Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors,...
Transcript of Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors,...
![Page 1: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/1.jpg)
SYNTHESIS AND BIOLOGICAL EVALUATION OF NOVEL ENDOCANNABINOID PROBES, METABOLICALLY STABLE ANALOGS, AND N-ACYLETHANOLAMINE-
HYDROLYZING ACID AMIDASE INHIBITORS
A dissertation presented
by
Kyle Mark Whitten
To The Department of Chemistry and Chemical Biology
In partial fulfillment of the requirements for the degree of Doctor of Philosophy
in the field of
Chemistry
Northeastern University Boston, Massachusetts
October, 2012
![Page 2: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/2.jpg)
2
SYNTHESIS AND BIOLOGICAL EVALUATION OF ENDOCANNABINOID PROBES,
METABOLICALLY STABLE ANALOGS, AND N-ACYLETHANOLAMINE-HYDROLYZING ACID AMIDASE INHIBITORS
By
Kyle Mark Whitten
ABSTRACT OF DISSERTATION
Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Chemistry in the Graduate School of Northeastern University
October, 2012
![Page 3: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/3.jpg)
3
The design of novel selective ligands is important for the structural characterization of G-
protein coupled receptors (GPCR). For this reason we have sought to study the interactions of
selective cannabinergic ligands with the CB1 and CB2 cannabinoid receptors to obtain
information on the pharmacophoric requirements for ligand-drug activities.
Our laboratory has developed ligand-assisted protein structure (LAPS) an approach
which involves the combined use of covalent ligands, CB1 and CB2 mutants, as well as LC/MS
based proteomic methods. We have designed a convergent synthesis for a series of potent and
metabolically stable anandamide based covalent ligands. These ligands contain either an azide or
isothiocyanate group in strategic sites for covalent binding to determine where this class of
ligands activates the GPCR.
2-Arachidonoylglycerol (2-AG) is an important endogenous signaling molecule towards
the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a
hindrance to its study. Previous chemical syntheses used conditions that promote acyl migration
to the more stable 1(3)-AG. Thus, we have developed an efficient and condition neutral
chemoenzymatic synthesis where minimal, if any, acyl migration is observed. Concordantly, in
vivo study of 2-AG is difficult due to its short duration of action caused by hydrolysis from
monoacylglycerol lipase (MAGL). Synthesis of a metabolically stable 2-AG analog has been
developed to prevent MAGL metabolism.
Palmitoylethanolamine (PEA) is recognized as a naturally occurring anti-inflammatory
agent that has been shown to enhance the effect of anandamide. The metabolism of PEA is
controlled by N-acylethanolamine-hydrolyzing acid amidase (NAAA) and inhibition of this
enzyme will increase PEA levels. Thus, we have synthesized a series of selective and reversible
inhibitors of NAAA with IC50 values in the low nM range.
![Page 4: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/4.jpg)
4
To Agnes,
for the sacrifices she made
![Page 5: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/5.jpg)
5
ACKNOWLEDGMENTS
I would first like to give gratitude to my advisor Professor Alexandros Makriyannis for
giving me the opportunity to conduct research on significant and novel projects relating to the
endocannabinoid system. His guidance and scientific input helped the evolution of these projects
where we were able to obtain new understanding of the cannabinoid system. It has been a
pleasure to learn from him not only in organic and medicinal chemistry, but also understand the
science at the interface of chemistry and biology.
I am grateful for the time and advice of my thesis committee, Dr. Graham Jones, Dr.
Carol Paronis, and Dr. Robert Hanson. Their input and discussion was helpful in completing this
dissertation.
I would like to specially thank my lab mentor Dr. Kumar Vadivel for his guidance at the
bench. His organic chemistry knowledge has been most useful in overcoming the various
hurdles I have approached throughout my research. His insight and direction has been most
helpful in the specific chemistries herein. I would also like to thank senior chemists in our lab,
Dr. Kiran Vemuri, and Dr. Spyros Nikas for their helpful discussions throughout the years and
their invaluable knowledge in organic synthesis.
I would like to thank Dr. Jodi Wood for her work in the biochemistry lab, making sure I
obtained all relevant biochemical data for my compounds. Han Zhou, who was responsible for
completing all the covalent assays on the endocannabinoid probes I have synthesized. Dr. Jay
West, was my biochemistry counterpart on the N-acylethanolamine-hydrolyzing acid amidase
(NAAA) project. He has done a great job purifying human NAAA and screening all the
inhibitors I produced in a high throughput screen that he developed. Dr. Anna Bowman, who
modeled my endocannabinoid covalent probes interacting with human CB2 receptor. Dr. Toby
![Page 6: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/6.jpg)
6
Järbe and Roger Gifford, who conducted pharmacological testing on mice with my 2-AG
analogs. And Dr. Roger Kautz, who has been a great help with the NMR. I would also like to
thank all the CDD members past and present who I’ve had the privilege of knowing throughout
these five years.
I want to thank Dr. Travis Dudding, who gave me my first opportunity to conduct organic
synthesis research in his lab at Brock University. This opportunity opened my eyes to research
which I have been doing ever since. Also, my undergraduate advisor Dr. Eddie Luzik, who
helped grow my skills as an organic chemist and helped me obtain funding for an organic
research project.
I want to thank my good friends Dr. Rose Gathungu, Dr. Chris Allen, and Lenny Dao; we
all came into the program together and are all leaving in the same year. I am grateful for your
friendship and enjoyed eating lunch together almost every day.
Last but not least, I would like to thank my family; my Mom and Dad who have been so
supportive throughout my life. They have encouraged me to pursue my interests and were
always there for me with whatever help I needed. As well as my little brothers, Eric and Mark,
who growing up with helped me become the person I am today. And most importantly, I want to
thank my wife Agnes; who decided to move with me to Boston after we graduated together from
University of New Haven. She has sacrificed a lot, and I am so grateful for her love and support.
![Page 7: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/7.jpg)
7
TABLE OF CONTENTS
Abstract 2
Acknowledgements 5
Table of Contents 7
List of Figures 11
List of Tables 13
List of Schemes 14
Abbreviations 16
Chapter 1: The Endocannabinoid System
1.1 History of Cannabis Sativa 20
1.2 The Cannabinoid Receptors 20
1.2.1 Cannabinoid Receptor Distribution 21
1.2.2 Cannabinoid Receptor Modulation 22
1.2.3 Compounds Interacting with the Cannabinoid Receptors 22
1.3 The Endocannabinoids 26
1.3.1 Endocannabinoid Biosynthesis 27
1.4 Metabolizing Enzymes 30
1.4.1 Fatty Acid Amide Hydrolase -- FAAH 30
1.4.2 Monoacylglycerol Lipase -- MGL 32
1.4.3 N-Acylethanolamine-Hydrolyzing Acid Amidae -- NAAA 33
1.5 Endocannabinoid System Retrograde Signaling 34
1.6 Goal of Thesis Research 34
1.7 References 36
![Page 8: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/8.jpg)
8
Chapter 2: Novel Endocannabinoid Probes
2.1 Introduction 44
2.2 Current Cannabinoid Probes 45
2.3 Design of Bifunctional Endocannabinoid Covalent Probes 49
2.4 Linear synthetic strategy 50
2.5 Development of a Convergent Synthesis for Covalent Probes 51
2.6 Binding Affinity and Covalent Binding Data of Covalent Probes 54
2.7 Head-group Optimization 56
2.8 Ligand-Assisted Protein Structure (LAPS) 60
2.8.1 LAPS Studies Utilizing AM9017 61
2.9 Significance of Transmembrane Helix 6 66
2.10 Docking of AM9017 into hCB2 Models 66
2.11 Conclusions 70
2.12 Experimental 72
2.13 References 90
Chapter 3: Chemoenzymatic Synthesis of Biologically Active Compounds
3.1 Introduction 94
3.1.1 Synthesis of 2-AG 95
3.1.2 Lipases in the Synthesis of Acylated Glycerols 97
3.2 Synthesis of 2-MAGs with Immobilized Candida antarctica and Rhizomucor
miehei
98
3.2.1 Synthesis of 2-MAGs with Immobilized Candida antarctica 98
![Page 9: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/9.jpg)
9
3.2.2 Synthesis of 2-MAGs with Rhizomucor miehei 100
3.3 Enzymatic synthesis of N-Acylethanolamines 102
3.3.1 Candida antarctica for the direct aminolysis of esters 103
3.3.2 Reaction optimization and results 104
3.4 Conclusions 107
3.5 Experimental 108
3.6 References 125
Chapter 4: Chemically and Metabolically Stable 2-Arachidonoylglycerol Analogs
4.1 Introduction 130
4.2 Synthesis of Biphenyl 2-AG Analogs 132
4.2.1 Biphenyl 2-AG Analog Cannabinoid Binding Data 137
4.3 Modification of the Glycerol Head Group 140
4.3.1 Synthesis of 2,4-dihydroxypentan-3-arachidonoates 140
4.3.2 Synthesis of 1,3-dihydroxybutan-2-arachidonoates 142
4.4 Purification and Isolation of 2,4-dihydroxypentan-3-arachidonoate Isomers 144
4.5 Identification of pent-2,4-ol-3-arachidonoate Stereochemistry 147
4.6 Chemically and Metabolically Stable 2-AG Analog Data 151
4.6.1 Chemical Stability of 2-AG Analogs 151
4.6.2 Metabolic Stability of 2-AG Analogs Compared to 2-AG 152
4.6.3 Cannabinoid In Vitro Binding Assay Data 154
4.6.4 Pharmacological Data of 2-AG, 1-AG, AA, and 2-AG Analogs In Vivo 155
4.7 Conclusions 159
4.8 Experimental 161
![Page 10: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/10.jpg)
10
4.9 References
180
Chapter 5: N-Acylethanolamine-Hydrolyzing Acid Amidase Inhibitors
5.1 Introduction and Background 183
5.1.1 Current NAAA inhibitors 184
5.2 Design, Synthesis, and Biological Evaluation of NAAA Inhibitors 186
5.2.1 Retroamides 186
5.2.2 Carbonates and Carbamates 188
5.2.3 Optimization of AM9058 192
5.2.4 Isothiocyanates 193
5.3 Evaluation of AM9053 Mode of Inhibition 198
5.4 Conclusions 202
5.5 Experimental 205
5.6 References 227
Chapter 6: Future Directions
6.1 Novel Endocannabinoid Probes 231
6.2 Chemoenzymatic Methods 232
6.3 2-AG Analogs 232
6.4 NAAA Inhibitors 232
6.5 References 233
Appendix I : Publications 234
![Page 11: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/11.jpg)
11
LIST OF FIGURES Figure 1.1 Δ9-Tetrahydrocannabinol 20
Figure 1.2 Class examples of compounds activating CB1 and CB2 receptors 23
Figure 1.3 Selective CB1 Agonists 24
Figure 1.4 CB1 receptor antagonists and inverse agonists 25
Figure 1.5 CB2 selective agonists 25
Figure 1.6 CB2 selective inverse agonists/antagonists 26
Figure 1.7 The primary endocannabinoids Anandamide and 2-Arachidonoyl glycerol 26
Figure 1.8 Other possible endocannabinoids 27
Figure 1.9 FAAH inhibitors 32
Figure 1.10 MGL inhibitor JZL184 33
Figure 2.1 THC based covalent probes 45
Figure 2.2 Other endocannabinoid probes 46
Figure 2.3 Tagged endocannabinoid probes 47
Figure 2.4 Arachidonoylcyclopropylamine covalent probes 48
Figure 2.5 CB1 receptor with transmembrane cysteines highlighted 60
Figure 2.6 Human CB2 receptor with transmembrane cysteines highlighted 61
Figure 2.7 Covalent assay of AM9017 with WT hCB2 and mCB2 63
Figure 2.8 Covalent assay of AM9017 with C6.47S hCB2 and mCB2 mutants 64
Figure 2.9 AM9017-hCB2 covalent complex equilibrated in a POPC membrane 66
Figure 2.10 Zoom-in of AM9017 covalent attachment to the hCB2 receptor 67
Figure 2.11 Comparison of inactive hCB2 (orange) with active hCB2 receptor
covalently bound to AM9017 (green) 68
![Page 12: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/12.jpg)
12
Figure 3.1 N-Acylethanolamines 101
Figure 4.1 2-AG and published 2-AG analogs 130
Figure 4.2 1H NMR of 1,3-diol products after NaBH4 reduction of 1,3-diketone 144
Figure 4.3 Product separation from TLC analysis of tested solvent systems 146
Figure 4.4 Theoretical products from NaBH4 reduction of a 2-4 diketone 147
Figure 4.5 Zoom in on splitting patterns of C2, C3, and C4 protons 148
Figure 4.6 Newman projects of the two meso compounds: 49 & 50 150
Figure 4.7 Locomotor activity following administration of 2-AG analogs 155
Figure 4.8 Rearing activity following administration of 2-AG analogs 156
Figure 4.9 Locomotion and rearing of dosed mice with 2-AG, 1-AG, and arachidonic
acid 157
Figure 5.1 Best NAAA inhibitors derived from palmitic esters, 1 & 5; retroesters, 2;
retroamides, 3; along with palmitoylethanolamine (PEA) 4 184
Figure 5.2 Reported β-lactone NAAA inhibitors 185
Figure 5.3 Concentration dependent inhibition of human NAAA by AM9053 199
Figure 5.4 Tryptic digest of purified human NAAA obtained by MALDI-TOF MS for
protein neat (A) and AM9053 treated enzyme (B) 200
Figure 5.5 Lineweaver-Burk plot analysis of AM9053 inhibition of hNAAA 201
![Page 13: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/13.jpg)
13
LIST OF TABLES Table 2.1 Binding affinity (Ki) for ligands 17-24 to the cannabinoid receptors 53
Table 2.2 Percentage of occupied receptors for 18-20 and 22-24 in covalent binding
assay 54
Table 2.3 Binding affinity (Ki) for ligands 62-65 to the cannabinoid receptors 58
Table 2.4 Percentage of occupied receptors by 62-65 in covalent binding assays 58
Table 3.1 Structure and Yields of Lipase catalyzed 2-MAGs 100
Table 3.2 Amidation of esters with immobilized Candida antarctica in 1:1 hexane-
diisopropylether 104
Table 4.1 2-point cannabinoid receptor binding assay data 137
Table 4.2 hMGL substrate assay results 152
Table 4.3 Cyclic AMP assay for 2-AG dimethyl analogs 154
Table 5.1 IC50 values for compounds 12-20 towards NAAA, FAAH, and MGL
enzymes 187
Table 5.2 Carbonates and Carbamates 190
Table 5.3 Carbamate inhibitors with alternate phenyl leaving groups 192
Table 5.4 Inhibition data of isothiocyanate inhibitors 196
![Page 14: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/14.jpg)
14
LIST OF SCHEMES Scheme 1.1 N-acylethanolamine biosynthetic pathway 28
Scheme 1.2 Other possible biosynthetic routes of NAEs 29
Scheme 1.3 Biosynthetic pathways of 2-AG 30
Scheme 2.1 Possible mechanism of nitrene formation and nucleophilic attack of
isothiocyanate 44
Scheme 2.2 Design of bifunctional azide and isothiocyanate covalent probes 49
Scheme 2.3 Linear synthesis of 20-hydroxy methyl tetraynoate 49
Scheme 2.4 Convergent synthesis of tetraeneoates 51
Scheme 2.5 Deprotection of 10-(trimethylsilyl)deca-6,9-diyn-1-ol 51
Scheme 2.6 Functionalizing the arachidonoate tail 52
Scheme 2.7 Crude visualization of linear probes degree of freedom 55
Scheme 2.8 Anandamide and AM356 CB1 binding 56
Scheme 2.9 Synthesis of chiral head group 56
Scheme 2.10 Metabolically stable covalent probes 57
Scheme 3.1 Acyl migration from 2-AG to 1(3)-AG 93
Scheme 3.2 TIPS method for synthesizing 2-AG 94
Scheme 3.3 2-AG synthesis through benzylidene protected glycerol 95
Scheme 3.4 2-AG synthesis through glycidal ring openeing 95
Scheme 3.5: “AAA” and “ABA” triglycerides 96
Scheme 3.6 Chemoenzymatic Syntheses with immobilized Candida antarctica and
Rhizomucor miehei 98
Scheme 3.7 CAL catalyzed aminolysis of esters 104
![Page 15: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/15.jpg)
15
Scheme 4.1 Synthesis of biphenyl 2-AG analogs 132
Scheme 4.2 Continued synthesis of biphenyl 2-AG analogs 134
Scheme 4.3 Synthesis of biphenyl ether 2-AG analogs 135
Scheme 4.4 Synthesis of to 2,4-dihydroxypentan-3-arachidonoates 140
Scheme 4.5 Attempted keto-oxirane ring opening 141
Scheme 4.6 Chemoenzymatic esterification of ±butane-1,2,3-triol 142
Scheme 4.7 Successful synthetic strategy towards a monomethyl 2-AG analog 143
Scheme 5.1 Synthesis of retroamide inhibitors 186
Scheme 5.2 Synthesis of Carbonates 25-27 188
Scheme 5.3 Synthesis of Carbamates 33-36, 38 and 40-41 189
Scheme 5.4 Parallel synthesis of carbamates 191
Scheme 5.5 Synthesis of Isothiocyanate NAAA inhibitors 194
Scheme 5.6 S-alkylation inhibition mechanism of β-lactones 198
Scheme 5.7 Irreversible inhibition by AM6701 198
![Page 16: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/16.jpg)
16
ABBREVIATIONS
1,3-DBG 1,3-dibutoyl glycerol
2-AG 2-arachidonoyl glycerol
2-AGE 2-arachidonoyl glycerol ether
2-MAG 2-monoacylglycerol
AA arachidonic acid
Abh4 α/β-hydrolase-4
ACEA arachidonoyl 2'-chloroethylamine
ACPA arachidonoyl cyclopropylamine
AD Alzheimer's disease
AEA arachidonoyl ethanolamine
BOC tert-butoxycarbonyl
CAL Candida antarctica lipase
cAMP cyclic adenosine monophosphate
CB1 cannabinoid receptor 1
CB2 cannabinoid receptor 2
CNS central nervous system
DAG diacylglycerol
DBU 1,8-diazabicyclo[5.4.0]undec-7-ene
DGL diacylglycerol lipase
DMAP 4-dimethylamino pyridine
![Page 17: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/17.jpg)
17
DPPA diphenylphosphoroyl azide
EC endocannabinoid
EDCI 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide
FAAH fatty acid amide hydrolase
GPCR G-protein couped receptor
GP-NAE glycerophospho-NAE
hCB human cannabinoid receptor
IC50 half maximal inhibitory concentration
Ki binding affinity
LAPS Ligand-assisted Protein Structure
LCMS liquid chromatography mass spectrometry
MALDI-TOF matrix assisted laser desorption/ionization - time of flight
MAP mitogen-activated protein
mCB mouse cannabinoid receptor
MGL monoacylglycerol lipase
NAAA N-acylethanolamine-hydrolyzing acid amidase
NAE N-acylethanolamine
NAE-P NAE-phosphate
NAPE N-acylphosphatidylethanolamine
NAPE-PLD NAPE-hydrolyzing phospholipase D
NAT N-acyl transferase
NMR nuclear magnetic resonance
OEA oleoylethanolamine
![Page 18: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/18.jpg)
18
PA phosphatidic acid
PAMCA N-(4-methyl coumarin) palmitamide
PC phosphatidylcholine
PE phosphatidylethanolamine
PEA palmitoylethanolamine
PI phosphatidylinositol
PLA1 phospholipase A1
PMSF phenylmethylsulfonyl flouride
POPC palmitoyloleoylphosphatidylcholine
PPAR-α peroxisome proliferator-activated receptor-α
rCB rat cannabinoid receptor
SAR structure-activity relationship
TBAF tetrabutlyammonium fluoride
TFA trifluoroacetic acid
THC tetrahydrocannabinol
THF tetrahydrofuran
TIPS triisopropylsilyl
TLC thin layer chromatography
TMH transmembrane helix
TMS trimethylsilyl
UV ultraviolet
WT wild type
![Page 19: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/19.jpg)
19
CHAPTER 1
THE ENDOCANNABINOID SYSTEM
![Page 20: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/20.jpg)
20
1.1 History of Cannabis sativa
Cannabis sativa, commonly known as marijuana, has historically been used for its many
beneficial properties. Cannabis has been used since c. 2700 BC for its value in food, fiber, oil,
paper, and maybe most importantly—medicine. The Chinese were among the first to understand
the properties of marijuana consumption including their notes on psychoactive properties,
anesthesia, antiemetic, antibiotic, anthelmintic, as well as using it for over 100 additional
ailments.1 The primary psychoactive constituent responsible for many of the effects of cannabis
remained elusive until Δ9-tetrahydrocannabinol (THC, Figure 1.1) was eventually isolated and
characterized in 1964 by Mechoulam et al.2
O
OH
H
H
THC
Figure 1.1 Δ9-Tetrahydrocannabinol
1.2 The Cannabinoid Receptors
With the identification of THC, the next challenge was to determine how the body responds
when activated by cannabinoids and where this activation occurs in the body. Eventually, two
G-protein coupled receptors (GPCR) were identified, the cannabinoid 1 (CB1) receptor,
discovered in 19883 and cloned in 1990,4 and the cannabinoid 2 receptor (CB2), cloned in 1993.5
These receptors were first named as those of which respond to cannabinoids instead of naming
them after their endogenous ligands because there were no known endogenous agonists at the
time of their discovery.6 GPCRs are comprised of seven transmembrane helices connected by
seven intra and extracellular loops. The GPCRs can be divided into 5 main families: the
![Page 21: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/21.jpg)
21
rhodopsin, adhesion, frizzled/taste, glutamate, and secretin families.7 GPCRs compromise the
largest family of pharmaceutical targets for modulation.
Between the CB1 and CB2 receptors is an overall 44% homology, with 68% amino acid
sequence homology between the transmembrane domains.5 Both receptors are coupled to Gi/o
(heterotrimeric) proteins, thus there activation adenylyl cyclase, and promote mitogen-activated
protein (MAP) kinase. This reduces the production of cyclic adenosine monophosphate
(cAMP).8
GPCRs are proposed to exist in an equilibrium between various activated states. There are
believed to be the active states (R’’, R*), inactive states (R’, R), and also the signaling state
(R*G). Various levels of basal activity can suggest which state the receptor models in a ligand-
free environment.9 Interactions with different types of ligands can shift the receptors equilibrium
to different states. Agonists are ligands that activate the receptor; they can be a full agonist in
where full efficacy is observed, or a partial agonist where efficacy is reduced compared to a full
agonist. Antagonists block the activation of the receptor by agonists and thus prevent or limit a
biological response from activation. Lastly, an inverse agonist can produce a negative cellular
response through lowering the activity below the basal level.10
1.2.1 Cannabinoid Receptor Distribution
The CB1 receptor primarily resides in the central nervous system (CNS).11 CB1 is one of
the most abundant GPCRs in the brain, and is predominately located on presynaptic terminals of
neurons,12-14 but they have also been discovered on postsynaptic neurons and on glial cells.15
Outside of the CNS, the CB1 receptor has been found in the gastrointestinal tract,16
cardiovascular system,17, 18 and reproductive system.19 The CB1 receptor is highly concentrated
in the brain, with dense accumulation in basal ganglia, cerebellum, and hippocampus which
![Page 22: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/22.jpg)
22
affect motor control, cognitive function, and stress response. Much lower levels of CB1 are
observed in the lower brain stem.20
The CB2 receptor, however, is not commonly observed in the CNS,21 and is customarily
expressed in the immune system.22 The concentrations of the CB2 receptor were first measured in
the spleen, thymus, tonsils, and peripheral blood mononuclear cells.23 More recently, expression
of CB2 receptors in the spinal cord under neuropathic conditions has been discussed.24
1.2.2 Cannabinoid Receptor Modulation
CB receptor activation involves the inhibition of adenyl cyclase which leads to decreased
production of cAMP.25 Calcium influx and subsequent neurotransmitter release can also be
inhibited by CB receptor stimulation,26 while activation of ATP-sensitive potassium channels is
observed through the induction of antinociception,27 as well as MAP kinase activation.28, 29
Cannabinoid agonists have shown to activate subtypes of Gi/o α subunits by using a GTP
photoaffinity analog and measured through [35S]GTPγS binding.30 While mu and delta opioid
receptors can activate as many as 20 G-proteins, CB1 receptor binding has been shown to
activate only three G-proteins.31 [35S]GTPγS binding is utilized to measure agonist efficacy with
regards to G-protein activation.32
1.2.3 Compounds Interacting with the Cannabinoid Receptors
There are four main classes of compounds that are known to activate both the CB1 and
CB2 receptor. They include classical, nonclassical, aminoalkylindole, and eicosanoid (Figure
1.2). Classical cannabinoids are either plant derived or analogs of the tricyclic dibenzopyran
structure.33 Nonclassical compounds do resemble THC, however, they usually lack a pyran ring.
