. It is well-known that such saturation can occur in many plants at relatively low light
intensities (~10% of the full sunlight), revealing the major cause of photosynthetic
inefficiency. The saturation light intensity can vary among plants by more than 20 times
and the variations in the electron transport rate via PSII can be as high as the one order of
magnitude. At the conditions when the absorbed energy by antenna cannot be used for
charge separation and electron transport it is eventually wasted as heat, that diminishes the
photosynthetic yield. The onset of NPQ in antenna helps to dispose of the unused energy
quicker, saving the photosynthetic membrane from the photodamage. The decrease in the
photosynthetic efficiency due to NPQ is transient, protective and therefore a positive event.
Nevertheless, NPQ and photoinhibition, both strongly diminish the average photosynthetic
efficiency.
Finally, additional energy losses occur during and after CO 2 assimilation stage of photo-
synthesis via loss of electrons into respiration processes and loss of glucose for growth,
transport and other energy requirements of plant life. These bring down the final figure of
light energy efficiency storage to well below 1%. As was shown earlier, this figure is rather
close to 0.1% globally.
Figure 10.1 clearly shows that by far the major losses of light energy in photosynthesis
occur in the process of light harvesting and charge separation: not all photons are being
suitable, some lost before absorption, others lost in the processes of transfer and trapping
and lots are absorbed but not used at all due to the saturation of electron transport. One can
argue that evolution made the antenna potentially very efficient, able to supply sufficient
energy to the photosynthetic machinery in deep shade, yet not capable of collecting of all
light photons at even moderate light intensities and forced to ‘waste’ energy via NPQ in
Rupan_c10.indd 246 8/29/2012 5:34:53 PM
What is in it for Plant, Biosphere and Mankind? 247
order to avoid photodamage. This protective measure results from the electron transport
saturation. The latter seems to be inevitable, since the ‘slowing down’ and accumulation
into the chemical form (glucose) of the captured light is the goal of photosynthesis that
satisfies the metabolic requirements of life on our planet (see Chapter 1). Photosynthetic
antenna can therefore be both, extremely efficient and inefficient and such flexibility offers
a potential for adaptations as well as its artificial manipulation.
10.3 Crops and Light Harvesting
Crops are the result of artificial selection by the mankind. The agenda was different here
than that of the natural selection, since the latter was aimed at survival of plants whilst the
former at survival of humans. As a result, crops are generally weaker organisms, reliant
upon fertilizers and pesticides. However, crops are constantly being pushed to produce
more. This requires, above all, energy that comes from light. Does light harvesting have to
be different in crops from that of wild plants? The Figure 10.1 scheme suggests that the
process inefficiency is not a limiting factor, if anything; it needs to be flexibly made very
inefficient to protect the photosynthetic membrane against damage. But the protection,
NPQ, will inevitably lead to decrease in efficiency, but safe, rather than one that is very
expensive to restore (photoinhibition). Unless electron transfer and carbon assimilation
rates are made faster the light harvesting improvement is not of a concern. Nature evolved
the antenna in order to enable the photosynthetic organisms to survive in environments
with very low light. Therefore, the light capture is effective enough to satisfy the require-
ments of electron transport and can indeed saturate it at relatively low light intensities.
Some plants like the fastest-growing Phyllostachys pubescens simply make use of very
large canopy (leaf index area of 8–12) that enables it to harvest almost all available light
(Figure 10.3 ). However, plants vary in the electron transport and reaction centre turnover
rates as was mentioned in the previous paragraph. The causes and regulation processes
involved are not very well understood. The alterations in stoichiometry of some electron
transport caries are one of the factors that affect the light saturation curves. How, for
example, the RCII turnover relates to the plant productivity is also not a simple question.
In theory, they should correlate but the type of this relationship depends on various
environmental and metabolic factors. Interestingly, faster turnover would accelerate the
earlier onset of photoinhibition, since it seems that the latter depends upon the number of
turns rather than light intensity per se .
The dynamic nature of NPQ regulation seems to be an important aspect of light harvesting
in crops. Indeed, it is not enough to have just large NPQ, but it is absolutely vital to make
sure that it closely tracks the light intensity fluctuations. Even for many crops growing in
the open field the intermittent shading within their tightly grown three-dimensional canopy
makes the light exposure very much agile. To track the fluctuations NPQ must be of a large
amplitude as well as rapid formation and recovery rate. As was discussed in Chapter 9,
zeaxanthin amplifies qE, a quickly-reversible part of NPQ, making it faster to form but
slower to recover. On the other hand, PsbS protein accelerates greatly both, the formation
Rupan_c10.indd 247 8/29/2012 5:34:53 PM
248 The Photosynthetic Membrane
and recovery of this process. Therefore, for crops enduring large and frequent (in a timescale
of seconds) fluctuations of light, high levels of zeaxanthin as well as PsbS protein would be of
benefit. In nature the levels of xanthophyll cycle carotenoids as well as PsbS protein can vary
by several times, suggesting that plants have an inherent potential to acclimate (long-term
adaptation) to the different light habitats by altering the composition of these key regulatory
molecules in the photosynthetic membrane. Hence, genetic manipulation of PsbS expression
as well as the genes of xanthophyll biosynthesis enzymes became a feasible strategy these days
in the pioneering work on the crop improvement programs worldwide.
An additional critical point of light harvesting regulation in crops is the efficiency of
NPQ in photoprotection. One has to assess how well plants are protected against
photoinhibition by quenching. The latter can be very fast to form and recover but not large
enough to offer effective protection. Or, the quenching can be too great, wasting a part of
excitation energy in the antenna that could have otherwise been used in photosynthesis. To
address the protective requirement in NPQ, the work on development of methodologies to
assess the process, establish long-term monitoring methodologies and manipulate it accord-
ingly is necessary. The strategies of light harvesting control for different types of crops are
individual and, for those growing in greenhouses are very different from those required for
growing outdoors. The main peculiarity of the greenhouse culture is the possibility to grow
under constant illumination. Since, as was discussed earlier in this chapter, even moderate
light intensity can saturate photosynthesis, one can potentially think of adjusting the growth
Figure 10.3 Phyllostachys pubescens , the efficient light harvester and one of the fastest growing plants. Kyoto Rakusai Bamboo Park.Courtesy of Kateryna Law. (See Plate 10.3 in colour plate section.)
Rupan_c10.indd 248 8/29/2012 5:34:54 PM
What is in it for Plant, Biosphere and Mankind? 249
light intensity to the level that is just enough to saturate electron transport, avoiding strong
photoinhibition and on the other hand having controlled levels of NPQ, just necessary to
dissipate the excess light, if any. In the perfect scenario, it would be desirable not to have
NPQ at all and have somewhat lower growth light, saving on the power in the greenhouse.
Moreover, the metabolic state of plants could vary during the day, stage of development,
and so on that would inevitably reflect in the light saturation requirement and NPQ itself.