Pfizer developed CP55,940 which is one of the most widely used ligands for the study of the
cannabinoid system.34 WIN55,212-2 was one of the first compounds to produce pharmacological
![Page 23: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/23.jpg)
23
effects similar to that of THC, in which the structure bare no resemblance to that of any classical
cannabinoid or nonclassical analog.35 Eicosanoids, represented by anandamide, are the class of
compounds which are biosynthesized on demand and referred to as endocannabinoids (EC),
which are discussed in Section 1.3.
Classical Nonclassical
O
OH
H
H
THC HO
OH
CP55,940
Aminoalkylindole Eicosanoid
O
NO
N
O
WIN55,212-2
O
NH
OH
Anandamide
Figure 1.2 Class examples of compounds activating CB1 and CB2 receptors
Selective CB1 agonists were developed to improve on the low selectivity of anandamide
through modification of the amide head group. Two of the more potent CB1 selective agonists are
arachidonoyl 2’-chloroethylamide (ACEA) and arachidonoyl cyclopropylamine (ACPA, Figure
1.3).36 ACEA has binding affinities of 1.4 nM and >2000 nM for CB1 and CB2 respectively
while ACPA has affinities of 1.4 nM and 715 nM respectively. However, these compounds lack
![Page 24: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/24.jpg)
24
enzymatic stability towards fatty acid amide hydrolase (FAAH). This lead to the development of
(R)-methanandamide (see Chapter 2, Scheme 2.8) and O-1812, where the insertion of a 1’
methyl provided resistance to hydrolysis from FAAH.37
O
NH
Cl
ACEA
O
NH
ACPA
O
NH
OH
O-1812 CN
Figure 1.3 Selective CB1 Agonists
Examples of CB1 receptor antagonists and inverse agonists can be seen in Figure 1.4.
SR141716A, also known as Rimonabant, is a ligand developed by Sanofi-Aventis. First
classified as a CB1 selective antagonist with binding affinity of 1.98 nM for the CB1 receptor and
>1000 nM towards CB2,38 there is evidence it may also behave as an inverse agonist.39 More
recent reports indicate this inverse agonism may not be CB1 mediated.40 AM251 is a close analog
of Rimonabant with similar properties.41 LY320135 is chemically distinct from Rimonabant and
AM251, as it features a benzopyran as opposed to the diarylpyrazole of the other ligands, but it is
less potent towards the CB1 receptor with an affinity of 141 nM.42
![Page 25: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/25.jpg)
25
NN
ONH
Cl
Cl
Cl
NN
ONH
Cl
Cl
I
SR141716A AM251
OO
O
O
CN
LY320135
Figure 1.4 CB1 receptor antagonists and inverse agonists
CB2 selective agonists can include a variety of structural motifs, including the classical
cannabinoid analog JWH133 (Figure 1.5) which exhibits CB1 and CB2 binding affinities of 677
nM and 3.4 nM respectively. AM1241 is an indole-based ligand with receptor affinities of 280
nM and 3.4 nM. Another selective agonist is the nonclassical-like HU308 with an affinity
towards CB2 of 22.7 nM. Potent CB2 selective inverse agonists/antagonists include SR144528
and AM630. The first is a diarylpyrazole and the later is an N-alkyl indole (Figure 1.6).
OH
H
JWH133
O
HU308
O
HO
N
O
N
NO2
IAM241
Figure 1.5 CB2 selective agonists
![Page 26: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/26.jpg)
26
NN
ONH
Cl
SR144528
N
N
O
O
OI
AM630
Figure 1.6 CB2 selective inverse agonists/antagonists
1.3 The Endocannabinoids
An endocannabinoid, is an endogenous compound that interacts with the cannabinoid (CB)
receptors as its primary function.43 The two most studied endocannabinoids are anandamide
(AEA)44 and 2-arachiconoylglycerol (2-AG) (Figure 1.7).45 Additional endogenous CB agonists
include homo-γ-linolenoylethanolamide and docosatetraenoylethanolamide,46 noladin ether,47 N-
oleoyl dopamine48, N-arachidonoyl dopamine,49 oleamide and virodhamine (Figure 1.8).50
O
NH
OH
AEA
O
OOH
OH
2-AG
Figure 1.7 The primary endocannabinoids Anandamide and 2-Arachidonoyl glycerol
![Page 27: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/27.jpg)
27
NH
OOH
docosatetraenoylethanolamide
NH
OOH
homo-y-linolenoylethanolamide
OOH
OH
noladin ether
NH2
O
oleamide
NH
OOH
OH
N-oleoyl dopamine
O
NH
N-arachidonoyl dopamine
OH
OH
O
ONH2
virodhamine
Figure 1.8 Other possible endocannabinoids
The first endocannabinoid was isolated from porcine brain in 1992. It was determined
that the structure was N-arachidonoylethanolamine (AEA), named anandamide from the Sanskrit
‘ananda’ meaning bliss and ‘amide’ for its chemical features .44 A second endocannabinoid, 2-
AG, was isolated from canine gut in 1995 and found to bind to the CB receptors.45
1.3.1 Endocannabinoid Biosynthesis
The hydrophobic properties of endocannabinoids do not allow them to be stored, rather,
they are biosynthesized based on necessity.51 Anadamide, belonging to the class of N-
acylethanolamines (NAEs), is formed in animal tissue through a common pathway. NAE
biosynthesis is commonly referred as the ‘transacylation-phosphodiesterase pathway’—where,
starting from glycerophospholipids, N-acyl transferase (NAT), and N-
acylphosphatidylethanolamine-hydrolyzing phospholipase D (NAPE-PLD) catalyze the two
steps which complete the process (Scheme 1.1).52,53,54
The transfer of a fatty acyl chain from the sn-1 position of glycerophospholipids (in
phosphatidylcholine [PC]) to the amino group of phosphatidylethanolamine (PE) is catalyzed by
the calcium dependent NAT to form N-acylphophatidylethanolamine (NAPE, Scheme 1.1). The
![Page 28: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/28.jpg)
28
dependency of NAT on Ca2+ makes this first step the rate-limiting step.52, 53 In the second step,
NAPE-PLD hydrolyzes NAPE to NAE and phosphatidic acid (PA). 54
Scheme 1.1 N-acylethanolamine biosynthetic pathways
O
R1O
O R2
OO
POH
O
OH2N
PE
O
R3O
O R4
OO
POH
O
ON
PC
O
R1O
O R2
OO
POH
O
OHNR3
O NAPE
HO
O R4
OO
POH
O
ON
Lyso PC
NAT
OHHNR3
O
O
R1O
O R2
OO
POH
O
HOPANAE
NAPE-PLD
H2O
There are possible alternative pathways by which NAEs can be formed (Scheme 1.2).
Starting from NAPEs, hydrolysis of the O-acyl chains leads to either NAE-P (N-
acylethanolamine-phosphate) or lyso-NAPE. The phosphate group can be hydrolyzed from
NAE-P or the phosphodiester can be hydrolyzed from lyso-NAPE to form NAEs. Additionally,
α/β-hydrolase-4 (Abh4) can deacylate lyso-NAPE to glycerophospho-NAE (GP-NAE) which can
![Page 29: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/29.jpg)
29
then be hydrolyzed to NAEs.54, 55 These alternative pathways may be just as important as NAPE-
PLD in the formation of NAEs. Cravatt et al. used NAPE-PLD(-/-) mice to measure NAPE-PLD
activity and endogenous levels of NAPEs and NAEs. As expected, NAPE-PLD activity was
decreased as well as saturated NAEs, however, the levels of polyunsaturated NAEs, including
anandamide, in the NAPE-PLD(-/-) mice were unchanged. This led to the conclusion that
NAPE-PLD is not the only contributor to the biosynthesis of NAEs.56
Scheme 1.2 Other possible biosynthetic routes of NAEs
O
R1O
O R2
OO
POH
O
OHNR3
O NAPE
OHP
OH
O
OHNR3
O
O
R1O
OHO
POH
O
OHNR3
O
OHHNR3
ONAE
HO
OHO
POH
O
OHNR3
ONAPE-PLD
PLC PLA2
NAE-P
Phosphatase Lyso-PLDGP-NAEPhosphodiesterase
GP-NAELyso-NAPE
ABH4
In the biosynthesis of 2-AG, arachidonic acid containing phosphatidylinositol (PI,
Scheme 1.3) is cleaved at the sn-1 position by phospholipase C (PLC) to provide the
diacylglycerol (DAG).57 This remaining acyl group at the sn-1 position of DAG is cleaved by
diacylglycerol lipase (DGL), which exists in an α and β form, although evidence suggests DGLα
is important in the biosynthesis of 2-AG.58 Another pathway proceeds through Lyso-PI which is
produced through the cleavage of an acyl group of PI by phospholipase A1 (PLA1). 2-AG is then
produced after PI specific cleavage from lyso PI-PLC.57
![Page 30: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/30.jpg)
30
Scheme 1.3 Biosynthetic pathways of 2-AG
AA
O
OP
O
R
O
OH
O
HO
HO
OHOH
OH
PI
PLC
PLA1
AA
OH
O
O
R
DAG
AA
OH
OP
O
OH
O
HO
HO
OHOH
OH
Lyso PI
Lyso PI-PLCDAGL
O
O
OH
OH
2-AG
OH
O
= AA
1.4 Metabolizing Enzymes
The endocannabinoid system is activated by the endocannabinoids biosynthesized on
demand. There are several metabolizing enzymes that are responsible for the degradation of the
endocannabinoids in order to regulate their endogenous levels. These include fatty acid amide
hydrolase (FAAH), monoacylglycerol lipase (MGL), and N-acylethanolamine-hydrolyzing acid
amidase (NAAA).
1.4.1 Fatty Acid Amide Hydrolase - FAAH
Upon metabolism, anandamide is enzymatically hydrolyzed into arachidonic acid and
ethanolamide.59 This metabolizing enzyme was cloned in 1996 by Cravatt, et al., and
distinguished as FAAH, to encompass the fatty acid amides this enzyme was capable of
![Page 31: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/31.jpg)
31
hydrolyzing.60 FAAH was established as the primary metabolizing enzyme of anandamide,
when FAAH-/- knockout mice exhibited a 1500% increase in anandamide levels over wild type.61
FAAH belongs to the amidase family of proteins. Its catalytic activity proceeds through
an unusual mechanism where a non-histidine residue is responsible for activation (histidine most
commonly activates the catalytic serine). Lysine 142 acts as the base in FAAH regulated
metabolism. This activates the serine nucleophile for hydrolytic action.62 The structure of FAAH
consists of a twisted β-sheet with eleven strands encompassed by α-helices. The crystal structure
identified two channels that hold the hydrophobic acyl chain, called the acyl chain binding
channel, and the cytoplasmic-access channel responsible for housing the more polar
ethanolamine.63
With FAAH’s primary function of regulating endocannabinoids, inhibition of this
enzyme should subsequently increase EC levels. This therapeutic potential has seen promise
with regards to neurodegenerative diseases. Endocannabinoids are produced in response to
neurologic trauma of the brain, and an increase in ECs can produce additional therapeutic
relief.64 Inhibition of FAAH has also shown effects toward nicotine reward and dependence.
Besides increasing levels of AEA, inhibition also increases levels of oleoylethanolamide (OEA)
and palmitoylethanolamide (PEA) which can interact with other receptors.65 D’Addario, et al.,
reported that up-regulation of FAAH mRNA is observed in subjects with Alzheimer’s disease
(AD), which results in increased metabolites of AEA, and may lead to increased inflammation
that occurs in AD.66
Phenylmethylsulfonyl fluoride (PMSF, Figure 1.9) was one of the first compounds used
for the inhibition of FAAH. PMSF is a non-selective serine protease inhibitor with an IC50 value
of 290 nM towards FAAH, where pretreatment of this inhibitor has shown to increase AEA
![Page 32: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/32.jpg)
32
levels.67 URB597 is a potent selective irreversible carbamate inhibitor of FAAH with an IC50 of
4.6 nM; while the reversible FAAH inhibitor OL-135 has an IC50 of 2.1 nM.68
SO
OF
PMSF
H2N O
OHN
O
URB597
O
N
O
N
OL-135
Figure 1.9 FAAH inhibitors
1.4.2 Monoacylglycerol Lipase – MGL
MGL was first purified in 1976 from rat adipose tissue and found to be inactivated by
sulfhydryl agents.69 Karlsson, et al., cloned MGL and reported the complete amino acid
sequence containing 302 amino acids. They also identified the catalytic triad of serine 122,
aspartic acid 239, and histidine 269.70 The report of a MGL crystal structure indicates it exists as
a dimer with specific hydrophobic and hydrophilic channels that accommodate 2-AG for
hydrolysis. Cysteine 201 was also identified as a key residue involved in the inhibition of this
metabolizing enzyme.71
Blankman, et al., reported that 85% of all 2-AG metabolism was a result of MGL
activity, with a majority of the remaining hydrolysis mediated by α/β-hydrolase domain-
containing protein-6 and -12.72 Increasing the levels of 2-AG through MGL inhibition produced
behavioral effects in mice similar to those observed with CB1 agonists, such as, analgesia,
hypomotility, and hypothermia.73
One of the more potent and most commonly studied MGL inhibitors is JZL184 (Figure
1.10) with an IC50 value of 8 nM. This inhibition produces cannabinoid behavioral effects such as
analgesia, hypomotility and hypothermia.73
![Page 33: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/33.jpg)
33
O2N
O O
N
OH
O
OO
O
JZL184
Figure 1.10 MGL inhibitor JZL184
1.4.3 N-Acylethanolamine-Hydrolyzing Acid Amidase – NAAA
After the initial identification,74 cloning and characterization,75 NAAA has been
identified as the primary enzyme responsible for PEA hydrolysis, as well as hydrolyzing OEA
and AEA, in many mammalian tissues, organs, and some components of the immune system
(e.g. macrophages).74-77 While NAAA is responsible for the hydrolysis of amides, it is distinctly
different from FAAH.78 These enzymes differ in their primary amino acid sequence and
enzymatic properties. While NAAA is present in the lysosomes, FAAH is primarily distributed
in the cytosolic and luminal sides of intracellular membranes.79 These enzymes appear to have
similar roles, however, their primary substrates are different. NAAA hydrolyzes PEA at a rate
approximately forty times greater than it does AEA,75 while FAAH hydrolyzes PEA eight times
slower than AEA.80 The activity of NAAA is greatest at pH 4-5, whereas FAAH’s peak activity
occurs at pH 8.5-10.81 NAAA is an N-terminal nucleophile hydrolase with a cysteine (Cys126 in
the human enzyme) residue serving as the catalytic nucleophile,75 confirmed by mutagenesis82
and mass spectrometry studies.83
The increase of PEA and OEA through inhibition of NAAA causes increased activatation
of the peroxisome proliferator-activated receptor-α (PPAR-α).84, 85 PEA activation of PPAR-α
produces anti-nociceptive and anti-inflammatory effects.86 While PEA’s activity at the CB1 and
![Page 34: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/34.jpg)
34
CB2 is unclear, it has been hypothesized that PEA participates in an ‘entourage effect’ where
NAEs compete for the active sites of FAAH, and therefore increase the biological activity of
anandamide by impeding its degradation.87 Current reported inhibitors of NAAA are discussed in
Chapter 5.
1.5 Endocannabinoid System Retrograde Signaling
The endocannabinoid system operates under a retrograde signaling pathway.88
Endocannabinoid biosynthesis can be triggered through three mechanisms; Ca2+ elevation
through strong depolarization, Gq-coupled receptor activation, or mild depolarization along with
mild receptor activation.89 Calcium level increase activates the enzymes responsible for
endocannabinoid biosynthesis.90 AEA and 2-AG then migrate after postsynaptic release to
activate presynaptic CB1 receptors.91 This receptor activation then closes Ca2+ channels,
activates K+ channels, and inhibits neurotransmitter release, which stops endocannabinoid
production.89 AEA is then metabolized by FAAH, and 2-AG metabolized by MGL. This
retrograde signaling has implications in areas such as, motor control,92 memory,93 and
neuropathological states.94
1.6 Goal of Thesis Research
The previous review describes important features of the endocannabinoid system that will be
focused on in the following work. The tone of the endocannabinoid is a system can be affected
through a change to receptors, enzymes or biosynthesis/metabolism of endogenous ligands that
work within the system. The compounds prepared here interact with many components in the
endocannabinoid system. Endogenous ligands (AEA and 2-AG) activate both the CB1 and CB2
receptors, while enzymes like FAAH, MGL, and NAAA can directly modify their levels while
also affecting the levels of secondary endocannabinoids.
![Page 35: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/35.jpg)
35
Anandamide based ligands can activate both receptors and is hydrolyzed by FAAH and
NAAA. It is our goal to understand the interactions between this AEA and the CB receptors. It
is our hypothesis that modifying the anandamide head group and altering the tail length of the
ligand combined with a covalent probe can increase the compounds ability to covalent label the
receptor. These interactions are incredibly useful for ligand-assisted protein structure (LAPS)
experiments. This information will help map out the functional selectivity of endocannabinoids
compared to that of other classes of compounds that can activate the CB receptors. We believe
that modifying the head group of the probes can also increase metabolic stability of amide based
ligands in the presence of FAAH, likewise, the same goal is set for analogs of 2-AG.
2-AG the second principle endocannabinoid is difficult to study due to chemical and
metabolic instabilities. Our hypothesis is that through modification of the ligand, we can
produce analogs that will be stable in the presence of metabolizing enzymes so that a
pharmacological profile can be observed.
NAAA can hydrolyze AEA as well as PEA, and it has been observed that affecting the
levels of these endogenous ligands has implications to other endocannabinoids involvement with
FAAH. Our hypothesis is that through the inhibition of NAAA we can increase the therapeutic
effects observed from increased levels of both AEA and PEA. We believe various classes of
compounds (carbamates, carbonates, and isothiocyanates) will behave as potent covalent
inhibitors of the enzymes catalytic cysteine residue.
![Page 36: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/36.jpg)
36
1.7 References
1. Mathre, M. L. Cannabis in Medical Practice: A Legal, Historical, and Pharmacological Overview of the Therapeutic Use of Marijuana. McFarland & Company, Inc.: 1997; p 239. 2. Gaoni, Y.; Mechoulam, R. Isolation, Structure and Partial Synthesis of an Active Constituent of Hashish. Journal of the American Chemical Society 1964, 86, 1646-1647. 3. Devane, W. A.; Dysarz, F. A.; Johnson, M. R.; Melvin, L. S.; Howlett, A. C. Determination and characterization of a cannabinoid receptor in rat brain. Molecular Pharmacology 1988, 34, 605-613. 4. Matsuda, L. A.; Lolait, S. J.; Brownstein, M. J.; Young, A. C.; Bonner, T. I. Structure of a Cannabinoid Receptor and Functional Expression of the Cloned cDNA. Nature 1990, 346, 561-564. 5. Munro, S.; Thomas, K. L.; Abu, S. M. Molecular Characterization of a Peripheral Receptor for Cannabinoids. Nature 1993, 61-65. 6. Pertwee, R. G.; Howlett, A. C.; Abood, M.; Barth, F.; Bonner, T. I.; Cabral, G.; Casellas, P.; Cravatt, B. F.; Devane, W. A.; Elphick, M. R.; Felder, C. C.; Herkenham, M.; Kunos, G.; Mackie, K.; Martin, B. R.; Mechoulam, R. Cannabinoid receptors, introductory chapter. http://www.iuphar-db.org/DATABASE/FamilyIntroductionForward?familyId=13 (Accessed on 27/06/2012.). 7. Kobilka, B. K. G protein coupled receptor structure and activation. Biochimica et Biophysica Acta (BBA) - Biomembranes 2007, 1768, 794-807. 8. Svíženská, I.; Dubový, P.; Šulcová, A. Cannabinoid receptors 1 and 2 (CB1 and CB2), their distribution, ligands and functional involvement in nervous system structures — A short review. Pharmacology Biochemistry and Behavior 2008, 90, 501-511. 9. Katritch, V.; Cherezov, V.; Stevens, R. C., Structure-Function of the G Protein-Coupled Receptor Superfamily. Annu. Rev. Pharmacool. Toxicol. 2012, 53, 25.1-25.25 10. Park, P. S.-H.; Lodowski, D. T.; Palczewski, K. Activation of G Protein–Coupled Receptors: Beyond Two-State Models and Tertiary Conformational Changes. Annual Review of Pharmacology and Toxicology 2008, 48, 107-141. 11. Glass, M.; Faull, R. L. M.; Dragunow, M. Cannabinoid receptors in the human brain: a detailed anatomical and quantitative autoradiographic study in the fetal, neonatal and adult human brain. Neuroscience 1997, 77, 299-318. 12. Katona, I.; Sperlágh, B.; Sık, A.; Käfalvi, A.; Vizi, E. S.; Mackie, K.; Freund, T. F. Presynaptically Located CB1 Cannabinoid Receptors Regulate GABA Release from Axon Terminals of Specific Hippocampal Interneurons. The Journal of Neuroscience 1999, 19, 4544-4558. 13. Marsicano, G.; Lutz, B. Expression of the cannabinoid receptor CB1 in distinct neuronal subpopulations in the adult mouse forebrain. European Journal of Neuroscience 1999, 11, 4213-4225. 14. Tsou, K.; Mackie, K.; Sañudo-Peña, M. C.; Walker, J. M. Cannabinoid CB1 receptors are localized primarily on cholecystokinin-containing GABAergic interneurons in the rat hippocampal formation. Neuroscience 1999, 93, 969-975. 15. Rodrıguez, J. J.; Mackie, K.; Pickel, V. M. Ultrastructural Localization of the CB1 Cannabinoid Receptor in μ-Opioid Receptor Patches of the Rat Caudate Putamen Nucleus. The Journal of Neuroscience 2001, 21, 823-833.
![Page 37: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/37.jpg)
37
16. Croci, T.; Manara, L.; Aureggi, G.; Guagnini, F.; Rinaldi-Carmona, M.; Maffrand, J.-P.; Le Fur, G.; Mukenge, S.; Ferla, G. In vitro functional evidence of neuronal cannabinoid CB1 receptors in human ileum. British Journal of Pharmacology 1998, 125, 1393-1395. 17. Wagner, J. A.; Járai, Z.; Bátkai, S.; Kunos, G. Hemodynamic effects of cannabinoids: coronary and cerebral vasodilation mediated by cannabinoid CB1 receptors. European Journal of Pharmacology 2001, 423, 203-210. 18. Szabo, B.; Nordheim, U.; Niederhoffer, N. Effects of Cannabinoids on Sympathetic and Parasympathetic Neuroeffector Transmission in the Rabbit Heart. Journal of Pharmacology and Experimental Therapeutics 2001, 297, 819-826. 19. Peralta, L.; Agirregoitia, E.; Mendoza, R.; Expósito, A.; Casis, L.; Matorras, R.; Agirregoitia, N. Expression and localization of cannabinoid receptors in human immature oocytes and unfertilized metaphase-II oocytes. Reproductive BioMedicine Online 2011, 23, 372-379. 20. Herkenham, M.; Lynn, A. B.; Little, M. D.; Johnson, M. R.; Melvin, L. S.; de Costa, B. R.; Rice, K. C. Cannabinoid receptor localization in brain. Proceedings of the National Academy of Sciences 1990, 87, 1932-1936. 21. Griffin, G.; Wray, E. J.; Tao, Q.; McAllister, S. D.; Rorrer, W. K.; Aung, M.; Martin, B. R.; Abood, M. E. Evaluation of the cannabinoid CB2 receptor-selective antagonist, SR144528: further evidence for cannabinoid CB2 receptor absence in the rat central nervous system. European Journal of Pharmacology 1999, 377, 117-125. 22. Berdyshev, E. V. Cannabinoid receptors and the regulation of immune response. Chemistry and Physics of Lipids 2000, 108, 169-190. 23. Galiegue, S.; Mary, S.; Marchand, J.; Dussossoy, D.; Carriere, D.; Carayon, P.; Bouaboula, M.; Shire, D.; Le Fur, G.; Casellas, P. Expression of central and peripheral cannabinoid receptors in human immune tissues and leukocyte subpopulations. European Journal of Biochemistry 1995, 232, 54-61. 24. Brownjohn, P. W.; Ashton, J. C. Spinal cannabinoid CB2 receptors as a target for neuropathic pain: an investigation using chronic constriction injury. Neuroscience 2012, 203, 180-93. 25. Howlett, A. C. Pharmacology of cannabinoid receptors. Annual Review of Pharmacology and Toxicology 1995, 35, 607-34. 26. Daniel, H.; Rancillac, A.; Crepel, F. Mechanisms underlying cannabinoid inhibition of presynaptic Ca2+ influx at parallel fibre synapses of the rat cerebellum. J Physiol 2004, 557, 159-74. 27. Reis, G. M.; Ramos, M. A.; Pacheco Dda, F.; Klein, A.; Perez, A. C.; Duarte, I. D. Endogenous cannabinoid receptor agonist anandamide induces peripheral antinociception by activation of ATP-sensitive K+ channels. Life Sciences 2011, 88, 653-7. 28. Paszcuk, A. F.; Dutra, R. C.; da Silva, K. A.; Quintao, N. L.; Campos, M. M.; Calixto, J. B. Cannabinoid agonists inhibit neuropathic pain induced by brachial plexus avulsion in mice by affecting glial cells and MAP kinases. PLoS One 2011, 6, e24034. 29. Rajesh, M.; Mukhopadhyay, P.; Hasko, G.; Liaudet, L.; Mackie, K.; Pacher, P. Cannabinoid-1 receptor activation induces reactive oxygen species-dependent and -independent mitogen-activated protein kinase activation and cell death in human coronary artery endothelial cells. British Journal of Pharmacology 2010, 160, 688-700.