Indeed, the rate of CO 2 assimilation would determine the rate of ATP and NADPH
consumption that in turn would affect the levels of reduction of the electron transport chain
and lumen acidification. The latter would control zeaxanthin and in the end the levels of
energy dissipation in antenna via NPQ. Therefore the development of a system of a feed-
back control that finely adjusts the light intensity in greenhouses to the needs of plants
avoiding unwanted saturation effects and wasteful excitation energy losses would be an
ultimate energy-saving measure for the new generation of agriculture.
The fundamental research on improvement of efficiency of energy utilization in
photosynthesis is important not only for yield of crops but for saving space on land and
saving the wild environment from the effects of agricultural activities. The great challenge
is that the ways photosynthesis processes and stages evolved make it very hard to manoeu-
vre their adjustments to bring about fast, effective and reliable crop improvement. One can
argue that instead of trying to find ways to enhance the photosynthetic efficiency, one can
try to manipulate regulation of photosynthesis in the context of plant development and
growth enlarging, for example, the volume of the photosynthetic machinery. Making more
room for it by expanding the total surface of the photosynthetic membrane and the carbon
assimilation machinery is one of the ways of exploring potential enhancement of crop productivity. Indeed, the well-developed canopy of bamboo could be one of the central
factors enabling its very fast growth rate (Figure 10.3 ). One has to explore the great advan-
tage of the nanoscale design of the photosynthetic membrane, remembering Feynmann’s
famous ‘plenty of room at the bottom’, mentioned in the Chapter 2. If not the efficiency of
the photosynthetic machinery, the scale of its design should be exploited to enhance the
productivity of the process. Naturally, there will be some limitations to overcome, arising
from the creation of strong light gradients within the cell, and so on.
10.4 Light Harvesting Principles for Future Applications: Liberation from Saturation Constraints
The principles of light harvesting antenna design come useful when the questions of the
use of alternative energy sources for the needs of mankind arise. The fundamental idea is
that mankind has to learn to live in harmony with the Biosphere. Instead of using the
polluting and anyway nearly exhausted products of the millions of years of photosynthe-
sis, fossil fuels, we must learn to use the most natural source of energy available for our
planet, the Sun. The whole Biosphere uses only a tiny fraction of the Sun’s energy as was
mentioned previously. This means that the problem of energy shortage did never appear
in it until the modern human civilization has evolved. Its progress pushes the boundaries
Rupan_c10.indd 249 8/29/2012 5:34:54 PM
250 The Photosynthetic Membrane
of the Biosphere, wiping out species, exhausting its resources and poisoning the environ-
ment. In the end, human activities start to undermine greatly the advantages of living in
the civilized world as we know it. Hence, the need to exist in harmony with the Biosphere
should be the first priority of the modern society. The solution of the energy question is
of paramount importance towards reaching this goal. One hundred thousand TW of avail-
able power from the Sun is an immense number. Currently, human beings use about 14
TW, more than 60% of which comes from burning fossil fuels. The maximum energy that
can be extracted from the other alternative sources like wind or tidal could only partially
satisfy the growing global demand for energy. Nuclear fission is another alternative, but
expensive, potentially dangerous, polluting and cannot be sustained for long, since the
resources of nuclear fuels are limited. Nuclear fusion is much more attractive and power-
ful potential source of energy, however, it is not clear whether the technology can be
practically developed at all.
Solar power is impressive. An hour of the global sunlight energy equals to the yearly
energy needs of the mankind. Solar panels with only 5% efficiency of energy conversion
covering the size of 10% of Sahara desert can produce ~20 TW energy, which again,
sufficient to satisfy the world energy demand. These figures suggest that solar power should
be seriously considered as the major source of energy for our civilization. Moreover, the
demand for energy grows quickly. In the recent 50 years it grew almost three times. The
share of electric power demand is about 60%. And light energy is relatively easy to convert
in the energy of moving electrons, as the nature in the form of photosynthesis has clearly
demonstrated. Indeed, photons interact with matter via electrons, charging them with
energy, that can cause electron removal from molecule and transfer elsewhere, initiating
what is basically an electric current process (see Chapters 3 and 5). In technological reality
common photovoltaic devices can be based upon the use of silica-based materials. They are
semiconductors, that is, materials that possess limited amount of charges that can form the
electric current. An essential parameter of a photovoltaic semiconductor is its band gap:
energy difference between the electrons based in the valence band and electrons that are
based in the conduction band and possessing much higher energy than the valence electrons.
The band gap for silica is 1.12 eV or ~1116 nm, a near infrared region of the solar spectrum
(Figure 10.4 ). Unfortunately this region is not at the maximum of the natural light spectrum
and can be strongly obscured by the water vapour absorption. The efficiency of silica-based
photovoltaic devices can practically reach 20% or slightly more.
Currently the solar energy industry is at the embryonic stage. The whole world consumes
only around 2 GW of Sun power, a tiny 0.01% of the total energy demand and 1/(2 × 10 8 )
fraction of freely available light energy. Why was the vast energy of the Sun not broadly
used and instead we chose fossil fuels: a chemically stored light energy via millions of
years of photosynthesis? The answer is that the science and engineering some 100 years
ago were nowhere near the levels they are now and therefore relatively cheap fossil fuels
were adopted for various energy requirements. Progress in chemistry and chemical
engineering in the nineteenth and twentieth centuries paved the way for mass manufacture
of various types of vehicles and heavy machinery that transformed the world we live in. In
addition, the domestic demands for water, heat and light have been greatly satisfied on a
Rupan_c10.indd 250 8/29/2012 5:34:55 PM
What is in it for Plant, Biosphere and Mankind? 251
colossal scale. At the beginning, nobody thought that the fossil fuels would run out.
Nowadays, it is a relatively accurately predicted reality.
The use of energy of light globally becomes unavoidable. Apart from being freely
available, it will continue to be available for some time, another several billions of years.
The consumption of light energy can be made absolutely non-polluting: an important factor
enabling our civilization to live in harmony with the Biosphere. There is plenty of light
energy available, much more than we would ever need. However, there are also disadvantages
in this form of energy. First of all, it has an intermittent nature: the Sun shines brightly
(when there are no clouds) only during a day. Hence, there is a need to transform and store
its energy in a different form, as photosynthesis does in the dark. It simply makes mole-
cules by fixing CO 2 . The chemical form of energy can be stored for a long time. Therefore,
the solar energy industry has to address the storage problem accordingly. Another challenge
is that any global enterprise, like mass-conversion of all industries for the new energy
carrier, is enormously expensive and time-consuming, particularly at the beginning and
when the traditional forms of energy are still available. Naturally, the old resists the change
brought about by the new. And finally, another disadvantage of using light is that in most
cases it is a very dilute form of energy. Yes, globally it is large, but practically, it requires
collection across the significant space. The evolution of photosynthesis invented the light
harvesting antenna to enable energy concentration within the membrane and for the
photochemical reaction centres. The emergence of antenna made it possible for organisms
to live in very shaded environments. Improving the light capturing efficiency in the solar
devices as well as their photoconversion efficiency could greatly enhance energy input, and
save space and resources.