![Page 38: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/38.jpg)
38
30. Prather, P. L.; Martin, N. A.; Breivogel, C. S.; Childers, S. R. Activation of cannabinoid receptors in rat brain by WIN 55212-2 produces coupling to multiple G protein alpha-subunits with different potencies. Molecular Pharmacology 2000, 57, 1000-10. 31. (i) Saidak, Z.; Blake-Palmer, K.; Hay, D. L.; Northup, J. K.; Glass, M., Differential activation of G-proteins by mu-opioid receptor agonists. Br. J. Pharmacol. 2006, 147 (6), 671-80. (ii) Breivogel, C. S.; Sim, L. J.; Childers, S. R. Regional differences in cannabinoid receptor/G-protein coupling in rat brain. Journal of Pharmacology and Experimental Therapeutics 1997, 282, 1632-42. 32. Howlett, A. C.; Breivogel, C. S.; Childers, S. R.; Deadwyler, S. A.; Hampson, R. E.; Porrino, L. J. Cannabinoid physiology and pharmacology: 30 years of progress. Neuropharmacology 2004, 47 Suppl 1, 345-58. 33. Papahatjis, D. P.; Nikas, S. P.; Kourouli, T.; Chari, R.; Xu, W.; Pertwee, R. G.; Makriyannis, A. Pharmacophoric Requirements for the Cannabinoid Side Chain. Probing the Cannabinoid Receptor Subsite at C1‘. Journal of Medicinal Chemistry 2003, 46, 3221-3229. 34. Howlett, A. C.; Johnson, M. R.; Melvin, L. S.; Milne, G. M. Nonclassical cannabinoid analgetics inhibit adenylate cyclase: development of a cannabinoid receptor model. Molecular Pharmacology 1988, 33, 297-302. 35. Compton, D. R.; Gold, L. H.; Ward, S. J.; Balster, R. L.; Martin, B. R. Aminoalkylindole analogs: cannabimimetic activity of a class of compounds structurally distinct from delta 9-tetrahydrocannabinol. Journal of Pharmacology and Experimental Therapeutics 1992, 263, 1118-1126. 36. Hillard, C. J.; Manna, S.; Greenberg, M. J.; DiCamelli, R.; Ross, R. A.; Stevenson, L. A.; Murphy, V.; Pertwee, R. G.; Campbell, W. B. Synthesis and characterization of potent and selective agonists of the neuronal cannabinoid receptor (CB1). Journal of Pharmacology and Experimental Therapeutics 1999, 289, 1427-33. 37. Di Marzo, V.; Bisogno, T.; De Petrocellis, L.; Brandi, I.; Jefferson, R. G.; Winckler, R. L.; Davis, J. B.; Dasse, O.; Mahadevan, A.; Razdan, R. K.; Martin, B. R. Highly selective CB(1) cannabinoid receptor ligands and novel CB(1)/VR(1) vanilloid receptor "hybrid" ligands. Biochemical and Biophysical Research Communications 2001, 281, 444-51. 38. Rinaldi-Carmona, M.; Barth, F.; Heaulme, M.; Shire, D.; Calandra, B.; Congy, C.; Martinez, S.; Maruani, J.; Neliat, G.; Caput, D.; et al. SR141716A, a potent and selective antagonist of the brain cannabinoid receptor. FEBS Letters 1994, 350, 240-4. 39. MacLennan, S. J.; Reynen, P. H.; Kwan, J.; Bonhaus, D. W. Evidence for inverse agonism of SR141716A at human recombinant cannabinoid CB1 and CB2 receptors. British Journal of Pharmacology 1998, 124, 619-22. 40. Erdozain, A. M.; Diez-Alarcia, R.; Meana, J. J.; Callado, L. F. The inverse agonist effect of rimonabant on G protein activation is not mediated by the cannabinoid CB1 receptor: evidence from postmortem human brain. Biochemical Pharmacology 2012, 83, 260-8. 41. Lan, R.; Liu, Q.; Fan, P.; Lin, S.; Fernando, S. R.; McCallion, D.; Pertwee, R.; Makriyannis, A. Structure-activity relationships of pyrazole derivatives as cannabinoid receptor antagonists. Journal of Medicinal Chemistry 1999, 42, 769-76. 42. Felder, C. C.; Joyce, K. E.; Briley, E. M.; Glass, M.; Mackie, K. P.; Fahey, K. J.; Cullinan, G. J.; Hunden, D. C.; Johnson, D. W.; Chaney, M. O.; Koppel, G. A.; Brownstein, M. LY320135, a novel cannabinoid CB1 receptor antagonist, unmasks coupling of the CB1 receptor to stimulation of cAMP accumulation. Journal of Pharmacology and Experimental Therapeutics 1998, 284, 291-7.
![Page 39: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/39.jpg)
39
43. Lambert, D. M.; Fowler, C. J. The Endocannabinoid System: Drug Targets, Lead Compounds, and Potential Therapeutic Applications. Journal of Medicinal Chemistry 2005, 48, 5059-5087. 44. Devane, W.; Hanus, L.; Breuer, A.; Pertwee, R.; Stevenson, L.; Griffin, G.; Gibson, D.; Mandelbaum, A.; Etinger, A.; Mechoulam, R. Isolation and structure of a brain constituent that binds to the cannabinoid receptor. Science 1992, 258, 1946-1949. 45. Mechoulam, R.; Ben-Shabat, S.; Hanus, L.; Ligumsky, M.; Kaminski, N. E.; Schatz, A. R.; Gopher, A.; Almog, S.; Martin, B. R.; Compton, D. R.; Pertwee, R. G.; Griffin, G.; Bayewitch, M.; Barg, J.; Vogel, Z. Identification of an endogenous 2-monoglyceride, present in canine gut, that binds to cannabinoid receptors. Biochemical Pharmacology 1995, 50, 83-90. 46. Hanus, L.; Gopher, A.; Almog, S.; Mechoulam, R. Two New Unsaturated Fatty Acid Ethanolamides in Brain That Bind to the Cannabinoid Receptor. Journal of Medicinal Chemistry 1993, 36, 3032-3034. 47. Sugiura, T.; Kondo, S.; Sukagawa, A.; Nakane, S.; Shinoda, A.; Itoh, K.; Yamashita, A.; Waku, K. 2-Arachidonoylgylcerol: A Possible Endogenous Cannabinoid Receptor Ligand in Brain. Biochemical and Biophysical Research Communications 1995, 215, 89-97. 48. Bobrov, M. Y.; Lizhin, A. A.; Andrianova, E. L.; Gretskaya, N. M.; Frumkina, L. E.; Khaspekov, L. G.; Bezuglov, V. V. Antioxidant and neuroprotective properties of N-arachidonoyldopamine. Neuroscience Letters 2008, 431, 6-11. 49. Hu, S. S.; Bradshaw, H. B.; Benton, V. M.; Chen, J. S.; Huang, S. M.; Minassi, A.; Bisogno, T.; Masuda, K.; Tan, B.; Roskoski, R., Jr.; Cravatt, B. F.; Di Marzo, V.; Walker, J. M. The biosynthesis of N-arachidonoyl dopamine (NADA), a putative endocannabinoid and endovanilloid, via conjugation of arachidonic acid with dopamine. Prostaglandins Leukotrienes and Essential Fatty Acids 2009, 81, 291-301. 50. Vandevoorde, S.; Lambert, D. M. Focus on the Three Key Enzymes Hydrolysing Endocannabinoids as New Drug Targets. Current Pharmaceutical Design 2005, 11, 2647-2668. 51. Fowler, C. J. The cannabinoid system and its pharmacological manipulation - a review, with emphasis upon uptake and the hydrolysis of anandamide. Fundamental & clinical Pharmacology 2006, 20. 52. Schmid, H. H. O.; Schmid, P. C.; Natarajan, V. N-Acylated glycerophospholipids and their derivatives. Progress in Lipid Research 1990, 29, 1-43. 53. Schmid, H. H. O.; Schmid, P. C.; Berdyshev, E. V. Cell signaling by endocannabinoids and their congeners: questions of selectivity and other challenges. Chemistry and Physics of Lipids 2002, 121, 111-134. 54. Okamoto, Y.; WAng, J.; Morishita, J.; Ueda, N. Biosynthetic Pathways of the Endocannabinoid Anandamide. Chemistry & Biodiversity 2007, 4. 55. Natarajan, V.; Schmid, P. C.; Reddy, P. V.; Schmid, H. H. O. Catabolism of N-Acylethanolamine Phospholipids by Dog Brain Preparations. Journal of Neurochemistry 1984, 42, 1613-1619. 56. Cravatt, B. F.; Sorensen, E. J. Chemical strategies for the global analysis of protein function. Current Opinion in Chemical Biology 2000, 4, 663-668. 57. Ueda, N.; Tsuboi, K.; Uyama, T.; Ohnishi, T. Biosynthesis and degradation of the endocannabinoid 2-arachidonoylglycerol. Biofactors 2011, 37, 1-7. 58. Tanimura, A.; Yamazaki, M.; Hashimotodani, Y.; Uchigashima, M.; Kawata, S.; Abe, M.; Kita, Y.; Hashimoto, K.; Shimizu, T.; Watanabe, M.; Sakimura, K.; Kano, M. The
![Page 40: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/40.jpg)
40
Endocannabinoid 2-Arachidonoylglycerol Produced by Diacylglycerol Lipase α Mediates Retrograde Suppression of Synaptic Transmission. Neuron 2010, 65, 320-327. 59. Deutsch, D. G.; Chin, S. A. Enzymatic synthesis and degradation of anandamide, a cannabinoid receptor agonist. Biochemical Pharmacology 1993, 46, 791-796. 60. Cravatt, B. F.; Giang, D. K.; Mayfield, S. P.; Boger, D. L.; Lerner, R. A.; Gilula, N. B. Molecular characterization of an enzyme that degrades neuromodulatory fatty-acid amides. Nature 1996, 384, 83-7. 61. Lichtman, A. H.; Shelton, C. C.; Advani, T.; Cravatt, B. F. Mice lacking fatty acid amide hydrolase exhibit a cannabinoid receptor-mediated phenotypic hypoalgesia. Pain 2004, 109, 319-27. 62. Patricelli, M. P.; Cravatt, B. F. Fatty acid amide hydrolase competitively degrades bioactive amides and esters through a nonconventional catalytic mechanism. Biochemistry 1999, 38, 14125-30. 63. Bracey, M. H.; Hanson, M. A.; Masuda, K. R.; Stevens, R. C.; Cravatt, B. F. Structural adaptations in a membrane enzyme that terminates endocannabinoid signaling. Science 2002, 298, 1793-6. 64. Micale, V.; Mazzola, C.; Drago, F. Endocannabinoids and neurodegenerative diseases. Pharmacological Research 2007, 56, 382-92. 65. Muldoon, P. P.; Lichtman, A. H.; Parsons, L. H.; Damaj, M. I. The role of fatty acid amide hydrolase inhibition in nicotine reward and dependence. Life Sciences 2012. 66. D'Addario, C.; Di Francesco, A.; Arosio, B.; Gussago, C.; Dell'osso, B.; Bari, M.; Galimberti, D.; Scarpini, E.; Altamura, A. C.; Mari, D.; Maccarrone, M. Epigenetic regulation of Fatty Acid amide hydrolase in Alzheimer disease. PLoS One 2012, 7, e39186. 67. Wiley, J. L.; Dewey, M. A.; Jefferson, R. G.; Winckler, R. L.; Bridgen, D. T.; Willoughby, K. A.; Martin, B. R. Influence of phenylmethylsulfonyl fluoride on anandamide brain levels and pharmacological effects. Life Sciences 2000, 67, 1573-83. 68. Boger, D. L.; Miyauchi, H.; Du, W.; Hardouin, C.; Fecik, R. A.; Cheng, H.; Hwang, I.; Hedrick, M. P.; Leung, D.; Acevedo, O.; Guimaraes, C. R.; Jorgensen, W. L.; Cravatt, B. F. Discovery of a potent, selective, and efficacious class of reversible alpha-ketoheterocycle inhibitors of fatty acid amide hydrolase effective as analgesics. Journal of Medicinal Chemistry 2005, 48, 1849-56. 69. Tornqvist, H.; Belfrage, P. Purification and some properties of a monoacylglycerol-hydrolyzing enzyme of rat adipose tissue. Journal of Biological Chemistry 1976, 251, 813-9. 70. Karlsson, M.; Contreras, J. A.; Hellman, U.; Tornqvist, H.; Holm, C. cDNA cloning, tissue distribution, and identification of the catalytic triad of monoglyceride lipase. Evolutionary relationship to esterases, lysophospholipases, and haloperoxidases. Journal of Biological Chemistry 1997, 272, 27218-23. 71. Labar, G.; Bauvois, C.; Borel, F.; Ferrer, J. L.; Wouters, J.; Lambert, D. M. Crystal structure of the human monoacylglycerol lipase, a key actor in endocannabinoid signaling. ChemBioChem 2010, 11, 218-27. 72. Blankman, J. L.; Simon, G. M.; Cravatt, B. F. A Comprehensive Profile of Brain Enzymes that Hydrolyze the Endocannabinoid 2-Arachidonoylglycerol. Chemistry & Biology 2007, 14, 1347-1356. 73. Long, J. Z.; Li, W.; Booker, L.; Burston, J. J.; Kinsey, S. G.; Schlosburg, J. E.; Pavon, F. J.; Serrano, A. M.; Selley, D. E.; Parsons, L. H.; Lichtman, A. H.; Cravatt, B. F. Selective
![Page 41: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/41.jpg)
41
blockade of 2-arachidonoylglycerol hydrolysis produces cannabinoid behavioral effects. Nat Chem Biol 2009, 5, 37-44. 74. Ueda, N.; Yamanaka, K.; Yamamoto, S. Purification and characterization of an acid amidase selective for N-palmitoylethanolamine, a putative endogenous anti-inflammatory substance. J. Biol. Chem. 2001, 276, 35552-35557. 75. Tsuboi, K.; Sun, Y. X.; Okamoto, Y.; Araki, N.; Tonai, T.; Ueda, N. Molecular characterization of N-acylethanolamine-hydrolyzing acid amidase, a novel member of the choloylglycine hydrolase family with structural and functional similarity to acid ceramidase. Journal of Biological Chemistry 2005, 280, 11082-11092. 76. Sun, Y. X.; Tsuboi, K.; Zhao, L. Y.; Okamoto, Y.; Lambert, D. M.; Ueda, N. Involvement of N-acylethanolamine-hydrolyzing acid amidase in the degradation of anandamide and other N-acylethanolamines in macrophages. Biochimica Et Biophysica Acta 2005, 1736, 211-20. 77. Wang, J.; Zhao, L. Y.; Uyama, T.; Tsuboi, K.; Wu, X. X.; Kakehi, Y.; Ueda, N. Expression and secretion of N-acylethanolamine-hydrolysing acid amidase in human prostate cancer cells. J Biochem 2008, 144, 685-90. 78. Ueda, N.; Yamanaka, K.; Yamamoto, S. Purification and Characterization of an Acid Amidase Selective for N-Palmitoylethanolamine, a Putative Endogenous Anti-inflammatory Substance. Journal of Biological Chemistry 2001, 276, 35552-35557. 79. Ueda, N.; Tsuboi, K.; Uyama, T. N-acylethanolamine metabolism with special reference to N-acylethanolamine-hydrolyzing acid amidase (NAAA). Progress in Lipid Research 2010, 49, 299-315. 80. Wei, B. Q. Q.; Mikkelsen, T. S.; McKinney, M. K.; Lander, E. S.; Cravatt, B. F. A second fatty acid amide hydrolase with variable distribution among placental mammals. Journal of Biological Chemistry 2006, 281, 36569-36578. 81. Ueda, N.; Tsuboi, K.; Uyama, T. N-acylethanolamine metabolism with special reference to N-acylethanolamine-hydrolyzing acid amidase (NAAA). Progress in Lipid Research 2011, 49, 299-315. 82. Wang, J.; Zhao, L. Y.; Uyama, T.; Tsuboi, K.; Tonai, T.; Ueda, N. Amino acid residues crucial in pH regulation and proteolytic activation of N-acylethanolamine-hydrolyzing acid amidase. Biochimica Et Biophysica Acta 2008, 1781, 710-7. 83. West, J. M.; Zvonok, N.; Whitten, K. M.; Wood, J. T.; Makriyannis, A. Mass Spectrometric Characterization of Human N-Acylethanolamine-hydrolyzing Acid Amidase. J Proteome Res 2012, 11, 972-81. 84. Fu, J.; Gaetani, S.; Oveisi, F.; Lo Verme, J.; Serrano, A.; Rodriguez De Fonseca, F.; Rosengarth, A.; Luecke, H.; Di Giacomo, B.; Tarzia, G.; Piomelli, D. Oleylethanolamide regulates feeding and body weight through activation of the nuclear receptor PPAR-alpha. Nature 2003, 425, 90-3. 85. LoVerme, J.; La Rana, G.; Russo, R.; Calignano, A.; Piomelli, D. The search for the palmitoylethanolamide receptor. Life Sciences 2005, 77, 1685-98. 86. Lo Verme, J.; Fu, J.; Astarita, G.; La Rana, G.; Russo, R.; Calignano, A.; Piomelli, D. The Nuclear Receptor Peroxisome Proliferator-Activated Receptor-α Mediates the Anti-Inflammatory Actions of Palmitoylethanolamide. Molecular Pharmacology 2005, 67, 15-19. 87. Lambert, D. M.; Vandevoorde, S.; Jonsson, K.-O.; Fowler, C. J. The Palmitoylethanolamide Family: A New Class of Anti-Inflammatory Agents ? Current Medicinal Chemistry 2002, 9, 663.
![Page 42: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/42.jpg)
42
88. Ahn, K.; McKinney, M. K.; Cravatt, B. F. Enzymatic Pathways That Regulate Endocannabinoid Signaling in the Nervous System. Chemical Reviews 2008, 108, 1687-1707. 89. Hashimotodani, Y.; Ohno-Shosaku, T.; Kano, M. Endocannabinoids and Synaptic Function in the CNS. The Neuroscientist 2007, 13, 127-137. 90. Hardie, R. C.; Muallem, S. Lipids in Ca2+ signalling--an introduction. Cell Calcium 2009, 45, 517-20. 91. Wilson, R. I.; Nicoll, R. A. Endogenous cannabinoids mediate retrograde signalling at hippocampal synapses. Nature 2001, 410, 588-92. 92. El Manira, A.; Kyriakatos, A. The role of endocannabinoid signaling in motor control. Physiology (Bethesda) 2010, 25, 230-8. 93. Atsak, P.; Roozendaal, B.; Campolongo, P. Role of the endocannabinoid system in regulating glucocorticoid effects on memory for emotional experiences. Neuroscience 2012, 204, 104-16. 94. Orgado, J. M.; Fernandez-Ruiz, J.; Romero, J. The endocannabinoid system in neuropathological states. Int Rev Psychiatry 2009, 21, 172-80.
![Page 43: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/43.jpg)
43
CHAPTER 2
NOVEL ENDOCANNABINOID PROBES
![Page 44: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/44.jpg)
44
2.1 Introduction
B.R. Baker helped pioneer the idea of covalent ligands in the 1960’s from his study on
enzyme inhibitors, and his pursuits of improving chemotherapy. Baker’s rationale for design was
to understand what chemical features of a ligand were essential to binding so that other chemical
regions of the ligand could be altered to covalently interact with amino acid residues.1 By
incorporating a reactive chemical moiety capable of covalent linkage with amino acid residues,
one could produce ligands that behave as irreversible enzyme inhibitors or as probes to
covalently modify receptor binding sites.
While many functional groups can partake in a myriad of chemical reactions, an effective
strategy for this approach includes reactive functional groups stable in the presence of water and
ones where covalent interaction with specific amino acid residues is selective. These covalent
linkages are most likely to occur with nucleophilic amino acid residues in the active site of an
enzyme; thus electrophilic groups make promising probes.2 Early on, photoaffinity labels were
the most readily used, where photolysis of certain functional groups would cause carbene and
nitrene formation and immediate reactions with nearby amino acid residues would occur.3 One
drawback to this method is the possible promiscuity of carbenes and nitrenes, in which the site of
attachment may be difficult to determine.
Our lab has designed a method utilizing covalent ligands, CB1 and CB2 mutants, along
with LC/MS based methods to characterize the cannabinoid receptors called Ligand-Assisted
Protein Structure (LAPS).4-6 This approach provides insight into the structural and functional
properties of the cannabinoid GPCRs by identifying key amino acid residues in the binding sites
of the receptors. Covalent ligands form an irreversible bond in the binding domain and analysis
![Page 45: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/45.jpg)
45
of the ligand-receptor complex maps out key residues involved in interactions between ligands
and the receptor.
Our laboratory has utilized two types of functional groups in designing covalent
ligands—the azide and isothiocyanate. The azide is a photoaffinity label that when exposed to
irradiation nitrogen gas is lost and a nitrene is formed (Scheme 2.1). This nitrene is then able to
react with nearby amino acid residues in the binding domain to form a ligand-receptor complex.
Although it is observed that azide probes specifically interact with cysteine residues, this may
indicate the a nitrene rearrangement to an imine prior to nucleophilic attack. The isothiocyanate
is an electrophilic group that is unreactive in water, however, it is susceptible to nucleophilic
attack from cysteine to form a covalent bond in the binding domain (Scheme 2.1).
Scheme 2.1: Possible mechanism of nitrene formation and nucleophilic attack of isothiocyanate
R NN
NR N
NN
hv
-N2
R N R NC
SNu
H
R NH
Nu S
2.2 Current Cannabinoid Probes
The first cannabinoid probe to covalently bind to the CB1 receptor was (-)-5`-azido-Δ8-
tetrahydrocannabinol (5`-azido-THC, 1, Figure 2.1). The Ki for 1 to the CB1 receptor was 19
nM, which was a two-fold increase in affinity compared to the parent (-)-Δ8-THC (Ki of 35 nM).
The covalent binding of 1 was 12% and 31% for 50nM and 500nM equilibrated concentrations,
respectively, after 5 minutes of UV exposure.7
![Page 46: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/46.jpg)
46
O
OH
N3 O
OH
1 2
OH
NCS
O
OH
NCS
3
O
Figure 2.1 THC based covalent probes
(-)-11-hydroxy-7`-isothiocyanato-1`,1`-dimethylheptyl-Δ8-THC (2, Figure 2.1) was
developed as an electrophilic CB1 covalent probe. The IC50 of 2 was measured to be 1.6 nM. At
0.5 nM 10% labeling was observed after 5 min incubation and 50% after 30 min incubation.
Labeling increased to 50% and 70% labeling for 5 and 60 min incubation respectively using a 2
nM concentration of 2.8 (–)-7′-isothiocyanato-Δ8-THC (3, Figure 2.1) was synthesized in 1995
showing similar binding affinity and covalent binding data to 2.9 At that time, the covalent
binding of the isothiocyanate probes lead to the conclusion that a thiol, amine, or imidazole
amino acid was in the vicinity of the active site. In 2005, it was discovered that C6.47 (meaning
cysteine on helix 6, which is the 47th amino acid residue of the helix, it is also the 355th amino
acid residue overall) was the site of covalent attachment of 2 (AM841) to the CB1 receptor.
Treatment of 2 with alanine, serine, and leucine mutants of C6.47 (355) showed no change in
binding of [3H]CP55940 and [3H]WIN55212-2 to the CB1 receptor, whereas, treatment of 2 with
the WT CB1 receptor eliminated binding of [3H]CP55940 and [3H]WIN55212-2.10
![Page 47: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/47.jpg)
47
Photoactivatable anandamide analog 4 (Figure 2.2) was designed as a potential probe for
the identification of non-CB1 and non-CB2 receptors. Compound 4 has a Ki of 570 nM for CB1,
and 220 nM for CB2. The reduced affinity to the CB receptors was thought to allow this probe to
identify other non-CB receptors for anandamide.11 Covalent probe 5 (Figure 2.2) was an
improvement on 3 in which an iodo-group was incorporated for potential radiolabeling. This
compound was a successful probe where at 25 nM 50% of 5 was covalently bound to the
receptor.