The combination of fast progress in nanotechnologies with knowledge of the principles
of organization of photosynthetic light harvesting is a promising way to enhance the
efficiency and power of solar devices. An example of such technology can be the titanium
oxide-based photovoltaic devices coupled with a synthetic dyes absorbing infrared or
Wavelength, nm
500
Ligh
t int
ensi
ty O2
visible
Sun’s infrared region
H2O/O2
15001000 2000 2500 3000
H2O
Figure 10.4 Absorption of infrared sunlight by atmospheric water, oxygen and carbon dioxide.
Rupan_c10.indd 251 8/29/2012 5:34:55 PM
252 The Photosynthetic Membrane
visible light to overcome the relatively large band gap of titanium oxide (~3.2 eV corre-
sponding to 387 nm). In addition, this band gap can be tuned by the doping of the material
with various elements (N, Sn, Co, etc.) or/and applying various nanotechnologies. These
measures can result in tuning the absorption of the photovoltaic media to the maximum of
the visible light. An additional way to enhance and spectrally tune the photovoltaic media
could be the attachment of LHC antenna complexes. As was presented in Chapters 5–9, the
photosynthetic antenna possesses several remarkable features in its design that could be of
a great advantage in the creation of a new generation of photovoltaic nanostructured cells.
These advantages include a very high absorption cross-section, spectral tenability, relatively
good stability, small size and possibility to regulate the electronic excited energy levels by
tuning the excited state lifetime of the bound pigments. The potential to manipulate and
mutate the antenna protein offers a broad range of modifications of its properties, like
cross-section and attachment to semiconductors in various forms, like films, porous media
and quantum dots which can be largely free from the saturation effects that take place after
the light harvesting step in the chain of photosynthetic events (see Chapter 9). Light energy
collection principles of the natural antenna can also be utilized in the design of artificial
light harvesting media based upon highly absorbing pigments of, for example, the
porphyrin/chlorin family (for structures, see Chapter 5). Nature selected only a few organic
pigments to serve for light harvesting purposes. Hence, chemical modification and assem-
bly of these pigments into light harvesting antennae is the attractive strategy for the creation
of artificial photovoltaic systems. This strategy coupled with the research in nanomaterials
is an attractive future venue in creation of artificial solar energy systems. Chapters 3, 6 and
7 demonstrated the very complex hierarchy of photosynthetic membrane structures, in
particular light harvesting antennae. Indeed, the two-dimensional multisubunit assembly of
antenna around reaction centres is eventually compacted into the three-dimensional
organization of granae membranes carrying PSII. In addition, the arrangement of thylakoid
system within the chloroplast, chloroplasts within the cell and cells within the leaf tissue
create an optimized and regulated light capture process on the macroscopic level. Hence,
the nanoscale design of the photosynthetic antenna enables the most effective way of light
harvesting and, at the same time, photoprotection (see Chapter 9). Moreover, this design
ensures an impressive stability of the photosynthetic membrane made of vulnerable
molecules; lipids, pigments and proteins.
The use of light harvesting principles is not limited to the photovoltaic technologies. The
hydrogen production using solar energy and utilizing the mechanism of water splitting in
the photosystem II is another venue that is being intensively discussed and explored nowa-
days. Hydrogen is an ultimate pure form of energy in comparison to the carbon-based
fuels: the burning of hydrogen produces water as the final product. The efficiency of water
splitting by PSII driven by red light can reach 50%. Recent crystallographic advances ena-
bled researchers to describe the mechanism in very detail. One of the ways to utilize PSII
for the solar energy conversion into hydrogen would be to safely immobilize its complex
on the media that would preserve its vulnerable multisubunit structure. Again, novel devel-
opments in the materials sciences, particularly those researching new media for nanotech-
nologies are required to immobilize PSII for hydrogen production. As far as light harvesting
Rupan_c10.indd 252 8/29/2012 5:34:55 PM
What is in it for Plant, Biosphere and Mankind? 253
is concerned, LHCII is a natural complex feeding PSII with energy, therefore it can be
naturally integrated within the immobilized system. The antenna size can exceed 300 chlo-
rophylls per one reaction centre with efficiency at about 80%.
In addition to PSII, PSI complex can also be utilized for creation of hybrid solar cells.
Pioneering work on immobilization of PSI complexes on electrodes has already started to
emerge. Being more stable and more efficient than PSII, PSI is a promising complex to be
explored in solar technologies. Its antenna size is smaller than that of the PSI, however, it
has a docking site(s) for LHCII complex and therefore can be ‘equipped’ with the extra
antenna to maximize the power of the photon energy conversion into the energy of moving
electrons. It is important to mention that the photochemistry in the reaction centres of pho-
tosynthesis can also be used for creation of the new types of photosensors or bioindicators.
This venue of applications is not as well-publicized or investigated as the search for alter-
native energy. However, the photosensors or low-energy photo transformation devices
could be very useful in various aspects of our day-to-day life, such as assessing the pollu-
tions in the environment, testing water and food quality, powering various personal elec-
tronic gadgets we cannot live without in the modern society. Finally, the principles of light
energy harvesting and utilization may well become useful in medical applications and, who
knows, maybe in the future the human organism could be adopted to utilize the energy of
the Sun directly, a sci-fi scenario today but tomorrow’s reality? Taking into account the
ultimate ambition of the mankind to conquer the universe, light for space travel may be the
only source of available energy for all needs.
10.5 Effects of Changing Climate – The Onset of Disorder
Unfortunately, the approaching energy crisis is not the only global problem our
civilization has to address in this century. The levels of carbon dioxide in Earth’s
atmosphere have risen by ~28% in the last 300 years, by 17% in the last 100 years and by
~13% in the last 50 years. The progression is steepening up in a good correlation with the
increasing global manufacturing, population and energy demand. There is a little doubt
that mankind is involved in causing the CO 2 increase. Discovery and utilization of fossil
fuels, followed by industrial revolution and the arms race are to be blamed. Nearly
6 billion tons have been emitted into the atmosphere as a result of fossil fuel products
burning. Forecasts predict it will triple by the year 2050 due to the steeply increasing
human population and energy demand.
Despite being still very low (<0.04%), carbon dioxide concentration in the atmosphere
started to impact the global climate. The average global temperature has risen by ~0.6 °C in
the recent 250 years. The increase is believed to be due to mainly carbon dioxide. Figure 10.4
shows the infrared tail of the Sun’s spectrum depicting bands of atmospheric water, oxygen
and carbon dioxide absorption. The latter strongly absorbs in he region of the lowest energy
in the spectrum of Sun. Still, this absorption is trapping vast amount of light energy and
converting it all into heat, causing the global worming effect. Interestingly, that the amount
Rupan_c10.indd 253 8/29/2012 5:34:55 PM
254 The Photosynthetic Membrane
of carbon dioxide in the atmosphere is about 60 times lower than that of the gas dissolved
in the oceans. Global warming would gradually decrease the carbon dioxide solubility in
oceans and cause its release into the atmosphere, accelerating further the global warming
process. Accurate forecasting of the global warming is hard if not impossible since numer-
ous factors affect the process. The general trend, however, remains a great concern of
communities and the governments. The almost explosive on the geological scale global
warming can drastically affect the biosphere and the way we live in it.
Can our knowledge on the photosynthetic membrane be used to help combating or at least
predicting the impact of global warming? As far as the first measure is concerned, the
knowledge of the principles of photosynthesis in development of the alternative sources of
energy as described in the previous paragraph can help, since it would accelerate the aban-
donment of the use of the fossil fuels, hence stopping the further carbon dioxide emissions.
It would remain for us to address and solve the problem of removal of the already emitted
billions of tons of the gas from the atmosphere. This seems to be a titanic task. Recently,
various photocatalysts that reduce CO 2 to methane and other reduced forms of carbon have
been studied. The idea mimics photosynthesis on a simpler, photochemical level. If it works,
the problem of recycling of the carbon dioxide would be solved. Indeed, if we learn the
principles of recycling, so common in the Biosphere, we would embark on the path of living
in harmony with our planet, not disorder, that is detrimental to life. Additionally, our
Biosphere represents a relatively competent carbon carrier, binding nearly 2.6 times more of
this element than it is currently present in the atmosphere. Therefore, the global photosyn-
thesis could be, in theory capable, of doing the job provided that the climatic changes will
not be detrimental to its productivity. The global photosynthesis research in the future would
be very helpful if it addresses the impact of stress factors, such as light, drought and tem-
perature and their combinations on the productivity of the process. Indeed, the knowledge of
the photosynthetic membrane adaptations, described in the Chapter 9 and its broadening to
a multiple abiotic factors would be of a great help in predicting the effect of the global cli-
mate change on the biosphere. Crop sciences informed by this knowledge would enable to
create more resistant crops. Indeed, rapid environmental changes demand rapid measures, a
sign of the onset of a new geological era, the Anthropocene that many scientists have started
to talk about. The science of ocean photosynthesis will become increasingly relevant since
not only the global ocean carries vast amounts of carbon dioxide; it possesses great capacity
for CO 2 reduction. This is being limited by the deficit of iron and other vital for photosyn-
thesis microelements. Currently the aquatic photosynthetic productivity is about 50% of the
yield of land photosynthesis. Improvement of aquatic photosynthesis would also be of great
help for development of algal biodiesel technologies. Growing algae for fuel would not be
limited by space. In addition, it would be quicker and easier to create mutants that possess
high photosynthetic rates compared to land plants.
Bibliography
Barber , J. ( 2007 ) Biological Solar Energy . Phil. Trans. R. Soc. A , 365 , 1007 – 1023 . Blankenship , R. ( 2002 ) Molecular Mechanisms of Photosynthesis . London : Blackwell Science .
Rupan_c10.indd 254 8/29/2012 5:34:55 PM
What is in it for Plant, Biosphere and Mankind? 255
Boeker , E. and van Grondelle , R. ( 1999 ) Environmental Physics . Chichester : John Wiley & Sons, Ltd. Clayton , R.K. ( 1980 ) Photosynthesis. Physical Mechanisms and Chemical Patterns . Cambridge :
Cambridge University Press . Hall , D.O. and Rao , K.K. ( 1995 ) Photosynthesis . Cambridge : Cambridge University Press . Lewis , N.S. and Nocera , D.G. ( 2006 ) Powering the planet: chemical challenges in solar energy
utilization . Proc. Natl. Acad. Sci. U.S.A. , 103 , 15729 – 15735 . Moore , T.A. and Gust , D. ( 1989 ) Mimicking photosynthesis . Science , 244 , 35 – 41 . Murchie , E. and Horton , P. ( 2011 ) Manipulation of photoprotection to improve plant photosynthesis .
Plant Physiology , 155 , 86 – 92 . Murchie , E. , Pinto , M. and Horton , P. ( 2009 ) Agriculture and new challenges for photosynthesis
research . New Phytologist , 181 , 532 – 552 . Nocera , D.G. ( 2012 ) The artificial leaf . Acc. Chem. Res. , 45 , 767 – 776 . Qiu , G.X. , Shen , Y.K. , Li , D.Y. et al . ( 1992 ) Bamboo in sub-tropical eastern China , in: Primary
Productivity of Grass Ecosystems of the Tropics and Subtropics , S.P. Long et al . (eds). London : Chapman and Hall .
Ruban , A.V. , Duffy , C.D.P. and Johnson , M.P. ( 2011 ) Natural light harvesting: principles and environmental trends . Energy and Environmental Science , 4 , 1643 – 1650 .
Vernadsky , V.I. ( 1997 ) The Biosphere: Complete Annotated Edition . Heidelberg : Springer . Walker , D. ( 1992 ) Energy, Plant, Man , Brighton : Oxygraphics . Zhu , X.G. , Long , S.P. and Ort , D.R. ( 2010 ) Improving photosynthetic efficiency for greater yield .
Annual Review of Plant Biology , 61 , 235 – 261 .
Rupan_c10.indd 255 8/29/2012 5:34:55 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
‘… Will draw the thing as he sees it . For the God of things as they are!’
Rudyard Kipling
The aim of this book was to introduce the reader to the phenomenon of the photosynthetic membrane , the natural nanoscale world which evolved to provide life with its vital
component, energy. The ways in which this structure captures the fairly dilute energy of
light and adapts to its fluctuations were the focus of this text. One of the essential points the
author wanted to make is how the complexity and entropy of this biological system are
being conquered and exploited by the structure in the manner that is central for its chain of
functions: photon-exciton-electron-proton-chemical energy transformations. Despite the
fact that the photosynthetic membrane functions are primarily based upon the presence of
pigments, the central role of protein was explored, underlined and explained through the
examples of how it fulfils the accommodating, conducting and regulatory functions of
the photosynthetic light harvesting process. The outstanding principle that enables these
numerous sequential energy-transduction events is the self-regulation that is largely based
upon the grand structural design of the membrane.
The organization of light harvesting machinery in the two-dimensional space of the
membrane is an outstanding biological phenomenon that allows for a more organized and
controlled functioning of its numerous components. This is just one of the many ways in
which life conquers the inevitable entropy potential of the complexity of its components.
The membrane is well-compacted in the thylakoid system of chloroplasts so that the surface
area is greatly maximized and can be varied in response to the availability of light in the
environment. Amazingly, the world of the membrane is microscopic and yet its total surface
area within the chloroplast and leaf can be very large. The nanoscale organization provides
Conclusions
11
Rupan_c11.indd 257 8/29/2012 5:34:23 PM
258 The Photosynthetic Membrane
an environment with many different physicochemical properties to those of the macroscale.
It is of great advantage to have a modular organization of the membrane components,
specifically the light harvesting antennae. This organization enables the dynamics that
underlies its functions and adaptations, robustness and plasticity and most importantly the
autonomic control of its efficiency.
The photosynthetic membrane is built by a range of forces of which noncovalent ones
are of a great importance. They determine bilayer formation and integrity and membrane
protein secondary, tertiary and quaternary structures. The transient nature of these forces
enables the dynamics of the photosynthetic membrane components which manifest in lipid
and protein diffusion and conformational flexibility. Nanoscale life processes simply float
in an array of various non-covalent interactions, transient and yet very deterministic to the
point that they can accurately reproduce the ‘working’ structures of such vital molecules as
DNA and proteins. In the membrane these forces govern complex relationships between
various types of membrane proteins, stabilizing their macrostructural organization and lat-
eral distribution that are of paramount importance to the membrane functions. With amaz-
ing accuracy the proteins of the photosynthetic membrane handle tiny particles of matter:
photons, electrons and protons. These are millions of times smaller than the protein size
and yet being precisely directed throughout numerous membrane complexes, their
energy transformed and utilized for the creation of chemical bonds: a fundamental
realization of the accumulated negative entropy in the cell.