O
NH
O O
N3
I
4
O
O
OH
NCSI
5
OH
Figure 2.2 Other endocannabinoid probes
Martin-Couce, et al., developed a series of endocannabinoid probes for labeling of the
CB receptors. These ligands will had one of three tags; biotin, benzophenone, or a terminal
alkyne attached to a backbone analogous of AEA, 2-AG, and 2-AGE (Figure 2.3). Ligands 6-10
had poor affinity for the CB1 and CB2 receptors with Ki values >2000 nM. The 2-AG and 2-
AGE based ligands did, however, show some affinity to the CB receptors with compound 11
exhibiting Ki values of >5000 nM (CB1) and 379 nM (CB2); 12: 221 nM (CB1) and 450 nM
(CB2); and 13: 84.7 nM (CB1) and 84.9 nM (CB2).12
![Page 48: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/48.jpg)
48
O
NH
OTag1
O
NH
OH
OTag1
Tag1 =
ONH
O
5 3
S
HN NHHH
O
Tag2 =
O3
Tag3 =
O
HN
O
3
O
O
NH
OO
NH
OO
NH
OTag1 Tag2 Tag3
O3
OH
OTag1 O
OH
OTag1 O
OH
OTag2
O
6 7
8 9 10
11 12 13
Figure 2.3 Tagged endocannabinoid probes
The first two high affinity covalent anandamide-based probes for the CB1 receptor were
previously synthesized by our lab in 2005. Ligands 14 and 15 (Figure 2.4) were synthesized
with either the azide or isothiocyanate covalent probe at the ω-6 position and a cyclopropylamide
at the head position. These ligands showed a very high affinity towards the CB1 and the CB2
receptor; with 14 exhibiting Ki values of 0.9 nM (CB1) and 58 nM (CB2), and 15 exhibiting Ki
values of 1.3 nM (CB1) and 49 nM (CB2). After equilibrating 14 with the membranes at a
concentration 10 times its Ki, the membranes were exposed to ultraviolet light (254 nm) and 14
![Page 49: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/49.jpg)
49
was irreversibly labeled at 42%. Electrophilic probe 15 equilibrated with the receptor at a
concentration 10 times its Ki, irreversible labeled 32% of the receptors.13
O
NH
N3
O
NH
SCN14 15
Figure 2.4 Arachidonoylcyclopropylamine covalent probes
2.3 Design of Bifunctional Endocannabinoid Covalent Probes
Endocannabinoid covalent probes had previously exhibited high affinity towards the CB
receptors and both photoaffinity and electrophilic probes were shown to irreversibly bind to the
rCB1 receptor. The next step was to synthesize bifunctional probes with increased covalent
binding to rCB1 (rat), mCB2 (mouse), and hCB2 (human). Finding new compounds with
enhanced covalent binding combined with covalent studies on CB receptor mutants can reveal
important ligand-protein interaction in the binding domain for this class of compounds. This
information can enhance the design and synthesis of more potent ligands.
The design of our probes was based on key functional groups from prior
endocannabinoid analogs. The azide probe of 14 and the isothiocyanate probe of 15 were to be
used at the tail for irreversible linkage, while the head group would be a terminal alkyne as seen
with 16 (Scheme 2.2). 16 has high affinity for both CB receptors with Ki values of 10.8 nM
(rCB1 with PMSF), 4900 nM (rCB1), and 290 nM (mCB2).14 The terminal alkyne head-group
has shown an unexpected improvement to higher binding affinity at the CB2 receptor while also
introducing a second functionality to the molecule. The alkyne can be used for subsequent
“click” chemistry reactions that may be useful in the purification of a receptor-ligand complex.
![Page 50: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/50.jpg)
50
We hypothesized that incorporating these functional groups while altering the arachidonic chain-
length would result in improved covalent labeling of the cannabinoid receptors.
Scheme 2.2 Design of bifunctional azide and isothiocyanate covalent probes
O
NH
16
O
NH
X14 X = N315 X = NCS
nX
O
NH
n = 2-5
17-20 X = N321-24 X = NCS
2.4 Linear synthetic strategy
The synthetic route originally employed for 14 and 15 proceeded through a linear
synthesis, utilizing a series of 1,4-skipped alkyne couplings from a terminal alkyne and
propargyl halide15 to eventually produce 20-hydroxy methyl tetraynoate (Scheme 2.3).
Drawbacks of this approach include the instability of the sequential 1,4-skipped alkyne
intermediates. If a synthesis could be developed that may limit the amount of intermediate 1,4-
skipped alkynes, and number of steps, the overall yield can be improved.
Scheme 2.3 Linear synthesis of 20-hydroxy methyl tetraynoate
HOO
OHO
ClO
O
BrO
OOH
O
OHO
O
OBr
OH O
OHO
CuI, NaI, K2CO3,DMF, rt
CBr4, PPh3, CH2Cl2, 0 °C
CuI, NaI, K2CO3,DMF, rt
CBr4, PPh3, CH2Cl2, 0 °C
CuI, NaI, K2CO3,DMF, rt
![Page 51: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/51.jpg)
51
2.5 Development of a Convergent Synthesis for Covalent Probes
An efficient way to improve linear syntheses is to develop a convergent strategy. A
scheme was devised to synthesize two diyne intermediates that would resemble the two halves
(head and tail) of the probe based on a method reported in the synthesis of 4.11 In doing so, the
triyne intermediate, whose chemical instability causes a loss in the final yield, would be avoided.
The modified synthesis of the tetraynoate (38-41, Scheme 2.4) started with the coupling of
trimethylsilyl (TMS) protected propargyl bromide 25 to alkynols 26-29 in the presence of CuI,
NaI, and K2CO3 to yield TMS protected diynes 30-33 in 54-73% yields. As in previous
methods, 30 was deprotected with TBAF to yield deca-6,9-diyn-1-ol (Scheme 2.5). This method
proved to be successful on a scale <2.25 mmol where the yield was consistently >90%.
However, in a scale up of the synthesis, deprotection of 30 produced large amounts of an
unwanted allene byproduct. This drastically reduced the yield for the total synthesis, as a major
loss of compound occurred here. Montel et al. reported a 1,4-skipped alkyne synthesis from
TMS-alkynes and propargyl halides with CuI, and a fluorine source that allowed the deprotection
and coupling to occur in a one-pot synthesis.16 Thus, after CuI coupling of 34 and 35 with
subsequent Appel17 reaction to yield bromide 36 in 63% over the two steps, the TMS protected
diynes 30-33 were coupled to 36 by introducing 1.0M TBAF in THF (CsF as the fluorine source
reacted much slower and resulted in lower yields) to the CuI coupling conditions to yield
tetraynoates 38-41 in 34-63% yields.
![Page 52: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/52.jpg)
52
Scheme 2.4 Convergent synthesis of tetraeneoates
O
OHOCl
OHTMS
Brn
n = 2-5
OH
n
TMS
HO
O
OBr
O
OHO
OH
O
O
n = 2-5n
O
O
nn = 2-5 n = 2-5
CuI, NaI, K2CO3,DMF, rt
25 26-29 30-33
34 35 36
3730-33
38-41 42-45
54-73%
CuI, NaI, K2CO3,DMF, rt
74%
CBr4, PPh3, CH2Cl2, 0 °C
85%
CuI, NaI, K2CO3, CsF, DMF, rt
34-63%
Ni(OAc)2, NaBH4, NH2(CH2)2NH2
33-57%
Scheme 2.5 Deprotection of 10-(trimethylsilyl)deca-6,9-diyn-1-ol
TMSOH
HOH
.5eq TBAF, THF-40 to 0oC A
B
C D
![Page 53: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/53.jpg)
53
Partial hydrogenation of tetraynoates (38-41) is a crucial step as the synthesis proceeds
from the most unstable intermediates to the most stable intermediates, tetraenoates 42-45.
Initially, the partial hydrogenation was completed through Lindlar’s catalyst and quinoline,18
however, on a compound containing four alkynes, mixed saturation products were observed.
Many different reaction parameters were attempted to optimize this reaction, as it is simple to
carry out. However, after adjusting reaction temperature, equivalents of quinoline, and reaction
concentrations, no conditions proved satisfactory and it was apparent that the Lindlar catalyst
was more suited for partial hydrogenation of compounds containing one or two alkynes. A
slightly more involved partial hydrogenation reaction was then used. A P-2 Ni catalyst was
formed in situ from nickel(II) acetate tetrahydrate, sodium borohydride, and ethylenediamine
which was able to hydrogenate 38-41 to the all cis-tetraenoates 42-45.19
To reach the final products, the tail end hydroxyl was converted to an azide with
diphenylphosphoryl azide (DPPA) and 1,8-diazabicyclo[5.4.0]undec-7-ene (DBU) to produce
46-49 in ~55% yields (Scheme 2.6). The methyl esters were then hydrolyzed to the acids 50-53
in 98% yield. 50-53 then went through carbodiimide induced amide coupling with propargyl
amine to produce the azide probes 17-20 in ~80% yield. Subsequent treatment with PPh3 and
CS2 converted the azides to the isothiocyanates to provide probes 21-24.
Scheme 2.6 Functionalizing the arachidonoate tail
nN3
O
O
n = 2-5nN3
O
OH
n = 2-546-49 50-53
nN3
O
NH
n = 2-517-20nNCS
O
NH
n = 2-521-24
DPPA, DBU, DMF, 120 °C
~55%
LiOH, THF, rt
~80%
propargylamine, EDCI, DMAP, DCM, 0 °C
~80%
CS2, PPh3, THF, rt
~60%
42-45
![Page 54: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/54.jpg)
54
2.6 Binding Affinity and Covalent Binding Data of Covalent Probes
It has been established that anandamide analogs with shortened tail length can activate
the CB receptors. Yao, et al., synthesized methanandamide (AM356) analogs varying the tail
length of the compound while introducing a terminal aryl group. The binding affinity of those
compounds decreased when the tail was shortened to two carbons beyond the C14-C15 olefin.20
The same trend was observed with ligands 17 and 21. Where n=2, the binding affinity
was ~100 nM for the rCB1 receptor and >300 nM and >130 nM for the mCB2 and hCB2
receptors respectively (Table 2.1). For the ligands where n=3,4, or 5, the binding affinity is
retained, with ligands 19 and 20 having affinities in the low nM range for rCB1 with PMSF.
Another very interesting result was the binding affinity of 19 to the hCB2 receptor; at 15 nM it is
has one of the lowest Ki values for a lipid based compound toward the CB2 receptor.
aData obtained from one experiment run in triplicate. bData obtained from at least two separate experiments and no more than five all run in triplicate.
Table 2.1 Binding affinity (Ki) for ligands 17-24 to the cannabinoid receptors
nX
O
NH
Ligand AM n X rCB1 (nM) rCB1 w/
PMSF (nM) mCB2 (nM) hCB2 (nM)
17 9025a 2 N3 881.7 110.1 443.8 132.1
18 9032a 3 N3 121 21 38±1.3 36±2.6
19 9014b 4 N3 350±32 7.4±1.2 34±4.0 22±2.7
20 9002a 5 N3 >1000 6.9 43 55
21 9029b 2 NCS 1600±160 85±9.3 300±33 190±23
22 9039b 3 NCS 280±57 17±2.7 51±15 28±4
23 9017b 4 NCS 560±49 17±0.6 44±5.1 43±8.6
24 9004a 5 NCS >1000 12 25 25
![Page 55: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/55.jpg)
55
The increased potency for these compounds towards the CB2 receptor was not originally
expected, as LAPS studies on the CB2 receptor using endocannabinoid templates would bring
new insight to their interactions with that receptor. Ideally, for covalent studies one would
prefer the Ki to be ≤30 nM. As our covalent assays use a standard concentration of 10Ki (10
times the concentration of the Ki), the greater the affinity the more likely we can avoid solubility
issues. Using these criteria, ligands 17 and 21 were considered not suitable for covalent binding
studies for either receptor, while all the other ligands had acceptable binding affinities.
Azide probes 18-20 did not show any promising covalent activity towards CB2 receptors,
with only 19 successfully labeling the mCB2 receptor (20%, Table 2.2). Isothiocyanates 22-24
showed covalent binding greater than that of previous probes 14 and 15 (62-78% vs. 32-40%
respectively). The covalent binding to the CB2 receptors was greatly improved with 23, where
the ligand labeled 53% of the mCB2 receptor and 38% of hCB2; thus, making it a good candidate
for LAPS studies with the CB2 receptor. CB1 cAMP assay of 23 indicated that compound
behaved as an agonist with an EC50 of 85 nM.
aAll covalent binding data was obtained from one experiment run in triplicate.
Table 2.2 Percentage of occupied receptors for 18-20 and 22-24 in covalent binding assaya
nX
O
NH
Ligand AM n X rCB1 mCB1 hCB2
18 9032 3 N3 - 0% 0%
19 9014 4 N3 - 20% 4%
20 9002 5 N3 - 0% 0%
22 9039 3 NCS 78% 32% 27%
23 9017 4 NCS 62% 53% 38% 24 9004 5 NCS 71% 29% 24%
![Page 56: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/56.jpg)
56
Even with optimal receptor binding it is difficult to predict which ligands will produce
increased receptor labeling. The azide and isothiocyanate groups are linear, and placing them at
the tail of a compound increases the overall length of the tail and reduces the degrees of freedom
that may be required for adequate receptor binding (Scheme 2.7).
To circumvent this possibility we investigated shortening the arachidonic tail where the
probe would be attached. We hypothesized that reducing the tail length, while incorporating the
probe, would produce similar affinity to that of the ω-6 ligands. It was thought the shorter chain
would then place the probe in a more advantageous region for covalent linkage. However, this
trend was not observed as ligands 22-24 exhibited similar covalent binding percentages; and the
only difference in covalent binding was observed between the use of azide and isothiocyanate
probes themselves. This may be due to the mechanism of azide irradiation and rearrangement, or
the UV irradiations affect on the receptor itself.
Scheme 2.7 Crude visualization of linear probes degree of freedom
14 15 14 15N
CS
NNC
SCS
2.7 Head-group Optimization
One drawback to anandamide based probes is their susceptibility to hydrolysis by FAAH.
CB1 assays are run with the FAAH inhibitor PMSF to prevent amide hydrolysis.
Methanandamide (AM356) was the first synthetic anandamide analog that was metabolically
stable in the presence of FAAH.21 This metabolic stability occurs from the incorporation of a
chiral methyl to the ethanolamine head group--alpha to the amide nitrogen (Scheme 2.8). In
![Page 57: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/57.jpg)
57
order to obtain the metabolic stability desired towards FAAH we decided to introduce a chiral
methyl onto the propargyl amide head group.
Scheme 2.8 Anandamide and AM356 CB1 binding
O
NH
OHO
NH
OH
rCB1: >1000nMrCB1 w/ PMSF: 78nM
rCB1: 28nMrCB1 w/ PMSF: 20nM
Anandamide AM356
The synthesis of the chiral head group started from the D and L enantiomers of N-BOC-
(tert-butyloxycarbonyl) alaninol (54 and 55, Scheme 2.9). The alcohol was oxidized (Swern22
conditions) to yield 56 and 57, which were immediately reacted with the Ohira-Bestmann23
reagent to produce terminal alkynes 58 and 59 with 30-56% yields over the two steps. The BOC
protecting group was removed with TFA (triflouroacetic acid) to produce salts 60 and 61 in good
yields.
Scheme 2.9 Synthesis of chiral head group
NH
HOO
O NH
OO
O(COCl)2, DMSO, Et3N-78°C DCM
OP
OO
O
N2
MeOH, K2CO3 16h, 0°
NH
O
O
30-56% from alcohol
TFA, DCM NH3 O
O
CF3~90%
54 = R55 = S
58 = R59 = S
56 = R57 = S
60 = R61 = S
![Page 58: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/58.jpg)
58
Salts 60 and 61 were then coupled to acid 52 with 1-ethyl-3-(3-
dimethylaminopropyl)carbodiimide (EDCI) and 4-dimethylaminopyridine (DMAP) in
quantitative yield to give the R and S amides, 62 and 63. The azides were easily converted to
isothiocyanates 64 and 65 with previously described conditions (Scheme 2.10).
Competition binding assays indicated that 62-65 were stable in the presence of FAAH.
This was determined by the examining the similarities in binding affinity between the rCB1
assays with PMSF and without. It was surprising to see that the chirality of the methyl group did
not exhibit a significant difference on binding affinity to the CB1 receptor; whereas (R)-
methanandamide had an eight fold greater binding affinity than that of (S)-methanandamide.21
The R-isomers however, did have a higher affinity for the hCB2 receptors, while all ligands saw a
decline in mCB2 affinity compared to other covalent ligands (Table 2.3).
Scheme 2.10 Metabolically stable covalent probes
O
OHN3n n = 4
EDCI, DMAPDCM, 0°C
O
NHN3
n n = 4
100%
PPh3, CS2THF, 48hrs
45-52%
O
NHNCS
n n = 462 = R63 = S
64 = R65 = S
NH3 O
O
CF3
60 = R61 = S
52
The metabolically unstable isothiocyanate probes were better candidates for covalent
binding studies by occupying a much larger percentage of binding sites compared to their azide
counterparts. The opposite was observed for the metabolically stable chiral probes. The
isothiocyanate probes showed no covalent labeling at any of the receptors, while (S)-azide probe
63 occupied 77% of available CB1 receptors in the covalent binding assay. The (R)-azide, 62,
![Page 59: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/59.jpg)
59
only yielded 8% covalent binding percentage towards CB1, however, 62 was the best candidate
for hCB2 covalent binding as it occupied 46% of available receptors (Table 2.4). Compound 62
was observed to behave as an agonist at the CB1 receptor with an EC50 of 11 nM, while observed
to behave as an inverse agonist at the hCB2 receptor.
Table 2.3 Binding affinity (Ki) for ligands 62-65 to the cannabinoid receptorsa
O
NH
X
Ligand AM X Chirality rCB1 (nM)
rCB1 w/ PMSF (nM)
mCB2 (nM)
hCB2 (nM)
62 9069 N3 R 5.9±1.8 11±0.4 92±17 37±10
63 9073 N3 S 28±6.8 16±1.1 250±21 96±14
64 9070 NCS R 18±4.4 15±4.4 97±2.1 63±20
65 9074 NCS S 35±7.5 29±7.3 164±25 140±21 aAll experiments done in triplicate in three separate experiments.
Table 2.4 Percentage of occupied receptors by 62-65 in covalent binding assaysa
O
NH
X
Ligand AM X Chirality rCB1 hCB2 62 9069 N3 R 7.6% 46%
63 9073 N3 S 77% -
64 9070 NCS R 0% 0%
65 9074 NCS S 0% - aAll experiments completed once in triplicate.
![Page 60: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/60.jpg)
60
2.8 Ligand-Assisted Protein Structure (LAPS)
LAPS analysis combines the use of covalent probes, mass spectrometry, site-directed
mutagenesis, and computer modeling to determine the binding locations of different classes of
ligands to the CB GPCRs. This technique is used to understand structural and functional
information regarding the interaction of ligands and target proteins. Information obtained can be
used in the development of novel therapeutics.
Covalent analogs to THC have been used to determine within which transmembrane helix
(TMH) these types of ligands interact.10 Endocannabinoids are important signaling compounds,
information related to their interaction with the CB receptors is important in understanding their
function. Compound 15 was one of the first covalent probes analogous to the endocannabinoid
anandamide that showed adequate covalent binding percentages to the CB1 receptor to be used
for LAPS studies.13
To determine where in the GPCR ligands interact, a series of cysteine to serine mutants
of the CB receptors was developed. The CB1 receptor contains five cysteines located within the
transmembrane domains (Figure 2.5) at C1.55(139), C4.47(238), C6.47(355), C7.38(382), and
C7.42(386).
![Page 61: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/61.jpg)
61
Figure 2.5 CB1 receptor with transmembrane cysteines highlighted
With the covalent warhead (azide or isothiocyanate) susceptible to attack only from a
nucleophilic cysteine, it is possible to determine which specific cysteine interacts with the
covalent probe. By sequentially mutating each cysteine to serine and performing a covalent
assay, we can determine the specific cysteine where interaction occurs by looking for a loss of
covalent labeling.
This method was used on rCB1 with 15, and it was observed that the covalent binding
interaction was lost when C6.47(355) was mutated to serine.24 The covalent probe occupied
some percentage of the CB1 receptors when a covalent assay was performed with the wild type
receptor and cysteine to serine mutants at the other helices (C1.55, C4.47, C7.38, and C7.42).
2.8.1 LAPS Studies Utilizing AM9017
LAPS studies of 15 indicated an interaction with the CB1 receptor at TMH 6, however,
this compound was unable to covalently bind with the CB2 receptor. Endocannabinoids (ECs)
![Page 62: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/62.jpg)
62
have a greater affinity for CB1 compared to CB2, thus understanding interactions of ECs using
LAPS can be difficult with the CB2 receptor.
While the original strategy for incorporating a propargyl amine head-group into the EC
probe was for the potential use of ‘click’ chemistry (selective and efficient functional group
bonding) after the ligand covalently labeled to the receptor, we observed an unexpected
improvement of ligand affinity towards the CB2 receptors. With binding affinities in the lower
nM range, we would be able to perform covalent assays at a 10x Ki standard concentration
without solubility issues. The compound with the best covalent activity for both mCB2 and hCB2
was AM9017 (23, Table 2.2), and it would be the best candidate for LAPS studies on mutant
CB2 cell lines.
C7.38(284)SC7.42(288)S
C6.47(257)S
C1.39(40)S
C2.59(89)S
Site-Directed MutagenesishCB2 Library of Cysteine Mutants
http://www.wdv.com/CellWorld/Receptors/
Figure 2.6 Human CB2 receptor with transmembrane cysteines highlighted
![Page 63: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/63.jpg)
63
CB2 also contains five cysteines located in the transmembrane helices. These residues
are located at C1.39(40), C2.59(89), C6.47(257), C7.38(284), and C7.42(288) (Figure 2.6).
AM9017 (23) was tested in covalent assays on the wild type CB2 receptor for mouse and human.
The Bmax of [3H]-CP55,490 with the mCB2 receptor treated with AM9017 was 7100 (units for
Bmax are ρmol mg-1) compared to a Bmax of 15000 for the untreated mCB2 receptor; indicating
AM9017 occupied 53% of the mCB2 receptors. With the hCB2 receptor treated with AM9017,
[3H]-CP55,490 had a Bmax of 800, and a Bmax of 500 for the neat hCB2 receptor. This indicates
that AM9017 occupied 38% of the hCB2 receptors (Figure 2.7).
Covalent binding assays were performed on mutant mouse and human CB2 cell lines.
The first mutant assay to be performed was cysteine to serine on TMH6 (C6.47(257)S). The
Bmax of [3H]-CP55,490 on the neat receptor compared to receptor treated with AM9017 was
similar on both the mouse (7600 for neat compared to 8100 for treated mCB2) and human (6500
for neat compared to 6900 for treated hCB2) CB2 receptors (Figure 2.8). The loss of covalent
labeling of AM9017 when the cysteine on TMH 6 was mutated to a serine indicates this was the
site of interaction between AM9017 and the CB2 receptor.
![Page 64: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/64.jpg)
64
(A)
(B)
Figure 2.7: Competition binding of [3H]-CP55,490 with the (A) mouse and (B) human CB2 wild type receptors. Covalent binding is determined by the difference in competition binding of [3H]-CP55,490 with the neat receptor and the receptor pretreated with AM9017.
![Page 65: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/65.jpg)
65
Figure 2.8: Competition binding of [3H]-CP55,490 with the (A) mouse and (B) human CB2 receptors where C6.47(257) was mutated to S6.47(257) on TMH6. Covalent binding is determined by the difference in competition binding of [3H]-CP55,490 with the neat mutant receptor and the mutant receptor pretreated with AM9017.
![Page 66: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/66.jpg)
66
2.9 Significance of Transmembrane Helix 6
Studies of the β2-adrenergic25 and bovine rhodopsin26 GPCR indicate that the inactive
form of this class of GPCRs contains a salt bridge between TMH3 and TMH6. Upon GPCR
activation the salt bridge is broken due to the increase in distance between involved residues.
TMH6 appears to be significant for the activation of class-A GPCRs. This stems from a CWxP
motif which is conserved throughout this class of GPCRs.27, 28 This structural conformation has
been confirmed to exist in the hCB2 receptor through NMR spectroscopy.29 The tryptophan
(W258) in the conserved kinked region of TMH6 has been identified through NMR to hydrogen-
bond to a carbonyl from a nearby leucine residue (L255). H-bonding then positions the cysteine
(C257) in a favorable position for ligand interaction.29
2.10 Docking of AM9017 into hCB2 Models
Crystal structures have been produced of the rhodopsin30 and the β231 and A2A
32
adrenergic receptors in both their active and inactive states. These crystal structures suggested
that a change in state caused a shift in the cytoplasmic ends of TMH5 and TMH6. We have
modeled AM9017 in the hCB2 receptor based on these GPCR crystal structures.
AM9017 was first non-covalently docked to hCB2 receptor, followed by covalent
attachment of isothiocyanate to cysteine in TMH6. AM9017-hCB2 complex was inserted into a
palmitoyloleoylphosphatidylcholine (POPC) membrane, and the entire system was then
equilibrated with production dynamics of 1200 ps (Figures 2.9 and 2.10). The AM9017-hCB2
complex was then overlayed on the inactive hCB2 receptor (Figure 2.11).