The most fundamental function of the photosynthetic membrane is to capture sunlight;
hence the most abundant components are the light harvesting pigment-protein complexes.
This book aimed to explain the evolutionary necessity for the emergence of a specialized
group of proteins that bind pigments in order to efficiently intercept photons and concen-
trate their energy into the photosynthetic reaction centre for the primary photochemical
transformation. Effective collection of light – light harvesting – is vitally important; it
significantly broadens plant habitats, allowing them to live in extremely shady environ-
ments. The organization of light harvesting antennae also ensures efficient control of the
excitation pressure that can be built up in high light. Therefore, one of the principles of
antenna organization is its flexibility that stems out of the existence of a feedback control
of its efficiency by the proton gradient. The latter signals a saturation of the energy
transformation events in the membrane and sends a message to antenna to reduce light
harvesting efficiency, so that part of the absorbed light energy can be safely dissipated as
heat. Therefore, fluctuations in light intensity, even on timescale of minutes, are dynamically
tracked within plant leaves without an obvious visible manifestation. It is only when
chlorophyll fluorescence is measured that the highly dynamic nature of the light harvesting
process is revealed. Owing to this the photosynthetic machinery of a leaf can remain intact,
with the pigments green and capable of light harvesting for many days and even months,
whilst isolated natural pigments are generally promptly bleached and damaged by exposure
to light. One of the central properties of the natural light harvesting process is that all
antenna pigments are bound to the protein. The protein serves as a conductor of pigment
functions. It binds them in specific places, determining the distances between them, their
mutual orientations, and their interactions with each other and the environment. The protein
Rupan_c11.indd 258 8/29/2012 5:34:24 PM
Conclusions 259
is therefore a ‘programmed solvent’ that is genetically predetermined and capable of
accommodating the pigments at very high concentration without compromising their
function. It also ensures that the pigments are well-protected against the various unwanted
consequences of excess light, like triplet states, singlet oxygen, radicals, and so on. The
antenna xanthophylls, secondary pigments, are vitally important in protection. However,
this is not the only function of this class of molecules. They are also crucial in ensuring the
structural integrity and correct folding of the light harvesting protein. Hence the nature of
antenna molecular design reveals a cooperative character of the functioning of its structural
elements. This cooperativity is also central to the regulation of a sequence of photosynthetic
reactions that take place in the membrane, ensuring their relatively autonomic character.
The latter is an essential manifestation of life’s way of conquering entropy: the multiple
constituents of a biological system have evolved in such a way that their structure ensures
a smooth assembly into the complex functional cell elements/compartments which interact
with each other and accomplish complex functions of an essentially autonomic nature.
The atomic resolution structures of antenna complexes have just started to emerge and
our understanding of the function of the antenna’s various elements is still at an embryonic
state. However, the atomic resolution of LHCII complexes opened a rich world of vector
(directional) and quantum chemistry and physics of the workings of the molecular light
harvesting machine. This text gives an insight into how it is assembled within the photosys-
tem structure. It also shows numerous examples of the properties and fascinating behaviour
of isolated light harvesting complexes; these nanodevices that evolved to capture light with
the highest efficiency. Classic and emerging approaches in their studies are described here
in order to introduce the reader to the sheer spectrum of multidisciplinary expertise and
experience that have accumulated over several recent decades of the photosynthesis
research. Most exciting is the progress made in the field of visualization of the intact
membrane as well as the work on single proteins. Their success and rapid development
promises to give more insightful and mechanistic information about the workings and life
of the photosynthetic membrane.
It is reasonable to expect that in future new high resolution in vivo visualization and
protein tracking techniques will be developed, giving a direct picture of the behaviour of
individual groups of complexes or even single proteins. Parallel development of molecular
modelling techniques is necessary in order to describe the two-dimensional diffusion and
clustering processes in the intact membrane and the dynamics of individual proteins.
Science of the photosynthetic membrane, when equipped with such tools and approaches,
will eventually become more routinely predictive, giving accurate quantitative information
about the mechanisms of function and adaptation within the complex networks of proteins
and cofactors of the photosynthetic membranes, taking the whole physiology of the
photosynthetic process to a principally new level of understanding. The science of the bio-physical chemistry of live photosynthetic membranes would become a fundamental basis
for the new generations of plant physiologists, who would be able to explain and project the
various consequences of mutagenesis, adaptation strategies and the responses of the
photosynthetic machinery to various environmental factors. The new level of molecular
approaches and knowledge would become crucial to the work directed at improving the
Rupan_c11.indd 259 8/29/2012 5:34:25 PM
260 The Photosynthetic Membrane
productivity of crops and the adaptation strategies made necessary by a changing global
climate. The mechanistic and quantitative character of the new plant science would enable
researchers to accurately assess the productive capacity of various crops and predict the
quality of their adaptive potential. It would also benefit greatly the creation of ecological
models that predict the impact of global warming on plant communities and the biosphere
in general. Research into the physicochemcial principles of light harvesting would also
indicate whether they can realistically be utilized in the development of highly efficient,
stable and cheap solar energy devices. And, last but not least, it should become increasingly
fascinating and educational for us to observe and study the ways in which evolution han-
dled the laws of chemistry and physics in creating the photosynthetic membrane, a system
with form and function so fantastically complex yet so beautifully deterministic: a system
which ultimately sustains life on planet Earth.
Rupan_c11.indd 260 8/29/2012 5:34:25 PM
(a) (b)
(c) (d)
(e) (f)
(g) (h)
Chloroplast
Granae
Granae
Granal thylakoid
PSIILHCII
PSII
Plate 3.1 Origin and organization of the photosynthetic membrane of higher plants. (a) Spinach plants – a common model for mechanistic photosynthesis research. (b) Fluorescence confocal image of chloroplasts in the intact leaf showing clearly separated fluorescing dots – granae. Bar is 5 mm (courtesy of Tomasz Goral and Conrad Mullineaux). (c) Isolated chloroplasts in the incubation medium. Bar is 10 mm. (d) Electron micrograph of a single chloroplast show-ing dark elongated granae and large white starch granulae (centre). Bar is 1 mm. (e) Schematic presentation of thylakoid system structure of the chloroplast. (f) Electron micrograph of a single grana stack (centre). Bar is 200 nm. (g) Freeze-fracture electron micrograph of a single thylakoid membrane from grana showing photosystem II particles. Bar is 100 nm. (h) Freeze-fracture electron micrograph of grana thylakoid membranes displaying photosystem II as well as light harvesting complex particles (LHCII). Bar is 200 nm.