![Page 67: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/67.jpg)
67
Figure 2.9 AM9017-hCB2 covalent complex equilibrated in a POPC membrane
![Page 68: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/68.jpg)
68
Figure 2.10 Zoom-in of AM9017 covalent attachment to the hCB2 receptor with removal of POPC membrane. AM9017 is in stick representation with magenta carbons, blue nitrogen, yellow sulfur, and cysteine residue in orange. hCB2 is represented with green carbons
![Page 69: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/69.jpg)
69
Figure 2.11 Comparison of inactive hCB2 (orange) with active hCB2 receptor covalently bound to AM9017 (green)
![Page 70: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/70.jpg)
70
2.11 Conclusions
To benefit from LAPS studies, a convergent synthesis was developed and optimized to
produce bifunctional anandamide-based covalent probes. This convergent synthetic route
overcame stability issues of skipped-alkyne intermediates observed in the linear synthesis, as
well as overcome the inconsistent partial hydrogenation from using Lindlar’s catalyst. By
modifying the number of carbons in the ligand tail we observed that 3, 4, and 5 carbon tail
lengths were needed for binding affinities high enough for adequate covalent binding using a
standard 10x Ki ligand concentration. These ligands incorporated a propargyl amine head group
which improved CB1 affinity and unexpectedly the CB2 receptor binding as well. AM9017 was
identified as a candidate for LAPS studies of anandamide-based analogs on the hCB2 receptor,
where endocannabinoid covalent binding data had previously been elusive. AM9017 occupied
62, 53, and 38% of the rCB1, mCB2, and hCB2 respected binding sites. Preliminary LAPS
studies on hCB2 mutants, where C6.47 is mutated to serine, showed a loss of covalent labeling
with AM9017. This implied that TMH6 was the site of interaction between covalent probe
AM9017 and the hCB2 receptor. This interaction is believed to occur at a conserved CWxP
motif in TMH 6, which is also observed with anandamide-based covalent probes at the rCB1
receptor. When the ligand-protein covalent interaction was modeled based on crystal structures
of other GPCRs, a movement of TMH6 towards TMH5 was observed.
One of the disadvantages of the bifunctional covalent probes was their susceptibility to
enzymatic hydrolysis by FAAH. To reduce the susceptability, a propargyl amide head group
was designed with a chiral methyl group α to the amide nitrogen. This methyl group was
successful in stabilizing the ligand in the presence of FAAH, as indicated by binding assays in
the presence and absence of the FAAH inhibitor, PMSF. In contrast to the results from previousl
![Page 71: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/71.jpg)
71
anandamide-based compounds that introduced chiral methyl groups for this purpose, the chirality
of the methyl group in these compounds did not have a significant impact on receptor binding.
In summary, new synthetic routes were developed to expedite the preparation of novel
endocannabinoid based ligands, with an emphasis on ligands ability for covalent attachment to
cysteine residues. These advances are crucial for a better understanding of ligand-protein
interactions within the cannabinoid system. This information will be beneficial for the design
and development of future therapeutics targeted for the cannabinoid receptors.
![Page 72: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/72.jpg)
72
2.12 Experimental
General. All starting materials were obtained from commercial suppliers and were used without
further purification. 1H NMR and 13C NMR spectra were obtained on either a Varian 400 or 500
MHz spectrometer with CDCl3 as the solvent and TMS as the internal standard. Signal
multiplicities are labeled as: s for singlet, d for doublet, t for triplet, q for quartet, quin for
quintet, m for multiplet, and any appropriate combinations. All chemical shifts are in ppm. IR
spectra were obtained on a Perkin-Elmer Spectrum One FT-IR spectrometer. All HRMS data
were obtained on a Micromass 70-VSE III mass spectrometer and performed by the School of
Chemical Science, University of Illinois at Urbana-Champaign, Urbana, IL. All compounds were
purified on a Biotage Isolera One using prepacked Luknova flash columns with 40-60μM, 60Å
silica gel. Cannabinoid receptor binding assays and covalent binding assays were conducted
following the procedures outlined by Li et al.; except covalent binding assays were performed
with a concentration of 10Ki of each ligand.13
O
NHN3
(5Z,8Z,11Z,14Z)-17-azido-N-(prop-2-ynyl)heptadeca-5,8,11,14-tetraenamide, 17, AM9025.
EDCI (190 mg, 0.99 mmol), DMAP (80 mg, 0.66mmol) and propargyl amine (36 μL, 0.66
mmol) were added to a solution of 50 (100 mg, 0.33 mmol) in anhydrous CH2Cl2 (5 mL) at 0oC.
The reaction was allowed to stir under argon for 3 h. Upon completion; the reaction was diluted
with CH2Cl2 and water. The organic layer was separated, concentrated, and chromatographed on
silica to yield 17, AM9025, (.102g, 91%) as a yellow oil. Rf = 0.42 (35% ethyl acetate /
hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.90 (m, 1 H) 5.47 - 5.56 (m, 1 H)
5.29 - 5.46 (m, 7 H) 4.02 (dd, J=5.4, 2.4 Hz, 2 H) 3.28 (t, J=7.1 Hz, 2 H) 2.72 - 2.88 (m, 6 H)
![Page 73: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/73.jpg)
73
2.33 - 2.41 (m, 2 H) 2.16 - 2.23 (m, 3 H) 2.10 (q, J=6.8 Hz, 2 H) 1.71 (quin, J=7.5 Hz, 2 H). 13C
NMR (126 MHz, CHLOROFORM-d) δ ppm 172.7, 131.2, 129.3, 129.0, 128.6, 128.5, 128.2,
128.0, 125.6, 79.9, 71.7, 51.2, 35.9, 31.8, 29.3, 27.3, 26.8, 26.0, 25.9, 25.5. IR (neat) cm-1 3296,
2093, 1649, 1533.
O
NH
N3
(5Z,8Z,11Z,14Z)-18-azido-N-(prop-2-ynyl)octadeca-5,8,11,14-tetraenamide, 18, AM9032.
Synthesized following the procedure for 17 from 51 (84 mg, 0.26 mmol) to yield 18, AM9032,
(65 mg, 71%) as a yellow oil. Rf = 0.63 (35% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 5.80 (br. s., 1 H) 5.21 - 5.50 (m, 8 H) 4.05 (dd, J=4.9, 2.4 Hz, 2 H)
3.22 - 3.32 (m, 2 H) 2.73 - 2.86 (m, 6 H) 2.22 - 2.24 (m, 1 H) 2.17 - 2.22 (m, 2 H) 2.04 - 2.15 (m,
4 H) 1.70 - 1.77 (m, 2 H) 1.56 - 1.65 (m, 2 H). 13C NMR (126 MHz, CHLOROFORM-d) δ
172.7, 130.4, 130.1, 129.3, 129.2, 129.1, 128.7, 128.2, 128.1, 79.9, 71.8, 51.7, 35.9, 29.7, 29.4,
29.0, 27.3, 26.9, 25.9, 25.5, 24.5. IR (neat) cm-1 3296, 2094, 1646, 1535.
O
NH
N3
(5Z,8Z,11Z,14Z)-19-azido-N-(prop-2-ynyl)nonadeca-5,8,11,14-tetraenamide, 19, AM9014.
Synthesized following the procedure for 17 from 52 (122 mg, 1.0 mmol) to yield 19, AM9014
(152 mg, 83%) as a yellow oil. Rf = 0.47 (35% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 6.06 (br. s., 1 H) 5.29 - 5.43 (m, 8 H) 4.01 (dd, J=4.9, 2.4 Hz, 2 H)
3.25 (t, J=6.8 Hz, 2 H) 2.71 - 2.86 (m, 6 H) 2.15 - 2.22 (m, 3 H) 2.01 - 2.12 (m, 4 H) 1.70 (quin,
J=7.5 Hz, 2 H) 1.59 (quin, J=6.8 Hz, 2 H) 1.43 (quin, J=7.6 Hz, 2 H). 13C NMR (126 MHz,
![Page 74: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/74.jpg)
74
CHLOROFORM-d) δ ppm 172.8, 129.6, 129.3, 129.0, 128.6, 128.5, 128.4, 128.3, 128.2, 79.9,
71.6, 51.5, 35.8, 29.3, 28.6, 27.3, 27.0, 26.9, 26.8, 25.8 (2 C), 25.56. IR (neat) cm-1 3299, 2090,
1647, 1536.
O
NH
N3
(5Z,8Z,11Z,14Z)-20-azido-N-(prop-2-ynyl)icosa-5,8,11,14-tetraenamide, 20, AM9002.
Synthesized following the procedure for 17 from 53 (32 mg, 0.09 mmol) to yield 20, AM9002,
29 mg, 81%) as a yellow oil. 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.32 - 5.44 (m, 8
H) 4.05 (dd, J=5.4, 2.44 Hz, 2 H) 3.27 (t, J=6.8 Hz, 2 H) 2.75 - 2.88 (m, 6 H) 2.23 (t, J=2.4 Hz, 1
H) 2.19 (t, J=7.45 Hz, 2 H) 2.05 - 2.16 (m, 4 H) 1.73 (quin, J=7.3 Hz, 2 H) 1.60 (quin, J=6.45
Hz, 2 H) 1.36 - 1.44 (m, 4 H); IR (neat) cm-1 3297, 2094, 1647, 1533. 13C NMR (126 MHz,
CHLOROFORM-d) δ ppm 172.7, 129.8, 129.6, 129.2, 128.8, 128.6, 128.5, 128.3, 128.2, 79.9,
71.5, 51.9, 35.8, 29.3, 28.6, 27.3, 27.0, 26.9, 26.8, 25.9, 25.7 (2 C), 25.5. HRMS for C23H35N4O
(MH+) 383.2803. Calcd. 383.2811.
O
NHNCS
(5Z,8Z,11Z,14Z)-17-isothiocyanato-N-(prop-2-ynyl)heptadeca-5,8,11,14-tetraenamide, 21,
AM9029. Triphenylphosphine (92 mg, 0.35 mmol) and CS2 (17 μL, 0.28 mmol) were added to a
solution of AM9025 (80 mg, 0.23 mmol ) in anhydrous THF (5 mL). The reaction was allowed
to stir under argon for 48 hours. The reaction mixture was then concentrated and
chromatographed on silica gel to yield 21, AM9029, (41 mg, 49%) as an oil. Rf = 0.40 (35%
ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.92 (m, 1 H) 5.52 -
![Page 75: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/75.jpg)
75
5.66 (m, 1 H) 5.32 - 5.46 (m, 7 H) 4.05 (dd, J=5.1, 2.7 Hz, 2 H) 3.54 (t, J=6.6 Hz, 2 H) 2.78 -
2.88 (m, 6 H) 2.45 - 2.51 (m, 2 H) 2.19 - 2.25 (m, 3 H) 2.12 (q, J=6.8 Hz, 2 H) 1.73 (quin, J=7.6
Hz, 2 H). 13C NMR (126 MHz, CHLOROFORM-d) δ ppm 172.7, 132.3, 129.3, 129.0, 128.8,
128.6, 128.1, 127.7, 124.5, 79.9, 71.7, 45.0, 35.9, 29.3, 28.3, 26.7, 26.0, 25.9 (2C), 25.56. IR
(neat) cm-1 3294, 2186, 2092, 1647, 1535.
O
NH
NCS
(5Z,8Z,11Z,14Z)-18-isothiocyanato-N-(prop-2-ynyl)octadeca-5,8,11,14-tetraenamide, 22,
AM9039. Synthesized following the procedure for 21 from 18 (65 mg, 0.18 mmol) to yield 22,
AM9039 (65 mg, 96%) as a yellow oil. Rf = 0.34 (35% ethyl acetate / hexanes). 1H NMR (500
MHz, CHLOROFORM-d) δ ppm 5.71 (br. s., 1 H) 5.31 - 5.51 (m, 8 H) 4.06 (dd, J=4.9, 2.4 Hz,
2 H) 3.52 (t, J=6.8 Hz, 2 H) 2.71 - 2.89 (m, 6 H) 2.24 (t, J=2.9 Hz, 1 H) 2.17 - 2.22 (m, 2 H) 2.00
- 2.15 (m, 4 H) 1.66 - 1.80 (m, 4 H). 13C NMR (126 MHz, CHLOROFORM-d) δ 172.6, 130.3,
129.2, 129.2, 128.7, 128.5, 128.3, 128.3, 128.2, 79.9, 71.8, 45.3, 36.0, 31.8, 30.2, 29.4, 28.7,
26.8, 26.7, 25.9, 25.5. IR (neat) cm-1 3293, 2186, 2094, 1647, 1534.
O
NH
NCS
(5Z,8Z,11Z,14Z)-19-isothiocyanato-N-(prop-2-ynyl)nonadeca-5,8,11,14-tetraenamide, 23,
AM9017. Synthesized following the procedure for 21 from 19 (105 mg, 0.29 mmol) to yield 23,
AM9017, (66 mg, 60%) as a yellow oil. Rf = 0.33 (35% ethyl acetate / hexanes). 1H NMR (500
MHz, CHLOROFORM-d) δ ppm 5.65 (br. s., 1 H) 5.32 - 5.48 (m, 8 H) 4.05 (dd, J=4.9, 2.4 Hz,
2 H) 3.53 (t, J=6.4 Hz, 2 H) 2.70 - 2.88 (m, 6 H) 2.23 (br. s., 1 H) 2.21 (t, J=7.8 Hz, 3 H) 2.06 -
![Page 76: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/76.jpg)
76
2.17 (m, 4 H) 1.67 - 1.78 (m, 4 H) 1.50 (quin, J=7.6 Hz, 2 H). 13C NMR (126 MHz,
CHLOROFORM-d) δ ppm 172.6, 130.4, 129.3, 129.3, 129.0, 128.9, 128.5, 128.4, 128.4, 128.3,
79.8, 71.7, 45.2, 35.9, 29.7, 29.3, 27.4, 26.8, 26.7, 26.5, 25.9 (2 C), 25.5. IR (neat) cm-1 3297,
2183, 2091, 1647, 1535.
O
NH
SCN
(5Z,8Z,11Z,14Z)-20-isothiocyanato-N-(prop-2-ynyl)icosa-5,8,11,14-tetraenamide, 24,
AM9004. Synthesized following the procedure for 21 from 20 (23 mg, 0.06 mmol) to yield 24,
AM9004, (19mg, 80%) as a yellow oil. Rf = .30 (35% ethyl acetate/hexane). 1H NMR (500
MHz, CHLOROFORM-d) δ ppm 5.32 - 5.44 (m, 8 H) 4.05 (dd, J=5.4, 2.44 Hz, 2 H) 3.52 (t,
J=6.6 Hz, 2 H) 2.75 - 2.88 (m, 6 H) 2.23 (t, J=2.44 Hz, 1 H) 2.19 (t, J=7.5 Hz, 2 H) 2.05 - 2.16
(m, 4 H) 1.73 (quin, J=7.3 Hz, 2 H) 1.60 (quin, J=6.5 Hz, 2 H) 1.36 - 1.44. IR (neat) cm-1 3295,
2183, 2092, 1646, 1535. 13C NMR (126 MHz, CHLOROFORM-d) δ ppm 172.5, 130.3, 129.4,
129.3, 129.1, 129.0, 128.7, 128.5, 128.4, 79.7, 71.8, 45.0, 35.8, 29.6, 29.4, 27.7, 26.8, 26.7, 26.4,
25.9 (2 C), 25.7, 25.5. HRMS for C24H35N2OS (MH+) 399.2460. Calcd. 399.2470.
OH
hex-5-yn-1-ol, 28. A solution of 5-hexynoic acid (3.0 mL, 27.2 mmol) in anhydrous Et2O (15
mL) was slowly added to a 1.0M solution of LiAlH4 in Ether (27.2 mL, 27.2 mmol) at 0oC. The
reaction mixture was stirred under argon as it was warmed to room temperature and stirred for an
additional hour. A 1.0M HCl solution was added drop wise until the reaction mixture was
acidic. The lipophilic products were extracted with Et2O, and the aqueous layer was washed
![Page 77: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/77.jpg)
77
with Et2O three additional times. The combined layers were dried with MgSO4 and concentrated
to give 5-hexyn-1-ol (2.09g, 78%) as an oil. Rf = 0.31 (35% ethyl acetate / hexanes). 1H NMR
(500 MHz, CHLOROFORM-d) δ ppm 3.69 (t, J=5.9 Hz, 2 H) 2.25 (td, J=6.8, 2.4 Hz, 2 H) 1.96
(t, J=2.4 Hz, 1 H) 1.70 (quin, J=6.4 Hz, 2 H) 1.63 (quin, J=7.3 Hz, 2 H).
OH
hept-6-yn-1-ol, 29. Synthesized following the procedure for 28, (3.49 g, 97%) colorless oil. Rf =
0.30 (30% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ 3.65 - 3.71 (m,
2H), 2.23 (dt, J = 2.7, 7.0 Hz, 2H), 1.97 (t, J = 2.7 Hz, 2H), 1.59 - 1.65 (m, 4H), 1.51 - 1.54 (m,
2H).
TMS OH
7-(trimethylsilyl)hepta-3,6-diyn-1-ol, 30. (3-bromoprop-1-ynyl)trimethylsilane 25 (1.15mL, 7.2
mmol) and 3-butyn-1-ol 26 (545 μL, 7.2 mmol) were added to a suspension of CuI (2.74 g, 14.4
mmol), NaI (2.15 g, 14.4 mmol), and K2CO3 (1.99 g, 14.4 mmol) in anhydrous DMF (7mL )
under an atmosphere of argon. The mixture was stirred at room temperature over night. The
mixture was then quenched with saturated a saturated NH4Cl solution. The lipophilic product
was extracted with Et2O, filtered, and washed with water, brine, and dried over MgSO4. The
organic layer was concentrated and the residue was chromatographed on silica gel to yield 30
(1.05 g, 70%) as yellow oil. Rf = 0.47 (35% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 3.64 - 3.76 (m, 2 H) 3.21 (t, J=2.4 Hz, 2 H) 2.43 - 2.49 (m, 2 H).
TMSOH
8-(trimethylsilyl)octa-4,7-diyn-1-ol, 31. Synthesized following the procedure for 30 from 25
(1.15 mL, 7.2 mmol) and 27 (670 μL, 7.2 mmol) to yield 31 (881 mg, 63%) as a yellow oil. Rf =
![Page 78: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/78.jpg)
78
0.52 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 3.76 (t,
J=6.1 Hz, 2 H) 3.19 (t, J=2.2 Hz, 2 H) 2.30 (tt, J=6.8, 4.7, 1.9 Hz, 2 H) 1.76 (quin, J=6.5 Hz, 2
H) 0.12 - 0.20 (m, 9 H).
TMS OH
9-(trimethylsilyl)nona-5,8-diyn-1-ol, 32. Synthesized following the procedure for 30 from 25
(1.15 mL, 7.2 mmol) and 28 (780 μL, 7.2 mmol) to yield 32 (816 mg, 54%) as a yellow oil. Rf =
0.51 (40% acetone / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 3.64 - 3.71 (m, 2
H) 3.19 (t, J=2.4 Hz, 2 H) 2.22 (tt, J=6.8, 2.3 Hz, 2 H) 1.64 - 1.71 (m, 2 H) 1.56 - 1.62 (m, 2 H).
TMSOH
10-(trimethylsilyl)deca-6,9-diyn-1-ol, 33. Synthesized following the procedure for 30 from 25
(1.00 mL, 6.2 mmol) and 29 (780 μL, 6.2 mmol) to yield 33 (1.00 g, 73%) as a yellow oil. Rf =
0.37 (35% ethyl acetate/hexane). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 3.65 (br. s., 2
H) 3.19 (t, J=2.4 Hz, 2 H) 2.19 (tt, J=6.8, 2.4 Hz, 2 H) 1.57 - 1.62 (m, 2 H) 1.50 - 1.56 (m, 2 H)
1.43 - 1.49 (m, 2 H).
HOO
O
methyl 10-hydroxydeca-5,8-diynoate, 36. Synthesized following the procedure for 30 from 4-
chlorobut-2-yn-1-ol 34 (580 μL, 6.7 mmol) and methyl hex-5-ynoate 35 (.88mL, 13.4mmol) to
yield 36 (965 mg, 74%) as a colorless oil. Rf = 0.36 (35% ethyl acetate/hexane). 1H NMR (500
MHz, CHLOROFORM-d) δ ppm 4.27 (m, 2 H) 3.69 (s, 3 H) 3.18 (quin, J=2.2 Hz, 2 H) 2.44 (t,
J=7.6 Hz, 2 H) 2.24 (tt, J=6.8, 2.44 Hz, 2 H) 1.83 (quin, J=7.2 Hz, 2 H) 1.56 (br. s., 1 H).
BrO
O
![Page 79: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/79.jpg)
79
methyl 10-bromodeca-5,8-diynoate, 37. A solution of PPh3 (1.44 g, 5.47 mmol) in anhydrous
CH2Cl2 (10 mL) was added drop wise to a stirred suspension of CBr4 (1.81 g, 5.47 mmol) and 36
(965 mg, 4.97 mmol) in CH2Cl2 (20mL) at 0oC. After 2 h the solvent was removed under reduced
pressure and the resulting residue was chromatographed on silica gel to yield 37 (1.09 g, 85%) as
a yellow oil. Rf = 0.62 (35% ethyl acetate/hexane). 1H NMR (500 MHz, CHLOROFORM-d) δ
ppm 3.92 (t, J=2.2 Hz, 2 H) 3.68 (s, 3 H) 3.21 (t, J=2.2 Hz, 2 H) 2.44 (t, J=7.6 Hz, 2 H) 2.24 (tt,
J=6.8, 2.4 Hz, 2 H) 1.82 (quin, J=7.2 Hz, 3 H).
O
O
HO
methyl 17-hydroxyheptadeca-5,8,11,14-tetraynoate, 38. A solution of 37 (1.38 g, 5.39 mmol)
and 30 (971 mg, 5.39 mmol) in anhydrous DMF (6 mL) and 1.0M TBAF (5.39 g, 5.39 mmol) in
THF were added to a suspension of CuI (2.06 g, 10.8 mmol), NaI (1.62 g, 10.8 mmol), K2CO3
(1.49 g, 10.8 mmol) anhydrous DMF (5 mL). The reaction mixture was allowed to stir at room
temperature under argon for 72h. The reaction mixture was quenched with a saturated NH4Cl
solution and the lipophilic products were extracted with Et2O; washed with water, brine, and
dried over MgSO4. The ethereal layer was removed under reduced pressure and
chromatographed on silica gel to yield methyl 38 (690 mg, 45%) as a yellow oil. Rf = 0.19 (35%
ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 3.71 (q, J=6.0 Hz, 2 H)
3.68 (s, 3 H) 3.12 - 3.18 (m, 6 H) 2.41 - 2.48 (m, 4 H) 2.24 (tt, J=7.0, 2.3 Hz, 2 H) 1.82 (quin,
J=7.2 Hz, 2 H).
O
OHO
methyl 18-hydroxyoctadeca-5,8,11,14-tetraynoate, 39. Synthesized following the procedure
for 38 from 37 (1.44 g, 5.6 mmol) and 31 (881 mg, 4.5 mmol) to yield 39 (455 mg, 34%) as a
![Page 80: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/80.jpg)
80
yellow oil. Rf = 0.13 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ
ppm 3.75 (q, J=5.8 Hz, 2 H) 3.68 (s, 3 H) 3.09 - 3.20 (m, 6 H) 2.43 (t, J=7.5 Hz, 3 H) 2.30 (m, 2
H) 2.21 - 2.27 (m, 2 H) 1.82 (quin, J=7.2 Hz, 2 H) 1.75 (quin, J=6.6 Hz, 2 H).
O
O
HO
methyl 19-hydroxynonadeca-5,8,11,14-tetraynoate, 40. Synthesized following the procedure
for 38 from 37 (962 mg, 3.74 mmol) and 32 (780 mg, 3.74 mmol) to yield 40 (512 mg, 63%) as a
yellow oil. Rf = 0.17 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ
ppm 3.68 (s, 3 H) 3.65 - 3.67 (m, 2 H) 3.09 - 3.19 (m, 6 H) 2.43 (t, J=7.3 Hz, 2 H) 2.18 - 2.28
(m, 4 H) 1.82 (quin, J=7.2 Hz, 2 H) 1.67 (quin, J=6.8 Hz, 2 H) 1.59 (quin, J=7.3 Hz, 2 H).
O
OHO
methyl 20-hydroxyicosa-5,8,11,14-tetraynoate, 41. Synthesized following the procedure for 38
from 37 (900 mg, 3.5 mmol) and 33 (778 mg, 3.5 mmol) to yield 41 (605 mg, 53%) as a yellow
oil. Rf = 0.16 (35% ethyl acetate/hexane). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 3.68
(s, 3 H) 3.65 (t, 2 H) 3.10 - 3.19 (m, 6 H) 2.43 (t, J=7.3 Hz, 2 H) 2.24 (tt, J=6.7, 4.5 Hz, 2 H)
2.18 (tt, J=4.6, 2.3 Hz, 2 H) 1.82 (quin, J=7.2 Hz, 2 H) 1.58 (quin, 2 H) 1.49 - 1.55 (m, 2 H) 1.42
- 1.49 (m, 2 H).
O
OOH
(5Z,8Z,11Z,14Z)-methyl 17-hydroxyheptadeca-5,8,11,14-tetraenoate, 42. To a solution of
Ni(OAc)2•4H2O (1.03 g, 4.13 mmol) in anhydrous methanol (30 mL), was added NaBH4 (183
mg, 4.86 mmol) at room temperature under and atmosphere of argon. This mixture was
immediately put under vacuum and purged with H2 (3 times) and allowed to stir for 5 minutes.
![Page 81: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/81.jpg)
81
This solution was treated with ethylenediamine (422 μL, 6.32 mmol) and stirred for an additional
5 minutes; at which 38 (690 mg, 2.43 mmol) in anhydrous methanol (20 mL) was added. The
mixture was stirred at room temp under H2 for 2h. The reaction mixture was filtered through
celite, where the filtrate was diluted with Et2O and brine. The organic phase was separated and
the aqueous phase was extracted 3 times with Et2O, and the combined organic layers were dried
over MgSO4. The ethereal layer was removed under reduced pressure and the resulting residue
was chromatographed on silica gel to yield 42 (237 mg, 33%) as a colorless oil. Rf = 0.28 (35%
ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.48 - 5.62 (m, 1 H)
5.27 - 5.48 (m, 7 H) 3.54 - 3.77 (m, 5 H) 2.63 - 2.98 (m, 6 H) 2.38 (q, J=6.5 Hz, 2 H) 2.33 (t,
J=7.3 Hz, 2 H) 2.12 (q, J=6.8 Hz, 2 H) 1.71 (quin, J=7.5 Hz, 2 H).
O
O
OH
(5Z,8Z,11Z,14Z)-methyl 18-hydroxyoctadeca-5,8,11,14-tetraenoate, 43. Synthesized
following the procedure for 42 from 39 (455 mg, 1.52 mmol) to yield 43 (343 mg, 56%) as a
colorless oil. Rf = 0.13 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ
ppm 5.31 - 5.46 (m, 8 H) 3.63 - 3.69 (m, 5 H) 2.75 - 2.87 (m, 6 H) 2.33 (t, J=7.6 Hz, 2 H) 2.17
(q, J=7.0 Hz, 2 H) 2.11 (q, J=7.0 Hz, 2 H) 1.70 (quin, J=7.6 Hz, 2 H) 1.64 (quin, J=7.3 Hz, 2 H).
O
O
OH
(5Z,8Z,11Z,14Z)-methyl 19-hydroxynonadeca-5,8,11,14-tetraenoate, 44. Synthesized
following the procedure for 42 from 40 (512 mg, 1.64 mmol) to yield 44 (250 mg, 48%) as a
colorless oil. Rf = 0.52 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ
![Page 82: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/82.jpg)
82
ppm 5.31 - 5.45 (m, 8 H) 3.67 (s, 3 H) 3.64 (t, J=6.1 Hz, 2 H) 2.74 - 2.87 (m, 6 H) 2.33 (t, J=7.6
Hz, 2 H) 2.05 - 2.15 (m, 4 H) 1.71 (quin, J=7.5 Hz, 2 H) 1.56 - 1.64 (m, 2 H) 1.45 (quin, J=6.8
Hz, 2 H).
O
O
HO
(5Z,8Z,11Z,14Z)-methyl 20-hydroxyicosa-5,8,11,14-tetraenoate, 45. Synthesized following
the procedure for 42 from 41 (605 mg, 1.85 mmol) to yield 45 (354 mg, 57%) as a colorless oil.
Rf = 0.49 (35% ethyl acetate/hexane). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.30 -
5.47 (m, 8 H) 3.67 (s, 3 H) 3.64 (t, J=6.1 Hz, 2 H) 2.74 - 2.87 (m, 6 H) 2.33 (t, J=7.3 Hz, 2 H)
2.05 - 2.15 (m, 4 H) 1.71 (quin, J=7.6 Hz, 2 H) 1.57 (quin, J=6.4 Hz, 2 H) 1.34 - 1.44 (m, 4 H).
O
ON3
(5Z,8Z,11Z,14Z)-methyl 17-azidoheptadeca-5,8,11,14-tetraenoate, 46. DBU (182 μL, 1.22
mmol) and DPPA (263 μL, 1.22 mmol) were added to a solution of 42 (237 mg, 0.81 mmol) in
anhydrous DMF (3 mL) at 120oC. The reaction was allowed to stir for 4h where up it was
diluted with ether, washed with water, brine, and dried of MgSO4. The ethereal layer was
evaporated off under reduced pressure and the resulting residue was chromatographed on silica
to yield 46 (134 mg, 52%) as a yellow oil. Rf = 0.83 (35% ethyl acetate / hexanes). 1H NMR
(500 MHz, CHLOROFORM-d) δ ppm 5.48 - 5.56 (m, 1 H) 5.32 - 5.45 (m, 7 H) 3.67 (s, 3 H)
3.30 (t, J=7.1 Hz, 2 H) 2.74 - 2.88 (m, 6 H) 2.39 (q, J=7.3 Hz, 2 H) 2.33 (t, J=7.3 Hz, 2 H) 2.08 -
2.15 (m, 2 H) 1.71 (quin, J=7.5 Hz, 2 H).
![Page 83: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/83.jpg)
83
O
O
N3
(5Z,8Z,11Z,14Z)-methyl 18-azidooctadeca-5,8,11,14-tetraenoate, 47. Synthesized following
the procedure for 46 from 43 (340 mg, 1.11 mmol) to yield 47 (93 mg, 25%) as a yellow oil. Rf =
0.75 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.31 - 5.48
(m, 8 H) 3.67 (s, 3 H) 3.27 (m, J=6.8 Hz, 2 H) 2.72 - 2.87 (m, 6 H) 2.32 (t, J=7.3 Hz, 3 H) 2.17
(q, J=6.8 Hz, 1 H) 2.11 (q, J=6.8 Hz, 2 H) 1.63 - 1.75 (m, 4 H).
O
O
N3
(5Z,8Z,11Z,14Z)-methyl 19-azidononadeca-5,8,11,14-tetraenoate, 48. Synthesized following
the procedure for 46 from 44 (472 mg, 1.47 mmol) to yield 48 (228 mg, 45%) as a yellow oil. Rf
= 0.83 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.30 -
5.45 (m, 8 H) 3.67 (s, 3 H) 3.27 (t, J=6.8 Hz, 2 H) 2.81 (d, 5 H) 2.32 (t, J=7.3 Hz, 2 H) 2.02 -
2.15 (m, 4 H) 1.71 (quin, J=7.5 Hz, 2 H) 1.62 (quin, J=7.3 Hz, 2 H) 1.45 (quin, J=7.5 Hz, 2 H).
O
O
N3
(5Z,8Z,11Z,14Z)-methyl 20-azidoicosa-5,8,11,14-tetraenoate, 49. Synthesized following the
procedure for 46 from 45 (77 mg, 0.23 mmol) to yield 49 (45 mg, 54%) as a yellow oil. Rf = 0.86
(35% ethyl acetate/hexane). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.32 - 5.44 (m, 8
H) 3.67 (s, 3 H) 3.26 (t, J=6.8 Hz, 2 H) 2.74 - 2.87 (m, 6 H) 2.32 (t, J=7.5 Hz, 2 H) 2.02 - 2.15
(m, 4 H) 1.71 (quin, J=7.5 Hz, 2 H) 1.61 (quin, J=6.4 Hz, 2 H) 1.35 - 1.43 (m, 4 H).
![Page 84: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/84.jpg)
84
O
OHN3
(5Z,8Z,11Z,14Z)-17-azidoheptadeca-5,8,11,14-tetraenoic acid, 50. A 1.0M solution of LiOH
(84 μL, 0.84 mmol) was added to a solution of 46 (134 mg, 0.42 mmol) in THF (5 mL). The
reaction was allowed to stir under argon for 48 hours. Upon completion, a 1.0M solution of HCl
was added until the reaction mixture was slightly acidic. The lipophilic products were extracted
with Et2O washed with brine, and dried over MgSO4. The ethereal layer was evaporated off
under reduced pressure to yield 50 (102 mg, 80%) as yellow oil. Rf = 0.28 (35% ethyl acetate /
hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.48 - 5.58 (m, 1 H) 5.32 - 5.46 (m, 7
H) 3.30 (t, J=6.8 Hz, 2 H) 2.74 - 2.88 (m, 6 H) 2.33 - 2.43 (m, 4 H) 2.14 (q, J=7.2 Hz, 2 H) 1.72
(quin, J=7.5 Hz, 2 H).
O
OH
N3
(5Z,8Z,11Z,14Z)-18-azidooctadeca-5,8,11,14-tetraenoic acid, 51. Synthesized following the
procedure for 50 from 47 (100 mg, 0.31 mmol) to yield 51 (46 mg, 45%) as a yellow oil. Rf =
0.27 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.30 - 5.49
(m, 8 H) 3.19 - 3.33 (m, 2 H) 2.71 - 2.91 (m, 6 H) 2.37 (t, J=7.3 Hz, 2 H) 2.08 - 2.20 (m, 4 H)
1.63 - 1.76 (m, 4 H).
O
OH
N3
(5Z,8Z,11Z,14Z)-19-azidononadeca-5,8,11,14-tetraenoic acid, 52. Synthesized following the
procedure for 50 from 48 (228 mg, 0.66 mmol) to yield 52 (166 mg, 76%) as a yellow oil. Rf =
![Page 85: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/85.jpg)
85
0.43 (35% ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.31 - 5.46
(m, 8 H) 3.27 (t, J=6.8 Hz, 2 H) 2.74 - 2.88 (m, 6 H) 2.37 (t, J=7.3 Hz, 2 H) 2.06 - 2.17 (m, 4 H)
1.72 (quin, J=7.5 Hz, 2 H) 1.62 (quin, J=6.8 Hz, 2 H) 1.45 (quin, J=7.8 Hz, 2 H).
O
OH
N3
(5Z,8Z,11Z,14Z)-20-azidoicosa-5,8,11,14-tetraenoic acid, 53. Synthesized following the
procedure for 50 from 49 (45 mg, 0.12 mmol) to yield 53 (32 mg, 76%) as a yellow oil. Rf = 0.22
(35% ethyl acetate/hexane). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.33 - 5.46 (m, 8 H)
3.27 (t, J=6.8 Hz, 2 H) 2.76 - 2.87 (m, 6 H) 2.37 (t, J=7.3 Hz, 2 H) 2.07 - 2.19 (m, 4 H) 1.73
(quin, J=7.5 Hz, 2 H) 1.61 (quin, J=6.4 Hz, 2 H) 1.36 - 1.43 (m, 4 H).
NH
O
O
(R)-tert-butyl but-3-yn-2-ylcarbamate, 58. Oxalylchloride (498 μL, 5.8 mmol) was dissolved
in anhydrous CH2Cl2 (25 mL), stirred and cooled to -78 °C, under an argon atmosphere. This
solution was treated with DMSO (824 μL, 11.6 mmol) and stirred for 15 minutes. 54 (500 mg,
2.9 mmol) was added to the solution which stirred for 1.5h. The solution was then treated with
Et3N (2.42 mL, 17.4 mmol) and slowly warmed to room temperature. The solution was diluted
with ethyl acetate, washed with water, brine, and dried over MgSO4. The solvent was removed
under reduced pressure. The resulting aldehyde, 56, was dissolved in anhydrous MeOH (20 mL)
and treated with dimethyl 1-diazo-2-oxopropylphosphonate (836 mg, 4.4 mmol) and K2CO3
(801 mg, 5.8 mmol), stirred for 1 hour at 0° C and then overnight at room temperature. The
![Page 86: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/86.jpg)
86
reaction was quenched with a saturated solution of NH4Cl. The methanol was removed under
reduced pressure and the product was extracted with ethyl acetate (3x) and dried with MgSO4.
The organic layer was removed under reduced pressure and the residue was chromatographed on
silica gel to yield 58 (273 mg, 56%) as a white solid. Rf = 0.53 (20% ethyl acetate / hexanes). 1H
NMR (500 MHz, CHLOROFORM-d) δ ppm 4.58 - 4.79 (m, 1 H) 4.39 - 4.56 (m, 1 H) 2.25 (d,
J=1.9 Hz, 1 H) 1.45 (s, 9 H) 1.40 (d, J=6.8 Hz, 3 H).
NH
O
O
(S)-tert-butyl but-3-yn-2-ylcarbamate, 59.
Synthesized following the procedure for 58 from 55 (500 mg, 2.9 mmol) to yield 59 (147 mg,
30%) as a white solid. Rf = 0.53 (20% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 4.61 - 4.75 (m, 1 H) 4.41 - 4.56 (m, 1 H) 2.25 (d, J=2.4 Hz, 1 H) 1.45
(s, 9 H) 1.40 (d, J=6.8 Hz, 3 H).
NH3 O
O
CF3
(R)-but-3-yn-2-aminium 2,2,2-trifluoroacetate, 60. A solution of 58 (140 mg, 0.83 mmol) in
CH2Cl2 (4 mL) was treated with trifluoroacetic acid (1 mL) at room temperature and stirred for
2h. Solvent and excess trifluoroacetic acid was removed under reduced pressure, resulting in 60
(120 mg, 86%) as an oil. 1H NMR (500 MHz, WATER-d2) δ ppm 4.74 (dq, J=2.4, 6.8 Hz, 1 H)
3.47 (d, J=2.4 Hz, 1 H) 2.05 (d, J=6.8 Hz, 3 H).
NH3 O
O
CF3
![Page 87: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/87.jpg)
87
(S)-but-3-yn-2-aminium 2,2,2-trifluoroacetate, 61. Synthesized following the procedure for 60
from 59 (140 mg, 0.83 mmol) to yield 61 (140 mg, 90%) as an oil. 1H NMR (500 MHz, Water-
d2) δ ppm 4.77 (q, J=6.8 Hz, 1 H) 3.50 (t, J=2.4 Hz, 1 H) 2.08 (d, J=7.3 Hz, 3 H).
O
NH
N3
(5Z,8Z,11Z,14Z)-20-azido-N-((R)-but-3-yn-2-yl)icosa-5,8,11,14-tetraenamide, 62, AM9069.
EDCI (115 mg, 0.60 mmol), DMAP (3 mg, 0.03 mmol), triethylamine (0.024 mL, 0.17 mmol)
and 60 (30 mg, 0.17 mmol) were added to a solution of 52 (47 mg, 0.14 mmol) in anhydrous
DCM (5 mL) at 0°C. The reaction was allowed to stir under argon for 4 hours. Upon completion
the reaction was diluted with CH2Cl2 and water. The organic layer was separated and
concentrated. The resulting residue was chromatographed on silica gel to yield 62, AM9069, (56
mg, 100%) as a yellow oil. Rf = 0.56 (35% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 5.74 (br. s., 1 H) 5.31 - 5.45 (m, 8 H) 4.79 - 4.87 (m, 1 H) 3.26 (t,
J=7.1 Hz, 2 H) 2.74 - 2.87 (m, 6 H) 2.25 (d, J=2.4 Hz, 1 H) 2.17 (t, J=7.3 Hz, 2 H) 1.72 (quin,
J=7.3 Hz, 2 H) 1.57 - 1.64 (m, 2 H) 1.40 (d, J=6.8 Hz, 3 H) 1.36 (dd, J=6.8, 4.4 Hz, 2 H) 1.27 -
1.34 (m, 4 H). 13C NMR (126 MHz, CHLOROFORM-d) δ ppm 171.8, 130.1, 129.8, 129.3,
129.0, 128.6, 128.4, 128.3, 128.2, 84.5, 70.5, 51.6, 37.0, 36.0, 31.8, 29.3, 29.0, 27.4, 27.3, 26.8,
26.6, 25.9, 22.5, 21.2. IR (neat) cm-1 3302, 2094, 1643, 1535, 1453.
O
NH
N3
![Page 88: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/88.jpg)
88
(5Z,8Z,11Z,14Z)-20-azido-N-((S)-but-3-yn-2-yl)icosa-5,8,11,14-tetraenamide, 63, AM9073.
Synthesized following the procedure for 62 from 61 (25 mg, 0.14 mmol) to yield 63, AM9073,
(48 mg, 100%) as a yellow oil. Rf = 0.43 (35% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 5.65 (br. s., 1 H) 5.30 - 5.45 (m, 8 H) 4.78 - 4.87 (m, 1 H) 3.26 (t,
J=6.8 Hz, 2 H) 2.63 - 2.89 (m, 6 H) 2.25 (d, J=2.4 Hz, 1 H) 2.17 (t, J=7.8 Hz, 2 H) 1.94 - 2.13
(m, 4 H) 1.71 (quin, J=7.3 Hz, 2 H) 1.61 (quin, J=6.8 Hz, 2 H) 1.41 (d, J=6.8 Hz, 3 H) 1.34 -
1.39 (m, 4 H). 13C NMR (100 MHz, CHLOROFORM-d) δ ppm 171.9, 130.1, 129.2, 129.0,
128.6, 128.4, 128.3, 128.25, 128.20, 84.4, 70.5, 51.6, 36.9, 36.1, 31.8, 31.6, 29.3, 28.8, 27.3,
26.8, 26.5, 25.7, 22.5, 21.3. IR (neat) cm-1 3305, 2094, 1644, 1536, 1454.
O
NH
SCN
(5Z,8Z,11Z,14Z)-N-((R)-but-3-yn-2-yl)-20-isothiocyanatoicosa-5,8,11,14-tetraenamide, 64,
AM9070. Synthesized following the procedure for 21 from 62 (40 mg, 0.10 mmol) to yield 64,
AM9070, (19 mg, 45%) as a yellow oil. Rf = 0.67 (35% ethyl acetate / hexanes). 1H NMR (500
MHz, CHLOROFORM-d) δ ppm 5.62 (br. s., 1 H) 5.22 - 5.47 (m, 8 H) 4.82 (m, 1 H) 3.51 (t,
J=6.6 Hz, 2 H) 2.73 - 2.88 (m, 6 H) 2.25 (d, J=1.9 Hz, 1 H) 2.17 (t, J=7.3 Hz, 2 H) 2.06 - 2.15
(m, 4 H) 1.67 - 1.77 (m, 4 H) 1.41 (d, J=6.8 Hz, 3 H) 1.28 - 1.34 (m, 4 H). 13C NMR (100 MHz,
CHLOROFORM-d) δ 171.6, 131.1, 123.0, 129.5, 128.9, 128.7, 128.4, 128.3, 128.2, 84.4, 70.8,
45.3, 36.9, 36.1, 30.5, 29.7, 29.2, 27.6, 27.4, 26.7, 26.3, 26.0, 25.6, 22.5. IR (neat) cm-1 3293,
2185, 2094, 1645, 1537, 1452.
![Page 89: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/89.jpg)
89
O
NH
SCN
(5Z,8Z,11Z,14Z)-N-((S)-but-3-yn-2-yl)-20-isothiocyanatoicosa-5,8,11,14-tetraenamide, 65,
AM9074. Synthesized following the procedure for 64 from 63 (30 mg, 0.08 mmol) to yield 65,
AM9074, (16 mg, 52%) as an oil. Rf = 0.59 (35% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 5.63 (br. s., 1 H) 5.30 - 5.44 (m, 8 H) 4.83 (m, 1 H) 3.52 (t, J=6.6 Hz,
2 H) 2.71 - 2.88 (m, 6 H) 2.26 (d, J=2.4 Hz, 1 H) 2.17 (t, J=8.3 Hz, 2 H) 2.05 - 2.14 (m, 4 H)
1.67 - 1.76 (m, 4 H) 1.42 - 1.47 (m, 2 H) 1.41 (d, J=6.8 Hz, 3 H) 1.34 - 1.39 (m, 2 H). 13C NMR
13C NMR (100 MHz, CHLOROFORM-d) δ 171.8, 131.1, 129.9, 129.3, 129.0, 128.6, 128.4,
128.4, 128.3, 84.5, 70.6, 45.2, 37.0, 36.1, 30.1, 29.5, 29.0, 27.4, 27.2, 26.8, 26.4, 25.9, 25.5, 22.6.
IR (neat) cm-1 3295, 2184, 2094, 1644, 1536, 1452.
![Page 90: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/90.jpg)
90
2.13 References
1. Baker, B. R. Design of active-site directed irreversible enzyme inhibitors; the organic chemistry of the enzymic active-site [by] B. R. Baker. New York, Wiley [1967]: 1967. 2. Vallee, B. L.; Riordan, J. F. Chemical approaches to the properties of active sites of enzymes. Annu. Rev. Biochem. 1969, 38, 733-4. 3. Knowles, J. R. Photogenerated reagents for biological receptor-site labeling. Accounts of Chemical Research 1972, 5, 155-160. 4. Pei, Y.; Mercier, R. W.; Anday, J. K.; Thakur, G. A.; Zvonok, A. M.; Hurst, D.; Reggio, P. H.; Janero, D. R.; Makriyannis, A. Ligand-Binding Architecture of Human CB2 Cannabinoid Receptor: Evidence for Receptor Subtype-Specific Binding Motif and Modeling GPCR Activation. Chemistry & Biology 2008, 15, 1207-1219. 5. Picone, R. P.; Fournier, D. J.; Makriyannis, A. Ligand based structural studies of the CB1 cannabinoid receptor. Journal of Peptide Research 2002, 60, 348-356. 6. Zvonok, N.; Xu, W.; Williams, J.; Janero, D. R.; Krishnan, S. C.; Makriyannis, A. Mass Spectrometry-Based GPCR Proteomics: Comprehensive Characterization of the Human Cannabinoid 1 Receptor. Journal of Proteome Research 2010, 9, 1746-1753. 7. Charalambous, A.; Yan, G.; Houston, D. B.; Howlett, A. C.; Compton, D. R.; Martin, B. R.; Makriyannis, A. 5'-Azido-A8-THC: A Novel Photoaffinity Label for the Cannabinoid Receptor. Journal of Medicinal Chemistry 1992, 35, 3076-3079. 8. Guo, Y.; Abadji, V.; Morse, K. L.; Fournier, D. J.; Li, X.; Makriyannis, A. (-)-1 l-Hydroxy-7’-isothiocyanato-l1’’-,dimethylheptyl-A8-THC:A Novel,High-Affinity Irreversible Probe for the Cannabinoid Receptor in the Brain. Journal of Medicinal Chemistry 1994, 37, 3867-3870. 9. Morse, K. L.; Fournier, D. J.; Li, X.; Grzybowska, J.; Makriyannis, A. A novel electrophilic high affinity irreversible probe for the cannabinoid receptor. Life Sciences 1995, 56, 1957-1962. 10. Picone, R. P.; Khanolkar, A. D.; Xu, W.; Ayotte, L. A.; Thakur, G. A.; Hurst, D. P.; Abood, M. E.; Reggio, P. H.; Fournier, D. J.; Makriyannis, A. (-)-7′-Isothiocyanato-11-hydroxy-1′,1′-dimethylheptylhexahydrocannabinol (AM841), a High-Affinity Electrophilic Ligand, Interacts Covalently with a Cysteine in Helix Six and Activates the CB1 Cannabinoid Receptor. Molecular Pharmacology 2005, 68, 1623-1635. 11. Balas, L.; Cascio, M. G.; Marzo, V. D.; Durand, T. Synthesis of a potential photoactivatable anandamide analog. Bioorganic & Medicinal Chemistry Letters 2006, 16, 3765-3768. 12. Martín-Couce, L.; Martín-Fontecha, M.; Capolicchio, S.; López-Rodríguez, M. a. L.; Ortega-Gutiérrez, S. Development of Endocannabinoid-Based Chemical Probes for the Study of Cannabinoid Receptors. Journal of Medicinal Chemistry 2011, 54, 5265-5269. 13. Li, C.; Xu, W.; Vadivel, S. K.; Fan, P.; Makriyannis, A. High Affinity Electrophilic and Photoactivatable Covalent Endocannabinoid Probes for the CB1 receptor. Journal of Medicinal Chemistry 2005, 48, 6423-6429. 14. Lin, S.; Khanolkar, A. D.; Fen, P.; Goutopoulos, A.; Qin, C.; Papahadjis, D.; Makriyannis, A. Novel Analogues of Arachidonylethanolamide (Anandamide): Affinities for the CB1 and CB2 Cannabinoid Receptors and Metabolic Stability. Journal of Medicinal Chemistry 1998, 41, 5353-5361.