Ruban_bins.indd 1 8/29/2012 9:41:57 PM
Plate 3.2 Scattering and absorption of light by oak leaves. Left: 1, 2 and 3 order of leaves facing light. Right: chlorophyll fluorescence confocal image of the leaf cell showing even redistribution of chloroplasts. Bar is 5 micrometers (Photo on the right is courtesy of Tomasz Goral and Conrad Mullineaux).
Chlorophyll
Lipid
Xanthophyll
Plate 3.5 An example of close van der Waals interactions between a fatty acid residue of phospholipid, chlorophyll phytol tail and xanthophyll. The coordinates were taken from the structure of LHCII complex (for details see Chapter 6).
Ruban_bins.indd 2 8/29/2012 9:42:01 PM
Leaves Chloroplasts
Membranes
LHCII
Separated complexes
LHCIIb
LHCIIdLHCIIcLHCIIa
0.4
pH
4.2
4.6
0.7
Sucrose,M
PSII
PSI
Membrane fragments andsolubilised complexes
Grinding ¢rifugation
Osmotic shock ¢rifugation
+ Detergent ¢rifugation
Ultracentrifugation onsucrose gradient
Isoelectric focusing(IEF)
Plate 4.1 Basic steps of isolation of the photosynthetic membrane complexes.
Ruban_bins.indd 3 8/29/2012 9:42:02 PM
Plate 5.10 Global redistribution of chlorophyll a. Reproduced with permission from http://oceancolor.gsfc.nasa.gov/SeaWiFS/. © SeaWiFS Project/NASA.
Plate 6.5 Chlorophylls of LHCIIb monomer in 2.72 Å resolution structure (left) and tight circular way of chlorophyll arrangement around the hydrophobic core of the complex (right). Presented in freeware PyMol 0.99.
Ruban_bins.indd 4 8/29/2012 9:42:04 PM
Plate 6.6 Chlorophylls a of LHCIIb monomer. Arrangement around the apoprotein (top), geometry and nomenclature (middle) and types of ligands (bottom). Ph: phospholipid. Presented in freeware PyMol 0.99.
Ruban_bins.indd 5 8/29/2012 9:42:05 PM
Plate 6.7 Chlorophylls b of the LHCIIb monomer. Arrangement around the apoprotein (top), geometry and nomenclature (middle) and types of ligands (bottom). Presented in freeware PyMol 0.99.
Ruban_bins.indd 6 8/29/2012 9:42:06 PM
Plate 6.8 Structure of neoxanthin-binding domain of LHCIIb showing enrichment in Chl b (left) and 9-cis end of the molecule hydrogen bonded to tyrosine Y112 (right) in the vicinity of the antiparallel strand of the lumenal loop near helices C and E. Presented in freeware PyMol 0.99.
Plate 6.9 Structure of lutein 620-binding domain of LHCIIb showing the terminal emitter chlorophylls a610-612 (top) and hydrogen bonding patterns to hydroxyl oxygens of the xanthophyll (bottom). Presented in freeware PyMol 0.99.
Ruban_bins.indd 7 8/29/2012 9:42:07 PM
Plate 6.10 Structure of lutein 621-binding domain showing the domain chlorophylls a602-604 (top left), hydrogen bonding patterns to hydroxyl oxygens of the xanthophyll (top right) and interaction with Chl a603 localized on the neighbouring LHCIIb monomer (bottom). Presented in freeware PyMol 0.99.
Ruban_bins.indd 8 8/29/2012 9:42:09 PM
Plate 6.11 Structure of violaxanthin-binding domain of LHCIIb showing interactions with chlorophylls a 613-614 (top left), Chl b601 (top right). Below are shown the side (left) and top (right) views of all LHCIIb xanthophylls arrangement within the complex. Presented in freeware PyMol 0.99.
Ruban_bins.indd 9 8/29/2012 9:42:10 PM
Plate 6.14 Structure of CP29 (LHCIIa) complex at 2.8 Å resolution. Top: side and top views of the whole complex; middle: all xanthophylls view; bottom: the putative terminal emitter chlorophylls a. Presented in freeware PyMol 0.99.
Ruban_bins.indd 10 8/29/2012 9:42:11 PM
Plate 8.12 Spectra of the sun light and energy absorbed by the LHCII complex in trimeric and monomeric states. Bottom panel shows the relative leaf penetration depth of the sun light of different spectral regions/colour.
Ruban_bins.indd 11 8/29/2012 9:42:12 PM
0.8 ns 1.1 ns
864Time, ns
Flu
ores
cenc
e, r
el
200
1000
2000
LHCII trimer
LHCII crystal
Plate 8.18 Quenching of chlorophyll a fluorescence lifetime in a single LHCII crystal using FLIM technique. The image is shown in false colours defining the fluorescence lifetime as presented by the colour lifetime scale below the image. Bottom: average fluorescence decay profiles for trimers and crystals of LHCII. Reprinted with permission from Macmillan Ltd Publishers, Pascal et al .© 2005 Nature Publishing Group.
Ruban_bins.indd 12 8/29/2012 9:42:12 PM
Plant adaptations to light
Number ofmembranes
Size of antenna
ChloroplastmovementsChloroplast
number
Plantmetabolism
Chloroplastmetabolism
Photosystems ratioState transitions
NPQ
Leaf orientationLeaf reflectance
Salt depositsLeaf structure
Managing light absorption
Managing absorbed energy
Plate 9.2 Multilevel strategies of plant adaptations to the light environment. Type A: managing light absorption; type B: managing absorbed energy. Three levels of adaptations are presented: organismal (plant), cellular (chloroplasts) and molecular (photosynthetic membrane). Reprinted with permission from Ruban, A.V.© 2008, Landes Bioscience.
De-epoxidation
Dark / low light Excess light
Δ pH
PSII minor antenna
LHCII trimer
PSII core
Zeaxanthin
Violaxanthin
LHCII aggregate(quenched)
Plate 9.20 Scheme depicting the current knowledge regarding the structural reorganization of the PSII–LHCII macrostructure occurring in the NPQ state. Dissociation of the part of light harvesting antenna from PSII supercomplex leads to the reorganization and aggregation of LHCII complexes. Reproduced with permission from Johnson et al .© 2011 American Society of Plant Biologists.
Ruban_bins.indd 13 8/29/2012 9:42:13 PM
Plate 10.3 Phyllostachys pubescens, the efficient light harvester and one of the fastest growing plants. Kyoto Rakusai Bamboo Park. Courtesy of Kateryna Law.
Ruban_bins.indd 14 8/29/2012 9:42:14 PM
The Photosynthetic Membrane: Molecular Mechanisms and Biophysics of Light Harvesting,
First Edition. Alexander Ruban.
© 2013 John Wiley & Sons, Ltd. Published 2013 by John Wiley & Sons, Ltd.
Index
absorption cross-section, 74, 82, 177
abstract thinking, 241
acclimative modulation of antenna
size, 201
aggregation hypothesis, 225
Agrobacterium tumefaciens, 40
allene group, 87
allosteric control, 222
9-aminoacrydine, 63, 215
amphiphilicity, 9
anisotropy, 49
antenna cross-section, 94
antenna hydrophobicity, 230
antheraxanthin, 87
Anthropocene, 254
antimycin A, 218
antiparallel strands, 117
antisense, 136
anti-Stokes energy transfer, 97
Archaea, 11
artificial light harvesting, 252
ATP-synthase, 26, 28
attenuated total reflection (ATR), 54
bacteriochlorophyll, 131
band gap, 82, 250
basic natural sciences, 242
BBY particles, 35
Beer-Lambert law, 49
benzoquinone, 24
binary reaction, 191
bioindicators, 253
biophysical chemistry, 259
Biosphere, 4, 241
BODIPY, 30
Boltzmann constant, 4
Bragg’s law, 48
Brownian motion, 8
cantilever, 45
carbon dioxide, 253
β -carotene, 37
carotenoids, 37
cations, 19
cDNA hybridization, 40
charge recombination, 236
charge transfer, 183
chemical storage, 6
chlorin ring, 21, 82
chlorophyll, 24, 37
a/b ratio, 102
b fluorescence, 164
pigments, 82
spectral forms, 87
chlorophyll-chlorophyll associates, 182
chlorophyll-xanthophyll interactions, 183
chloroplast, 17
cholate, 36, 102
9-cis conformation, 115
classification of antennae, 91
classification of membrane proteins, 15
climate change, 253
coarse-grained model, 167–8
coherence, 80
collective dynamics, 14
compartmentalisation, 9
Rupan_bindex.indd 261 8/29/2012 5:40:56 PM
262 Index
concentration quenching, 78, 132
conduction band, 250
configurational alteration, 183
conformational states, 188
Confucius, 5, 33, 67, 101, 197
conical intersection, 235
conjugated double bonds, 24, 87
conjugation, 82
cooperative nature of qE, 233
co-ordination interactions, 119
CP24, 26, 106
CP26, 26, 106, 176
CP29, 26, 106, 126, 128
CP43, 26
CP47, 26
CPa, 105
critical micelle concentration
(cmc), 179, 190
crops, 247
cross-linkers, 42, 141, 218, 234
cross-section, 132
cryoelectron microscopy, 149
cryofixation, 44
crystallography, 45, 47–8, 102, 105,
107, 109
C2S2M2L2 particle, 142
C2S2M2 particle, 142–3, 147
C2S2 particle, 140
Cuscuta reflexa, 115
cytochrome b6/f complex, 26
damping, 42
Davidov’s splitting, 80
DCMU 61, 216
DEAE, 36
de Broglie dualism, 70
decay-associated spectra (DAS), 166–7
de-epoxidase, 129, 219
delocalized excitonic states, 235
delta-pH ( Δ pH), 28
denaturation, 37, 185
de-phasing energy, 235
deriphat, 106, 138
derivative method, 162
detergents, 24
Dexter electron exchange, 80
dichlorophenol indophenol (DCIP), 52
dicyclohexylcarbodiimide (DCCD), 218
diethyl sulphate, 40
diffractometer, 48
digalactosyl diacylglycerol
(DGDG), 115
digitonin, 35, 102, 138, 149
dipole moment, 71
dodecyl- α -D-maltoside, 139
dodecylglucposide, 106
dodecylmaltoside, 138
D1 protein, 27, 208
D2 protein, 27
EFs, 140
electrochemical potential, 15
electrochromic shift (ECS), 53, 168
electromagnetic wave, 68
electron
diffraction, 48
exchange, 81
transport, 6, 15
electrophoresis, 36
energy
balance, 243
imbalance (IB), 204
losses, 243
migration, 80
redistribution, 208
transfer rate, 109
transformations, 257
enthalpy, 185
entropically-driven, 185, 188
entropy, 2, 119, 242
negative, 2, 67
environmental changes, 254
enzymes, 16
epoxidaze, 219
Escherichia coli (E. coli) 38, 40
evanescent wave, 42
evergreen plants, 226
exchange interaction, 237
excitation fluorescence, 56, 206
excited state lifetime, 163
excitonic coupling, 79, 235
interactions, 237
Rupan_bindex.indd 262 8/29/2012 5:40:56 PM
Index 263
exciton transfer integral, 235
extinction coefficient, 50
fatty acids, 23
feedback control, 215
ferredoxin, 28, 52
Feynman, 7
ficoll, 40
fluorescence
band F700, 181
confocal, 41
damping, 42
excitation spectrum, 94
lifetime imaging (FLIM), 186
lifetime spectroscopy (TCSPC)
polarisation, 58
recovery after photobleaching (FRAP),
30, 42, 148, 223, 227
time-resolved, 58
yield, 59
Fo quenching, 218
forward genetics, 40
Fourier transformation, 48
FPLC, 35
Frank-Condon principle, 73
Fraunhofer lines, 70
free pigment zone, 105
Förster’s theory, 76
gallium phosphide, 41
gammaaminobutyric acid (GABA)
gel filtration, 35, 127, 140
global analysis, 167
global warming, 242, 254
glucose, 243
glucosides, 24
glutaraldehyde, 185
G-protein coupled receptors (GPCR)
grana stacking, 19, 104
harmful excitation energy, 198
heat emission, 218
heterotrimers, 136
higher occupied molecular orbital
(HOMO), 72
high hydrostatic pressure, 185
His-tag, 185
homogenous broadening, 72
homotrimers, 136
HPLC, 37
H-type aggregate, 89
hybrid solar cells, 253
hydrogen
bond, 10
bonding patterns, 183
production, 252
hydrophilic, 9
resins, 180
hyperbolic decay, 191
hysteresis, 223
icosahedral spherical particles, 115
icosienamer, 143
incoherent coupling, 237
inductive resonance, 81
inhomogeneous broadening, 72
inorganic deposits, 199
integral membrane-spanning, 13
internal conversion, 74
ion channels, 16
ion-exchange chromatography, 127
ionic interactions, 139
isoelectric focusing (IEF), 36, 190
isoenergetic, 185
isoprenoid residues, 23
J-type aggregate, 89
kanamycin-resistance, 40
kinase, 207
Kipling, 17, 267
knock-out mutations, 136
laurate, 10
leaf orientation, 199
LH2, 129
Lhcb2 antisense, 150, 209
Lhcb5 antisense, 141
LHCII, 26, 105–6, 115
crystals, 186
oligomerization, 179
LHCP, 105
Rupan_bindex.indd 263 8/29/2012 5:40:56 PM
264 Index
life, 1
light
adaptations, 198
capture, 6
energy accumulation processes, 6
energy losses, 244
harvesting gene family, 136
harvesting principles, 15, 252
saturation, 198
starvation, 198
lipid, 21
bilayer membrane, 9
mobility, 30–31
liposomes, 39
lithium dodecylsulphate (LDS), 38
Longfellow, 241
long-term adaptations, 201
lowest unoccupied molecular orbital
(LUMO) 72
low-temperature fluorescence, 181
lumen, 19
lutein, 37, 87, 111, 122, 171, 193–4, 209,
235, 246
macrostructural organisation, 135