![Page 91: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/91.jpg)
91
15. Tedeschi, C.; Saccavini, C.; Maurette, L.; Soleilhavoup, M. l.; Chauvin, R. 1,4-Diynes from alkynyl-propargyl coupling reactions. Journal of Organometallic Chemistry 2003, 670, 151-169. 16. Montel, F.; Beaudegnies, R.; Kessabi, J.; Martin, B.; Muller, E.; Wendeborn, S.; Jung, P. M. J. New Method Based on 1-(Trimethylsilyl)alk-1-yne To Prepare 1,4-Skipped Diynes. Organic Letters 2006, 8, 1905-1908. 17. Appel, R. Tertiary Phosphane/Tetrachloromethane, a Versatile Reagent for Chlorination, Dehydration, and P N Linkage. Angewandte Chemie International Edition in English 1975, 14, 801-811. 18. Lindlar, H. Ein neuer Katalysator für selektive Hydrierungen. Helvetica Chimica Acta 1952, 35, 446-450. 19. Brown, C. A. Catalytic hydrogenation. V. Reaction of sodium borohydride with aqueous nickel salts. P-1 nickel boride, a convenient, highly active nickel hydrogenation catalyst. The Journal of Organic Chemistry 1970, 35, 1900-1904. 20. Yao, F.; Li, C.; Vadivel, S. K.; Bowman, A. L.; Makriyannis, A. Development of novel tail-modified anandamide analogs. Bioorganic & Medicinal Chemistry Letters 2008, 18, 5912-5915. 21. Abadji, V.; Lin, S.; Taha, G.; Griffin, G.; Stevenson, L. A.; Pertwee, R. G.; Makriyannis, A. (R)-Methanandamide: A Chiral Novel Anandamide Possessing Higher Potency and Metabolic Stability. Journal of Medicinal Chemistry 1994, 37, 1889-1893. 22. Omura, K.; Swern, D. Oxidation of alcohols by “activated” dimethyl sulfoxide. a preparative, steric and mechanistic study. Tetrahedron 1978, 34, 1651-1660. 23. Müller, S.; Liepold, B.; Roth, G. J.; Bestmann, H. J. An Improved One-pot Procedure for the Synthesis of Alkynes from Aldehydes. Synlett 1996, 1996, 521-522. 24. Goutopoulos, A.; Fan, P.; Khanolkar, A. D.; Xie, X.-Q.; Lin, S.; Makriyannis, A. Stereochemical Selectivity of Methanandamides for the CB1 and CB2 Cannabinoid Receptors and Their Metabolic Stability. Bioorganic & Medicinal Chemistry 2001, 9, 1673-1684. 25. Urbani, P.; Cavallo, P.; Cascio, M. G.; Buonerba, M.; De Martino, G.; Di Marzo, V.; Saturnino, C. New metabolically stable fatty acid amide ligands of cannabinoid receptors: Synthesis and receptor affinity studies. Bioorganic & Medicinal Chemistry Letters 2006, 16, 138-141. 26. Hoegberg, T.; Stroem, P.; Ebner, M.; Raemsby, S. Cyanide as an efficient and mild catalyst in the aminolysis of esters. Journal of Organic Chemistry 1987, 52, 2033-2036. 27. Glass, M.; Faull, R. L. M.; Dragunow, M. Cannabinoid receptors in the human brain: a detailed anatomical and quantitative autoradiographic study in the fetal, neonatal and adult human brain. Neuroscience 1997, 77, 299-318. 28. Palczewski, K.; Kumasaka, T.; Hori, T.; Behnke, C. A.; Motoshima, H.; Fox, B. A.; Le Trong, I.; Teller, D. C.; Okada, T.; Stenkamp, R. E.; Yamamoto, M.; Miyano, M. Crystal Structure of Rhodopsin: A G Protein-Coupled Receptor. Science 2000, 289, 739. 29. Gnanaprakasam, B.; Milstein, D. Synthesis of amides from esters and amines with liberation of H2 under neutral conditions. J. Am. Chem. Soc. 2011, 133, 1682-1685. 30. Tsou, K.; Mackie, K.; Sañudo-Peña, M. C.; Walker, J. M. Cannabinoid CB1 receptors are localized primarily on cholecystokinin-containing GABAergic interneurons in the rat hippocampal formation. Neuroscience 1999, 93, 969-975. 31. Bezuglov, V.; Bobrov, M.; Gretskaya, N.; Gonchar, A.; Zinchenko, G.; Melck, D.; Bisogno, T.; Di Marzo, V.; Kuklev, D.; Rossi, J.-C.; Vidal, J.-P.; Durand, T. Synthesis and
![Page 92: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/92.jpg)
92
biological evaluation of novel amides of polyunsaturated fatty acids with dopamine. Bioorganic & Medicinal Chemistry Letters 2001, 11, 447-449. 32. El Fangour, S.; Balas, L.; Rossi, J.-C.; Fedenyuk, A.; Gretskaya, N.; Bobrov, M.; Bezuglov, V.; Hillard, C. J.; Durand, T. Hemisynthesis and preliminary evaluation of novel endocannabinoid analogues. Bioorganic & Medicinal Chemistry Letters 2003, 13, 1977-1980.
![Page 93: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/93.jpg)
93
CHAPTER 3
CHEMOENZYMATIC SYNTHESIS OF BIOLOGICALLY ACTIVE COMPOUNDS
![Page 94: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/94.jpg)
94
3.1 Introduction
2-AG is an important endogenous signaling molecule that acts as an agonist at the
cannabinoid receptors. As a principal endocannabinoid, the investigation of 2-AG’s interaction
with the CB receptors and subsequent biological effects have been heavily studied,1-4 however,
chemical properties of this compound impede its study. 2-AG and other 2-monoacylglycerols
(2-MAGs) have a propensity to experience a thermodynamic acyl-migration from the sn-2 to the
more stable sn-1(3) position (Scheme 3.1).
Scheme 3.1 Acyl migration from 2-AG to 1(3)-AG
R O
OOH
OH R O
O
OHOH
12
3
12
3
Boswinkel, et al., reported kinetic experiments investigating the rate of acyl migration of
various fatty acids (butyryl, lauryl, caprylyl, and palmityl). They observed over a period of 168
hours, that the ratio of 1-MAG to 2-MAG ranged from 4.6 to 8.5. They also identified an
increase in the rate of acyl migration as the length of the acyl chain increased.5 Lyubachevskaya,
et al., observed an equilibrium of 1-MAG to 2-MAG of 7.3:1 over 30 hours at 37 °C in
chylomicra emulsions. Incubation of 2-MAGs at lower temperatures showed less acyl migration,
with no migration occurring at -10 °C.6
When 2-AG experiences acyl migration, the resulting 1-AG does not activate the
cannabinoid receptors in vitro.7 Obtaining large quantities of 2-AG can be difficult even through
synthesis. This becomes a major problem when trying to perform larger studies of 2-AG, as the
acyl migration is facile and encouraged by the presence of acid, base, heat, and protic solvents
![Page 95: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/95.jpg)
95
commonly used for 2-AG synthesis.8, 9 To overcome these issues we have investigated moderate
reaction conditions utilizing enzymes to synthesize 2-AG, where minimal acyl migration is
observed.
3.1.1 Synthesis of 2-AG
There have been several reported syntheses of 2-AG, however, these employ many
laborious steps with unfavorable conditions and work-ups that may encourage acyl migration.
One of the earliest 2-AG syntheses reported by Han, et al., starts with the 1,3-triisopropylsilyl
(TIPS) protection of glycerol. The 1,3-TIPS glycerol is then coupled to arachidonic acid,
followed by removal of the silyl protecting groups over 24h with the use of TBAF and acetic
acid in 59% yield (Scheme 3.2).10
Scheme 3.2 TIPS method for synthesizing 2-AG
OHOH
HO
TIPSCl, DMF,imidazole
97%OTIPS
OHTIPSO
arachidonic acid,EDCI, DCM
94%
O
O
OTIPS
OTIPSO
O
OH
OH6eq AcOH, THF 6eq TBAF, -30 °C
59%
A second method coupled arachidonic acid with 1,3-benzylideneglycerol. Phenylboronic
acid is used to remove the benzylidene, resulting in a mixture of 1,3- and 2,3-phenylboronate
![Page 96: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/96.jpg)
96
esters that required separation before subsequent boronate ester removal with methanol and
water in 86% yield (Scheme 3.3). 11
Scheme 3.3 2-AG synthesis through benzylidene
O
OH1) (COCl)2, DMF
2) HOO
O
H
Ph
O
OO
O Ph
H
PhB(OH)2
B(OEt)3
O
OO
BO
O
OPh
H2O, MeOH H2O, MeOH
O BO
Ph
2-AG 1-AG
The most recent method was developed by Stamatov, et al., starting from the glycidyl
ester of arachidonic acid that is opened with trifluoroacetic acid to produce a triacylglycerol. 2-
AG is then obtained after treatment with pyridine and methanol in 94% yield (Scheme 3.4).12
Scheme 3.4 2-AG synthesis through glycidal ring openeing
O
OO
O
O
O
O
O
CF3
O
CF3(F3CCO)2OPyridine, MeOH
2-AG
![Page 97: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/97.jpg)
97
3.1.2 Lipase in the Synthesis of Acylated Glycerols
Application of lipase in the syntheses of 1,3-diacylglycerol, and 1(3)-rac-monoacyl
glycerol has been extensively studied and reviewed.13-21 The selectivity and yield are determined
by various factors which include the amount of enzyme, solvent, temperature and the type of
lipase used.22, 23 Even though the preparation of selective 1,3-diacylglycerols has been achieved
successfully, it has been a challenging task for the synthesis of 2-MAGs due to over hydrolysis
of the sn-2 acyl group and acyl migration from sn-2 to sn-1 or -3 position. Lipase-mediated
hydrolysis of triglycerides using 1,3-regiospecific lipases, esterification of fatty acids or
transesterification of fatty esters with glycerol, and the glycerolysis of triglycerides have been
documented.24, 25 Irimescu, et al., reported a successful synthesis of various 2-acylglycerols of
fatty acids through regiospecfic ethanolysis of symmetrical triglycerides with immobilized
Candida antarctica lipase (CAL, Novozyme 435).17, 26 Even though CAL is not considered as a
1,3-regiospecific enzyme, it has been consistently used for the preparation of 1,3-acylglycerols
and ethanolysis of triglycerides.26, 27 All existing methods utilize symmetrical (“AAA” type)
triglycerides which result in the formation of the corresponding ester by-product that requires
exhaustive purification (Scheme 3.5).
Scheme 3.5: “AAA” and “ABA” triglycerides
O
OCOR
OCORR
O
AAA typeO
OCOC3H7
OCOC3H7R
O
ABA type
R = fatty acid
Encouraged by this literature, we recently reported a method for the synthesis of 2-AG
that utilizes a structured 1,3-dibutyryl-2-arachidonate, an “ABA” type triglyceride. We chose
![Page 98: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/98.jpg)
98
butyrate at the 1 and 3 position because the anticipated byproduct, ethyl butyrate, can be easily
removed.28 Benefits of this procedure include use of ambient temperature, neutral pH, and
conservative reaction time. The method is simple and “green”, as the lipase can be recycled.
Nevertheless, a significant amount of ethyl arachidonate is formed, due to over-hydrolysis. Since
the reaction is selective and proceeded quickly, it has also become a valuable tool for the
radiolabelled synthesis of 2-AG.29 The following work describes the extension of our method to
the synthesis of 2-acylglycerols, starting from saturated and unsaturated fatty acids, and alkyl
and aryl carboxylic acids.
3.2 Synthesis of 2-MAGs with Immobilized Candida antarctica and Rhizomucor miehei
3.2.1 Synthesis of 2-MAGs with Immobilized Candida antarctica
To test the general practicality of this lipase mediated scheme (Scheme 3.6), we
synthesized 2-MAGs from various commercially available long-chain carboxylic acids,
including those of biological importance. The synthesis began with the enzymatic 1,3-diacyl
protection of glycerol by the addition of CAL to glycerol and vinyl butyrate in anhydrous
CH2Cl2 at 0 °C. This resulted in the protected glycerol in quantitative yield.27, 30 The 1,3-
dibutyrylglycerol was then coupled to various medium and long-chain acids through EDCI
coupling in anhydrous CH2Cl2 with a catalytic amount of DMAP for four hours at 0 °C. This
generated the structured triglycerides (“ABA” type) in 67-99% yields.
For the hydrolysis step, CAL was added to the triglyceride, stirred in a minimal amount
of anhydrous ethanol at room temperature. By TLC analysis, it was observed that within one
hour the triglyceride had been completely consumed, and a mixture of 2-MAG, mono-protected
2-MAG (diacylglycerol), and ethyl butyrate was generated. There was no formation of ethyl
ester of fatty acid observed during this period. At this point, additional lipase was added to the
![Page 99: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/99.jpg)
99
mixture, which was allowed to stir until all the diacylglycerol was consumed (1h), affording the
2-MAG. A significant amount of ethyl ester was observed during this period, and the formation
of ethyl ester largely depended on the type of fatty acid at the sn-2 position. Aryl and
unsaturated carboxylic acids showed more resistance towards over hydrolysis as compared to
saturated fatty acids.
Scheme 3.6 Chemoenzymatic Syntheses with immobilized Candida antarctica and Rhizomucor miehei
HO
OH
OH
Candida antarctica
99%
OCOC3H7
OCOC3H7
O
O 1EDCI, DMAP, CH2Cl2
R OH
O
56-99%
R O
OOCOC3H7
OCOC3H7
lipaseethanol
36-88%
R O
OOH
OH R O
OOH
OCOC3H7
1h
2a-14a
2b-14b
CH2Cl2 HO
R OEt
O
byproduct
Candida antarctica
Rhizomucor miehei
1h -24h
The separation of 1-MAG and 2-MAG is generally performed on boric acid impregnated
TLC plates and silica gel columns.31 Nonimpregnated silica TLC plates do not resolve 1- and 2-
MAGs. This separation is a necessary step for most 2-MAG syntheses due to the unfavorable
synthetic conditions used, where considerable formation of 1-MAG is observed. In contrast, the
highly regiospecific and neutral reaction conditions when using the lipase results in minimal or
no 1-MAG formation. Although silica gel purification has been reported to be a cause of acyl
migration from 2-MAG to 1-MAG,32 no migration was observed during column chromatography
with untreated silica gel. The only required step prior to purification was equilibration of silica
gel with hexanes. During chromatography, the highly non-polar ethyl ester byproduct eluted
![Page 100: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/100.jpg)
100
with ethyl butyrate, and the 2-MAG was isolated without any acyl migration. It was observed
that the lipase-catalyzed hydrolysis reactions involving saturated triglycerides had isolated yields
<50%, with the ethyl ester byproduct being the major product, whereas the unsaturated
triglycerides had yields in the range of 55-75%, and triglycerides containing phenylalkyl groups
had yields >80% (Table 3.1). It should also be noted that there was no observable difference in
rate of reaction or isolated yield from the hydrolysis of a 1,3-diacetylglycerol-protected
compound as compared to the 1,3-dibutrylglycerol-protected compound.
3.2.2 Synthesis of 2-MAGs with Rhizomucor miehei
We screened a second 1,3-specific lipases to investigate whether the transformation can
be completed in better yields with a variety of substrates. Lipase from Rhizomucor miehei
showed excellent selectivity towards hydrolyzing “ABA” type triglycerides. The reaction
proceeded in a similar fashion where the triglyceride was consumed quickly, but hydrolysis of
the diglycerides took 24 to 48 hours. Even though the reaction proceeded very slowly compared
to CAL, the R. miehei lipase offered a remarkable improvement in selectivity, providing
exclusively 2-MAGs in excellent yields without formation of any ethyl ester byproduct from sn-
2 hydrolysis. The saturated and unsaturated fatty acid triglycerides were hydrolyzed in good
yields (75-88%) after 24 h. However, in most of the reactions, some unreacted diglyceride
intermediate remained. Allowing the reaction to proceed for an additional 24 h, or adding
additional lipase, did not increase the yields. When the unreacted diglyceride was separated
from the 2-MAG after 24 h, and was subjected to an additional treatment of Rhizomucor miehei
lipase the maximal yield once again reached `80% 2-MAG formation. Surprisingly, as in contrast
to CAL, Rhizomucor miehei lipase showed less reactivity towards aryl esters (13 and 14).
![Page 101: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/101.jpg)
101
Table 3.1 Structure and Yields of Lipase catalyzed 2-MAGs
Cmpd. No. Triglyceride (a) 2-MAG (b)
C. antarctica
R. miehei
Yielda
(%) Yieldb
(%)
2 O
O
OCOC3H7
OCOC3H7H3C(H2C)10 O
O
OH
OHH3C(H2C)10
47 84
3 O
O
OCOC3H7
OCOC3H7H3C(H2C)12 O
O
OH
OHH3C(H2C)12
49 82
4 O
O
OCOC3H7
OCOC3H7H3C(H2C)14 O
O
OH
OHH3C(H2C)14
36 80
5 O
O
OCOC3H7
OCOC3H7
O
O
OH
OH
75 83
6 O
O
OCO(CH2)2CH3
OCO(CH2)2CH3H3C(H2C)16 O
O
OH
OHH3C(H2C)16
44 78
7 O
O
OCOC3H7
OCOC3H7
O
O
OH
OH
72 83
8 O
O
OCOC3H7
OCOC3H7
O
O
OH
OH
63 77
9 O
O
OCOC3H7
OCOC3H7
O
O
OH
OH
55 79
10 O
O
OCOC3H7
OCOC3H7
O
O
OH
OH
67 75
11 O
O
OCOCH3
OCOCH3
O
O
OH
OH
63 76
12 O
O
OCOC3H7
OCOC3H7H3C(H2C)20 O
O
OH
OHH3C(H2C)20
40 88
13 O
O
OCOC3H7
OCOC3H7
O
O
OH
OH
83 40
14 O
O
OCOC3H7
OCOC3H7
O
O
OH
OH
83 37
a Remaining yield consisted of the ethyl ester of sn-2 acyl group. b Remaining yield consisted of intermediate diglyceride.
![Page 102: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/102.jpg)
102
3.3 Enzymatic synthesis of N-acylethanolamines
NAEs, ethanolamides of various long-chain fatty acids, constitute a class of bioactive
lipid molecules formed from glycerophospholipids through the phosphodiesterase-transacylation
pathway consisting of Ca2+-dependent N-acyltransferase and N-acylphosphatidylethanolamine-
hydrolyzing phospholipase D.33, 34 Among the NAEs, anandamide (Figure 3.1) is a
physiologically important lipid signaling molecule acting as a receptor ligand in the
endocannabinoid system.34 Recently, other NAEs such as PEA, and OEA (Figure 3.1) also
gained much attention due to their anti-inflammatory and analgesic activities, and anorexic
activity, respectively.35
O
NH
OH
O
NH
O
NH
H3C(H2C)14OH
OH
arachidonoylethanolamine(anandamide)
N-palmitoylethanolamine
N-oleoylethanolamine
Figure 3.1 N-Acylethanolamines
NAEs, including anandamide, are not stored in the cell but rather produced on demand,
and their endogenous levels are regulated directly by enzymes responsible for their formation
and degradation. Anandamide has a relatively rapid onset of action, but is also rapidly
hydrolyzed by FAAH, which accounts for its short duration of action. Early studies on structure-
activity relationships (SAR) focused on the preparation of various amides of arachidonic acid
and established that amides from chloroethylamine, cylopropylamine and R-(2)-aminopropanol
![Page 103: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/103.jpg)
103
showed excellent improvement in their respective affinities to the cannabinoid CB1 receptor,
while exhibiting enhanced metabolic stability towards FAAH.36-40 Recently, SAR studies on the
modification of the hydrophobic chain have gained more attention and various analogs with fully
saturated fatty acid chains or alternatively encompassed alkyne moieties were synthesized.
Furthermore, our laboratory designed and synthesized high affinity covalent anandamide probes
for the CB1 receptor by introducing either electrophilic isothiocyanato or a photoactivatable
azido groups at the terminal carbon of the arachidonic acid moiety (Chapter 2).41 We also studied
the effect of aryl substitutions with variable methylene linker at the distal end of arachidonic
acid.42
All the synthetic schemes used the esters of substituted fatty acids as a starting point and
converted them to the needed amides using base mediated hydrolysis of the ester to carboxylic
acid, followed by activation of carboxylic acid with EDCI and treatment with various amines to
provide the respective amides. In a few cases, a protected form of ethanolamine was also used,
which required an additional deprotection step.
Several methods have been reported for the direct conversion of esters to amides
including magnesium methoxide,43 sodium cyanide,44 sodium methoxide,45 metal catalysts,46-48
and Alcalase.49 However, most of these methods suffer from incomplete conversion, longer
reaction times, and instability of the final products under the conditions used. Herein, we report a
highly selective lipase mediated mild conversion of esters to biologically important amides.
3.3.1 Candida antarctica for the direct aminolysis of esters
Lipases have found wide use as biocatalysts for many chemical transformations. Many
lipases have been studied for their use in amide formation,50-51 such as, amidation of benzyl
![Page 104: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/104.jpg)
104
esters,52 synthesis of acetamides in the presence of ionic liquids,53 and acylation of amines with
acids.54 Most of these methods utilize either carboxylic acids or vinyl esters of carboxylic acids
as reactants and the reactions require relatively high temperatures. In the kinetic resolution of
amines, Nechab, et al., reported that the reaction conditions required 80 °C and 3-10 h to acylate
chiral amines with CAL and ethyl acetate.55 The aminolysis of linoleyl ethyl ester with
ethanolamine, catalyzed by CAL, in a solvent free system produced the linoleylethanolamide
only in 24% yield in 20 h, including the presence of the unwanted o-acylation product.56 While
these examples show the use of lipases for the amidation of esters, there is limited work reported
on the use of lipases as a direct method for the synthesis of biologically active NAEs with regard
to functional group sensitivity common in the synthesis of modified fatty acid moieties. We have
therefore focused our efforts on the synthesis of biologically active NAEs using immobilized
CAL from methyl esters and various amines. Developments in this area will imrpove the
synthesis of multistep tail-modified NAEs as well as other biologically important fatty acid
amide analogs.
3.3.2 Reaction optimization and results
To optimize the reaction conditions, we chose methyl arachidonate and cyclopropyl
amine as reactants and hexane as a solvent. When carried out at room temperature in the
presence of CAL the reaction proceeded smoothly, but very slowly, requiring 24 hrs for
completion. However, at 45 °C the reaction proceeded to completion significantly faster (3 hrs).
For amines that were not sufficiently soluble in n-hexane, the reaction proceeded equally well in
a 1:1 hexanes-diisopropyl ether mixture (Scheme 3.7). The results are shown in Table 3.2.
![Page 105: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/105.jpg)
105
Scheme 3.7 CAL catalyzed aminolysis of esters
O
O
Immobilized Candida antartica
H2NOH
O
NH
OH
hexanes/diisopropylether 15
Table 3.2: Amidation of esters with immobilized Candida antarctica in 1:1 hexane-
diisopropylether
Amide
Entry Ester Amine Isolated yield Time
15
O
O
H2NOH
89% 2h
16
O
O
H2NOH
98% 24h
17
O
O
H2N 85% 3h
18
OH
O
O
H2NOH
85% 24h
19
N3
O
O
H2N 60% 24h
20 O
O
H2N
41% 24h
21 O
O
H2N 85% 3h
![Page 106: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/106.jpg)
106
22 O
OH3C(H2C)14 H2N
84% 3h
23 O
O H2N 95% 24h
24 O
O
H2NOH
90% 24h
25
CO2Me
H2N
91% 24h
Esters and amines were chosen based on their biological importance. Methyl
arachidonate was treated with cyclopropyl amine, ethanolamine and (R)-2-aminopropanol to
provide ACPA, anandamide, and (R)-methanandamide, respectively, in excellent yields.
Unprotected ethanolamine was directly used in the preparation of various ethanolamides (2, 3, 4
and 10). When performed with a substituted fatty acid carrying a terminal hydroxyl group (4),
the reaction proceeded smoothly to provide the desired amide. There was no observable
transesterification product in any of the reactions where hydroxyl groups were present either in
the amine or the fatty acid substrates. In order to investigate the general applicability of the
method, we chose various esters and amines and showed that reactions proceeded smoothly with
esters. The yields were mainly dependant on the amine. Primary amines, including benzylic
amines, underwent amidation smoothly and in excellent yields. Conversely, cyclohexylamine
exhibited slower reactivity under the present conditions and longer reaction times and increased
temperature did not improve the yield significantly. Esters of non-fatty acids (9,10 and 11) also
![Page 107: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/107.jpg)
107
underwent amidaton with amines in excellent yields and in all cases the reaction time appeared
to be more dependent on the amine used.