macroworld, 8
magnesium, 19, 103, 181
managing
absorbed energy, 198
light absorption, 198
mankind, 241
matter, 3
membrane
electric potential, 11
fluidity, 11
permeability, 11
protein, 11–12
metabolism, 15
methanesulfonate, 40
microscopy
atomic force (AFM), 45
confocal scanning, 17
electron (EM), 19, 42
fluorescence, 41
freeze-fracture (FFEM), 13–14, 27,
44–5, 137–8, 140, 147–8, 223–8
optical, 41
microtome, 44
Milne, 136, 169
minor antenna, 106
molar extinction, 74
molecular dimer, 235
monochromator, 56
monoexponential decay, 165
mutagenesis, 40
NADP reductase, 28
nano-materials, 252
nanoscale organisation, 257
nanoworld, 7
NASA satellite, 82
n-body modelling, 14
n-dodecyl- β -D-maltoside, 35–6
negative stain, 227
negative staining, 42
neoxanthin, 37, 87, 111, 121, 171,
193–4
Ni-containing column, 185
nigericin, 216
n-octyl- β -D-glucoside, 35
noncovalent bonds, 258
non-denaturing, 36
non-equilibrium thermodynamics, 119
non-invasive, 159
nonphotochemical chlorophyll
fluorescence quenching (NPQ), 62–3,
214, 248
nonradiative
decay, 59
dissipation, 182
processes, 56, 63
npq4 mutant, 230
N-terminal trimerization motif, 136
nuclear reorganization energy, 73
numerical aperture, 41
octylglucoside, 38, 106, 138
opal glass, 51
optical density, 50
order, 1
oscillating electric dipole, 68
oscillator strength, 74
overlap integral, 77
Ovid, 7
Rupan_bindex.indd 264 8/29/2012 5:40:56 PM
Index 265
oxygen evolving complex, 27
oxygenic photosynthesis, 197
parameters of light harvesting antenna, 94
percoll, 34
PFs surface, 140
Δ pH, 64, 215
Phaeodactylum, 221
phaeophytin, 87
phosphatase, 207
phosphatidylglycerol (PG), 117, 126
phosphodiester, 117
phospho-LHCII, 207
phospholipase, 177
phosphorylation of LHCII, 205
photochemical quenching (qP) 62–3
photoconversion efficiency, 251
photoelectric effect, 70
photoinhibition, 214
photoprotective efficiency, 248
photoreceptors, 200
photosensors, 253
photosynthesis, 4
photosynthetic
control, 215
saturation, 198
unit, 76, 135
photosynthetically active radiation
(PAR), 245
photosystem
I (PSI), 26
II (PSII), 26
photosystems ratio, 200–201
photovoltaic devises, 250
pH titrations, 191
Phyllostachys pubescens, 247–8
phytol, 22
pigment stoichiometry, 106
pK, 233
Planck constant, 70
plasticity of antenna, 176
plastocyanine, 29
plastoquinone 24, 207
polarisation, 53
polyacrylamide gel electrophoresis
(PAAG), 36, 102
polymerase chain reaction (PCR), 40
population growth, 242
porins, 16
porters, 16
potassium
cations, 19, 103
ferricyanide, 52
principles of light harvesting, 93
programmed solvent concept, 93, 109,
164, 179, 181
protein
landscapes, 147
mobility, 30–31
proteolysis of LHCII, 201
proton
binding equilibrium, 233
transport, 6
proton-antenna association constant, 222
PsaA, 26
PsaB, 26
PsbA, 26
PsbB, 26
PsbS protein, 218, 223, 248
PSI
cross-section, 207
supercomplex, 145
PSII
supercomplex, 140
turn-over, 29
yield, 220
pulvinar motor tissue, 199
purple bacteria, 24, 129
qE quencher, 234
quenching
in gel, 185
kinetics, 190
quinone, 23–4
radiative
energy dissipation, 74
lifetime, 59, 74
radical
cation, 236
pair, 214
Rayleigh scattering, 54
receptors, 16
recombinant protein, 37, 111
Rupan_bindex.indd 265 8/29/2012 5:40:56 PM
266 Index
recycling principle, 1
red energy traps, 96
Redfield theory, 80
redox state, 208
reflectance, 51
refractive index, 89
reorganisation energy, 73
resonance Raman, 113
respiration proceses, 244
reverse genetics, 40
Rhodobacter sphaeroides, 129
rhodopin glucoside, 24, 131
Rieske iron-sulphur protein, 28
robustness of antenna, 150
Rodopseudomonas sphaeroides, 24
Roman Empire, 12
rotations, 72
scattering, 51
second derivative, 172
selective light scattering, 182
selectivity, 159
self-regulation, 257
senescence, 226
short-term adaptations, 202
signalling, 15
Snowball Earth, 2
sodium dodecyl sulphate (SDS), 36, 102, 138
solar
energy capture, 242
panels, 250
power, 250
Soret band, 160, 177–8
spectroscopy, 49, 159
absorption, 49, 160
circular dichroism (CD), 39, 43, 160,
163
fluorescence, 56, 160
infrared (IR), 54
linear dichroism (LD), 53, 160, 162
pulse amplitude modulated (PAM), 59
Raman, 54, 171, 183–4, 188
single molecule, 188
Stark, 173
time-correlated single photon counting
(TCSPC), 59, 193
time-resolved, 165
transient absorption, 169–70, 183
spillover, 103, 207
spontaneous fluorescence quenching, 190
stacked thylakoids, 98
stacking, 19
state I, 203
state II, 203
state transitions, 202
steroid structure, 138
stimulated emission depletion (STED), 42
Stokes shift, 72, 95
stray light, 51
sunflecks, 202
supercomplex, 14
Superdex 200 column, 35
symmetry-forbidden, 183
T-DNA insertional mutagenesis, 40
terminal emitter, 183, 246
terpenoid, 24
tertiary
amines, 218
structure, 112, 119
thermodynamic equilibrium, 2
thin layer chromatography (TLC), 38
thin section, 229
thylakoid, 19
titanium oxide, 251
tocopherol, 23–4
total internal reflection (TURF), 42
Tower of London, 11
trans-cis isomerisation, 24
transgenic, 40
transition dipole moment, 74
translational movement, 72, 162
transmembrane helixes, 109
transport, 15
trimerisation, 126
trimers of CP26, 176
triplet excited state, 75
triton X100, 35, 103, 138
turn-over rate, 246
ultracentrifugation, 35
universe, 2
Rupan_bindex.indd 266 8/29/2012 5:40:57 PM
Index 267
unstacked thylakoids, 98
uranyl
acetate, 43
formeate, 43
valence band, 250
van der Waals, 10
vector chemistry, 31
vibrations, 72
vibronic satellite, 94, 163
violaxanthin, 37, 87, 111, 125, 171, 188,
190–191, 193–4, 219, 235
wagging vibrational mode, 113
water splitting, 252
western blot, 37
wonder reflex, 241
xanthophyll, 24, 87
cycle, 219
hydrophobicity parameter
(H-partameter), 194
solubility, 192
zeaxanthin, 37, 87, 123, 129, 171, 188,
190–191, 193–4, 219, 235
zwittergent-16, 146
zwitterionic detergents, 36
Rupan_bindex.indd 267 8/29/2012 5:40:57 PM