3.4 Conclusions
In summary, we have demonstrated that C. antarctica and R. miehei are suitable lipases
for the selective 1,3-hydrolysis of either an ‘AAA’ or ‘ABA’ triglyceride in order to produce
various 2-MAG. C. antarctica catalyzed reactions proceed faster, however, depending on the
substrates the yields were lower due to an ethyl ester by product. Meanwhile, R. miehei had
overall greater yields but required extended reaction times. In general, both are acceptable for
the chemoenzymatic synthesis of 2-MAGs. The work reported here has been recently
published.28, 57
CAL was also useful for the direct formation of amides from various amines and esters
containing skipped polyenes, allyl alcohol, allyl azide, alkyne, and aryl moieties. The method
described here, is simple, efficient and environmentally friendly, and does not require any
protection of other susceptible functional groups. This transacylation reaction provides excellent
yields and is selective. It may find general utility in the synthesis of amides from the
corresponding esters without requiring prior hydrolysis of the esters, as it can be difficult to
synthesize amides directly from esters under mild conditions. This method may prove useful in
the synthesis of drug intermediates and biologically important natural products. This work has
been recently published.58
![Page 108: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/108.jpg)
108
3.5 Experimental
General. Statements from section 2.12 apply to the following experiments.
Compounds 3a-14a were synthesized following the procedure described for 2a; while
compounds 3b-14b were synthesized following the C. antarctica and R. miehei procedures
described for 2b.
OCOC3H7
OCOC3H7HO
2-hydroxypropane-1,3-diyl dibutyrate (1). Immobilized Candida antarctica (750 mg) was
added to a solution of glycerol (2.0 g, 21.6 mmol) and vinyl butyrate (6.2 g, 54.0 mmol) in
anhydrous CH2Cl2 (10 mL) at 0°C. The resulting mixture was stirred for 3h under argon
atmosphere. Then, additional lipase (400 mg) was added to the reaction mixture which was
stirred for an additional 2 h at 0°C. The lipase was filtered off, the solvent was evaporated off
under reduced pressure, and the residue was chromatographed on silica to yield 1 (5.0 g, 99%) as
a colorless oil. Rf = 0.55 (40% ethyl acetate/hexanes). 1H NMR (500 MHz, CHLOROFORM-d)
δ ppm 4.20 (dd, J=11.72, 4.39 Hz, 2 H) 4.14 (dd, J=11.72, 5.86 Hz, 2 H) 4.04 - 4.12 (m, 1 H)
2.41 - 2.58 (m, 1 H) 2.33 (t, J=7.32 Hz, 4 H) 1.67 (sxt, J=7.32 Hz, 4 H) 0.96 (t, J=7.57 Hz, 4 H).
The 13C NMR spectral data (100 MHz, CDCl3) are in agreement with literature values.27
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3H3C(H2C)10
2-(dodecanoyloxy)propane-1,3-diyl dibutyrate (2a). EDCI (383 mg, 2.0 mmol), DMAP (19
mg, 0.16 mmol), and 1 (204 mg, 0.88 mmol) were added to a solution of lauric acid (160 mg,
0.80 mmol) in a 1:1 mixture of anhydrous THF/CH2Cl2 (10 mL) at 0 °C. The reaction was
![Page 109: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/109.jpg)
109
allowed to stir for 4h. The reaction was then diluted with CH2Cl2 (15 mL) and H2O (15 mL).
The organic layer was separated, dried over MgSO4, and the solvent was removed under reduced
pressure. The residue was chromatographed on silica gel (0% to 15% ethyl acetate/hexanes) to
yield 2a (221 mg, 67%) as a colorless oil. Rf = 0.50 (15% ethyl acetate/hexanes). 1H NMR (400
MHz, CHLOROFORM-d) δ = 5.24 - 5.31 (m, 1 H) 4.30 (dd, J=12.09, 4.03 Hz, 2 H) 4.16 (dd,
J=12.46, 5.86 Hz, 2 H) 2.27 - 2.35 (m, 6 H) 1.57 - 1.70 (m, 6 H) 1.21 - 1.36 (m, 16 H) 0.92 -
0.98 (m, 6 H) 0.88 (t, J=6.60 Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 173.4 (2C),
173.2, 77.4, 69.1, 62.3 (2C), 36.1 (2C), 34.4, 32.1, 29.8, 29.7, 29.6, 29.5, 29.3, 25.1, 22.9, 18.6
(2C), 14.4, 13.9 (2C). IR (neat) cm-1 2926, 2855, 1742, 1460. HRMS for C23H42O6Na (MNa+)
437.2881. Calcd. 437.2879.
O
O
OH
OHH3C(H2C)10
1,3-dihydroxypropan-2-yl dodecanoate (2b, utilizing Candida antarctica). Immobilized
Candida antarctica (Novozym 435, 100 mg) was added to a solution of 2a (100 mg, 0.24 mmol)
stirred in anhydrous EtOH (1 mL). After the full consumption of 2a (1h, TLC monitoring),
additional lipase (100 mg) was added until reaction completion was observed (1h). The reaction
mixture was diluted with CH2Cl2 (3 mL), and the lipase was filtered off. The solvent was
removed under reduced pressure, and the resulting residue was chromatographed on silica gel
(10% to 50% acetone/hexanes) to yield 2b (31mg, 47%) as a white solid. Rf = 0.26 (30%
acetone/hexanes). MP = 56-57 °C. 1H NMR (400 MHz, CHLOROFORM-d) δ = 4.93 (quin,
J=4.76 Hz, 1 H) 3.84 (br. s., 4 H) 2.38 (t, J=7.69 Hz, 2 H) 2.08 (br. s., 2 H) 1.58 - 1.69 (m, 2 H)
1.20 - 1.37 (m, 16 H) 0.88 (t, J=6.60 Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ =
![Page 110: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/110.jpg)
110
174.3, 75.3, 62.8 (2C), 34.6, 32.1, 29.8, 29.7, 29.6, 29.5, 29.3, 25.2 (2C), 22.9, 14.4. IR (neat)
cm-1 3352, 2922, 2856, 1730, 1464. HRMS for C15H30O4Na (MNa+) 297.2041. Calcd. 297.2042.
1,3-dihydroxypropan-2-yl dodecanoate (2b, utilizing Rhizomucor miehei). Lipozyme®,
immobilized from Rhizomucor miehei (100mg) was added to a solution of 2a (100 mg, 0.24
mmol) stirred in anhydrous EtOH (1 mL). The reaction was stirred for 24h, diluted with CH2Cl2
(3 mL), and the lipase was filtered off. The solvent was removed under reduced pressure, and
the resulting residue was chromatographed on silica gel (10% to 50% acetone/hexanes) to yield
2b (55 mg, 84%) as an oil. All spectral data was consistent with that obtained using the
procedure with C. antarctica.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3H3C(H2C)12
2-(tetradecanoyloxy)propane-1,3-diyl dibutyrate (3a). 347 mg, 99%, colorless oil. Rf = 0.47
(15% ethyl acetate/hexanes). 1H NMR (399MHz ,CHLOROFORM-d) δ = 5.32 - 5.22 (m, 1 H),
4.29 (dd, J = 4.4, 11.7 Hz, 2 H), 4.15 (dd, J = 5.9, 11.7 Hz, 2 H), 2.35 - 2.25 (m, 6 H), 1.70 - 1.56
(m, 6 H), 1.36 - 1.19 (m, 20 H), 0.94 (t, J = 7.3 Hz, 6 H), 0.87 (t, J = 6.6 Hz, 3 H). 13C NMR
(100MHz ,CHLOROFORM-d) δ = 173.4 (2C), 173.2, 69.1, 62.3 (2C), 36.1 (2C), 34.4, 32.2,
29.91, 29.89 (2C), 29.86, 29.7, 29.6, 29.5, 29.3, 25.1, 22.9, 18.6 (2C), 14.4, 13.9 (2C). IR (neat)
cm-1 2925, 2854, 1741, 1460. HRMS for C25H46O6Na (MNa+) 465.3195. Calcd. 465.3192.
O
O
OH
OHH3C(H2C)12
1,3-dihydroxypropan-2-yl tetradecanoate (3b). C. antarctica: 34mg, 49%; R. miehei: 57 mg,
82%; white solid. Rf = 0.22 (30% acetone/hexanes). MP = 57-58 °C. 1H NMR (399MHz
,CHLOROFORM-d) δ = 4.93 (quin, J = 4.8 Hz, 1 H), 3.89 - 3.78 (m, 3 H), 2.38 (t, J = 7.3 Hz, 2
![Page 111: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/111.jpg)
111
H), 2.17 - 2.10 (m, 2 H), 1.70 - 1.58 (m, 2 H), 1.38 - 1.19 (m, 20 H), 0.88 (t, J = 7.3 Hz, 3 H). 13C
NMR (100MHz ,CHLOROFORM-d) δ = 174.3, 75.2, 62.8 (2C), 34.6, 32.2, 29.91, 29.87 (2C),
29.8, 29.7, 29.6, 29.5, 29.3, 25.2, 22.9, 14.4. IR (neat) cm-1 3418, 2926, 2855, 1729, 1466.
HRMS for C17H34O4Na (MNa+) 325.2354. Calcd. 325.2355.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3H3C(H2C)14
2-(palmitoyloxy)propane-1,3-diyl dibutyrate (4a). 309 mg, 84%, colorless oil. Rf = 0.39 (15%
ethyl acetate/hexanes). 1H NMR (500MHz ,CHLOROFORM-d) δ = 5.30 - 5.25 (m, 1 H), 4.30
(dd, J = 4.2, 12.0 Hz, 2 H), 4.16 (dd, J = 5.9, 11.7 Hz, 2 H), 2.35 - 2.27 (m, 6 H), 1.70 - 1.58 (m,
6 H), 1.34 - 1.21 (m, 24 H), 0.98 - 0.92 (m, 6 H), 0.88 (t, J = 6.8 Hz, 3 H). 13C NMR (100MHz
,CHLOROFORM-d) δ = 173.4, 173.2 (2C), 69.1, 62.3 (2C), 36.1, 34.4, 32.2, 29.9 (6C), 29.7,
29.6, 29.5, 29.3, 25.1 (2C), 18.6 (3C), 14.4, 13.9 (2C). IR (neat) cm-1 2924, 1742, 1460. HRMS
for C27H50O6Na (MNa+) 493.3503. Calcd. 493.3505.
O
O
OH
OHH3C(H2C)14
1,3-dihydroxypropan-2-yl palmitate (4b). C. antarctica: 25 mg, 36%; R. miehei: 56 mg, 80%;
white solid. Rf = 0.27 (30% acetone/hexanes). MP = 64-65 °C. 1H NMR (500MHz
,CHLOROFORM-d) δ = 4.93 (quin, J = 4.8 Hz, 1 H), 3.84 (t, J = 4.9 Hz, 4 H), 2.38 (t, J = 7.6
Hz, 2 H), 2.13 - 2.05 (m, 2 H), 1.69 - 1.59 (m, 2 H), 1.38 - 1.20 (m, 24 H), 0.88 (t, J = 7.3 Hz, 3
H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 174.3, 75.2, 62.8 (2C), 34.6, 32.2, 29.93,
29.92, 29.89, 29.84, 29.7, 29.6, 29.5, 29.3, 25.2 (2C), 23.3, 22.9, 14.4. IR (neat) cm-1 3320, 2917,
2850, 1730, 1471. HRMS for C19H38O4Na (MNa+) 353.2668. Calcd. 353.2668.
![Page 112: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/112.jpg)
112
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3
(Z)-2-(hexadec-9-enoyloxy)propane-1,3-diyl dibutyrate (5a). 291 mg, 79%, colorless oil. Rf =
0.50 (15% ethyl acetate/hexanes). 1H NMR (399MHz ,CHLOROFORM-d) δ = 5.38 - 5.32 (m, 2
H), 5.31 - 5.24 (m, 1 H), 4.30 (dd, J = 4.4, 11.7 Hz, 2 H), 4.16 (dd, J = 5.9, 12.5 Hz, 2 H), 2.38 -
2.26 (m, 6 H), 2.01 (q, J = 6.6 Hz, 4 H), 1.72 - 1.56 (m, 6 H), 1.39 - 1.20 (m, 16 H), 0.95 (t, J =
7.3 Hz, 6 H), 0.88 (t, J = 7.0 Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 173.3 (2C),
173.1, 130.2, 129.9, 69.1, 62.3 (2C), 36.1 (2C), 34.4, 32.0, 30.0, 29.9, 29.4, 29.3, 29.25, 29.21,
27.5, 27.4, 25.1, 22.9, 18.6 (2C), 14.3, 13.8 (2C). IR (neat) cm-1 3007, 2928, 2856, 1742, 1459.
HRMS for C27H48O6Na (MNa+) 491.3347. Calcd. 491.3349.
O
O
OH
OH
(Z)-1,3-dihydroxypropan-2-yl hexadec-9-enoate (5b). C. antarctica: 46 mg, 66%; R. miehei:
58 mg, 83%; colorless oil. Rf = 0.25 (30% acetone/hexanes). 1H NMR (399MHz
,CHLOROFORM-d) δ = 5.40 - 5.31 (m, 2 H), 4.92 (quin, J = 4.8 Hz, 1 H), 3.86 - 3.79 (m, 4 H),
2.37 (t, J = 7.7 Hz, 2 H), 2.33 (br. s., 2 H), 2.05 - 1.97 (m, 4 H), 1.63 (quin, J = 7.3 Hz, 2 H),
1.39 - 1.23 (m, 16 H), 0.88 (t, J = 6.6 Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ =
174.3, 130.3, 129.9, 75.2, 62.6 (2C), 34.6, 32.0, 30.0, 29.9, 29.4, 29.32, 29.30, 29.2, 27.4, 27.4,
25.2, 22.9, 14.3. IR (neat) cm-1 3405, 3008, 2924, 2855, 1736, 1462. HRMS for C19H36O4Na
(MNa+) 351.2512. Calcd. 351.2511.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3H3C(H2C)16
![Page 113: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/113.jpg)
113
2-(stearoyloxy)propane-1,3-diyl dibutyrate (6a). 300 mg, 85%, colorless oil. Rf = 0.34 (15%
ethyl acetate/hexanes). 1H NMR (500MHz ,CHLOROFORM-d) δ = 5.30 - 5.24 (m, 1 H), 4.30
(dd, J = 4.4, 11.7 Hz, 2 H), 4.16 (dd, J = 6.1, 12.0 Hz, 2 H), 2.34 - 2.27 (m, 6 H), 1.70 - 1.59 (m,
6 H), 1.35 - 1.20 (m, 28 H), 0.98 - 0.93 (m, 6 H), 0.88 (t, J = 6.6 Hz, 3 H). 13C NMR (100MHz
,CHLOROFORM-d) δ = 173.4 (2C), 173.2, 69.1, 62.3 (2C), 36.2 (2C), 34.4, 32.2, 29.9 (4C),
29.89 (3C), 29.86, 29.7, 29.6, 29.5, 29.3, 25.1, 22.9, 18.6 (2C), 14.4, 13.9 (2C). IR (neat) cm-1
2924, 1742, 1460. HRMS for C29H54O6Na (MNa+) 521.3813. Calcd. 521.3818.
O
O
OH
OHH3C(H2C)16
1,3-dihydroxypropan-2-yl stearate (6b). C. antarctica: 32mg, 44%; R. miehei: 56 mg, 78%;
white solid. Rf = 0.23 (30% acetone/hexanes). MP = 68-69 °C. 1H NMR (399MHz
,CHLOROFORM-d) δ = 4.93 (quin, J = 4.6 Hz, 1 H), 3.88 - 3.82 (m, 4 H), 2.38 (t, J = 7.7 Hz, 2
H), 2.04 (t, J = 5.9 Hz, 2 H), 1.65 (quin, J = 7.3 Hz, 2 H), 1.38 - 1.19 (m, 28 H), 0.88 (t, J = 6.6
Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 174.3, 75.3, 62.8 (2C), 34.6, 32.2, 29.95
(5C), 29.91 (2C), 29.8, 29.7, 29.6, 29.5, 29.3, 25.2, 23.0, 13.8. IR (neat) cm-1 3313, 2916, 2849,
1730, 1472. HRMS for C21H42O4Na (MNa+) 381.2982. Calcd. 381.2981.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3
(Z)-2-(oleoyloxy)propane-1,3-diyl dibutyrate (7a). 290 mg, 82%, colorless oil. Rf = 0.43 (15%
ethyl acetate/hexanes). 1H NMR (500MHz ,CHLOROFORM-d) δ = 5.39 - 5.30 (m, 2 H), 5.30 -
5.24 (m, 1 H), 4.30 (dd, J = 4.4, 11.7 Hz, 2 H), 4.15 (dd, J = 6.1, 12.0 Hz, 2 H), 2.36 - 2.25 (m, 6
H), 2.01 (q, J = 6.2 Hz, 4 H), 1.71 - 1.55 (m, 6 H), 1.38 - 1.19 (m, 20 H), 0.95 (t, J = 7.3 Hz, 3
H), 0.88 (t, J = 6.8 Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 173.4 (2C), 173.1,
![Page 114: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/114.jpg)
114
130.3, 129.9, 69.1, 62.3, 36.1 (2C), 34.4, 32.1, 30.0, 29.9, 29.8, 29.6 (2C), 29.4, 29.3, 29.2, 27.5,
27.4, 25.1, 22.9, 18.6 (3C), 14.4, 13.9 (2C). IR (neat) cm-1 3007, 2925, 1742, 1460. HRMS for
C29H52O6Na (MNa+) 519.3658. Calcd. 519.3662.
O
O
OH
OH
1,3-dihydroxypropan-2-yl oleate (7b). C. antarctica: 48 mg, 67%; R. miehei: 60 mg, 83%;
colorless oil. Rf = 0.30 (30% acetone/hexanes). 1H NMR (399MHz ,CHLOROFORM-d) δ =
5.41 - 5.31 (m, 2 H), 4.92 (quin, J = 4.8 Hz, 1 H), 3.88 - 3.77 (m, 4 H), 2.49 (br. s., 2 H), 2.37 (t,
J = 7.7 Hz, 2 H), 2.01 (q, J = 6.4 Hz, 4 H), 1.63 (quin, J = 7.3 Hz, 2 H), 1.40 - 1.19 (m, 20 H),
0.88 (t, J = 6.6 Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 174.4, 130.3, 129.9, 75.1,
62.5 (2C), 34.6, 32.1, 30.0, 29.9, 29.8, 29.6, 29.4, 29.33, 29.31, 27.45, 27.38, 25.2 (2C), 22.9,
14.4. IR (neat) cm-1 3415, 3008, 2923, 2854, 1735, 1464. HRMS for C21H40O4Na (MNa+)
379.2827. Calcd. 379.2824.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3
2-((9Z,12Z)-octadeca-9,12-dienoyloxy)propane-1,3-diyl dibutyrate (8a). 344 mg, 98%,
colorless oil. Rf = 0.38 (15% ethyl acetate/hexanes). 1H NMR (399MHz ,CHLOROFORM-d) δ =
5.43 - 5.30 (m, 4 H), 5.29 - 5.24 (m, 1 H), 4.30 (dd, J = 4.4, 11.7 Hz, 2 H), 4.15 (dd, J = 5.9, 11.7
Hz, 2 H), 2.77 (t, J = 6.6 Hz, 2 H), 2.36 - 2.26 (m, 6 H), 2.05 (q, J = 6.6 Hz, 4 H), 1.72 - 1.56 (m,
6 H), 1.41 - 1.22 (m, 14 H), 0.95 (t, J = 7.7 Hz, 6 H), 0.89 (t, J = 7.0 Hz, 3 H). 13C NMR
(100MHz ,CHLOROFORM-d) δ = 173.3 (2C), 173.1, 130.5, 130.2, 128.3, 128.1, 69.1, 62.3
(2C), 36.1 (2C), 34.4, 31.8, 29.8, 29.6, 29.4 (2C), 29.3, 29.2, 27.4, 25.8, 25.1, 22.8, 18.6 (2C),
![Page 115: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/115.jpg)
115
14.3, 13.9 (2C). IR (neat) cm-1 3008, 2929, 2856, 1741, 1459. HRMS for C29H50O6Na (MNa+)
517.3506. Calcd. 517.3505.
O
O
OH
OH
(9Z,12Z)-1,3-dihydroxypropan-2-yl octadeca-9,12-dienoate (8b). C. antarctica: 45 mg, 63%;
R. miehei: 55 mg, 77%; colorless oil. Rf = 0.37 (30% acetone/hexanes). 1H NMR (399MHz
,CHLOROFORM-d) δ = 5.44 - 5.30 (m, 4 H), 4.93 (quin, J = 4.8 Hz, 1 H), 3.89 - 3.76 (m, 4 H),
2.77 (t, J = 6.6 Hz, 2 H), 2.38 (t, J = 7.3 Hz, 2 H), 2.13 (t, J = 6.2 Hz, 2 H), 2.05 (q, J = 6.8 Hz, 4
H), 1.69 - 1.59 (m, 2 H), 1.41 - 1.23 (m, 14 H), 0.89 (t, J = 6.6 Hz, 3 H). 13C NMR (100MHz
,CHLOROFORM-d) δ = 174.3, 130.5, 130.2, 128.3, 128.1, 75.2, 62.8 (2C), 34.6, 31.8, 29.8,
29.6, 29.4, 29.33, 29.30, 27.4, 25.9, 25.2 (2C), 22.8, 14.3. IR (neat) cm-1 3397, 010, 2926, 2855,
1736, 1459. HRMS for C21H38O4Na (MNa+) 377.2667. Calcd. 377.2668.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3
(Z)-2-(icos-11-enoyloxy)propane-1,3-diyl dibutyrate (9a). 328 mg, 88%, colorless oil. Rf =
0.42 (15% ethyl acetate/hexanes). 1H NMR (399MHz ,CHLOROFORM-d) δ = 5.38 - 5.32 (m, 2
H), 5.30 - 5.24 (m, 1 H), 4.30 (dd, J = 4.4, 11.7 Hz, 2 H), 4.16 (dd, J = 5.9, 12.5 Hz, 2 H), 2.36 -
2.26 (m, 6 H), 2.05 - 1.97 (m, 4 H), 1.71 - 1.57 (m, 6 H), 1.27 (br. s., 24 H), 0.95 (t, J = 7.3 Hz, 6
H), 0.88 (t, J = 6.6 Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 173.3 (2C), 173.1,
130.2, 130.0, 69.0, 62.3 (2C), 36.1 (2C), 34.4, 32.1, 30.0 (2C), 29.8, 29.7, 29.55 (2C), 29.52,
29.51, 29.3, 27.4 (2C), 25.1 (2C), 22.9, 18.6 (2C), 14.4, 13.9 (2C). IR (neat) cm-1 3008, 2925,
2855, 1742, 1459. HRMS for C31H56O6Na (MNa+) 547.3978. Calcd. 547.3975.
![Page 116: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/116.jpg)
116
O
O
OH
OH
(Z)-1,3-dihydroxypropan-2-yl icos-11-enoate (9b). C. antarctica: 40mg, 55%; R. miehei, 58
mg, 79%; white solid. Rf = 0.24 (30% acetone/hexanes). MP = 32-33 °C. 1H NMR (399MHz
,CHLOROFORM-d) δ = 5.38 - 5.32 (m, 2 H), 4.93 (quin, J = 4.8 Hz, 1 H), 3.89 - 3.78 (m, 4 H),
2.38 (t, J = 7.3 Hz, 2 H), 2.20 - 2.12 (m, 2 H), 2.01 (q, J = 6.6 Hz, 4 H), 1.71 - 1.57 (m, 2 H),
1.40 - 1.18 (m, 24 H), 0.88 (t, J = 6.6 Hz, 3 H). 13C NMR (100MHz ,CHLOROFORM-d) δ =
174.3, 130.2, 130.0, 75.2, 62.8 (2C), 34.6, 32.1, 30.0 (2C), 29.8, 29.7, 29.7, 29.6 (2C), 29.56,
29.51, 29.3, 27.4, 25.2 (2C), 23.0, 14.4. IR (neat) cm-1 3405, 3008, 2923, 2854, 1737, 1465.
HRMS for C23H44O4Na (MNa+) 407.3142. Calcd. 407.3137.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3
2-((5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenoyloxy)propane-1,3-diyl dibutyrate (10a).
168mg, 98%, colorless oil. Rf = 0.36 (30% ethyl acetate/hexanes). The 1H and 13C spectral data
(500 and 100 MHz, CDCl3) are in agreement with literature values.28 IR (neat) 3012, 2931, 1741,
1456. HRMS for C31H50O6Na (MNa+) 541.3502. Calcd. 541.3505.
O
O
OH
OH
(5Z,8Z,11Z,14Z)-1,3-dihydroxypropan-2-yl icosa-5,8,11,14-tetraenoate (10b). C. antarctica:
48mg, 67%; R. miehei: 54 mg, 75%; colorless oil. Rf = 0.30 (30% acetone/hexanes). The 1H and
13C spectral data (500 and 100 MHz, CDCl3) are in agreement with literature values.28 IR (neat)
3420, 2013, 2927, 1736, 1456. HRMS for C23H38O4Na (MNa+) 401.2677. Calcd. 401.2668.
![Page 117: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/117.jpg)
117
O
O
OCOCH3
OCOCH3
2-((4Z,7Z,10Z,13Z,16Z,19Z)-docosa-4,7,10,13,16,19-hexaenoyloxy)propane-1,3-diyl
diacetate (11a). EDCI (111 mg, 0.58 mmol), DMAP (6 mg, 0.06 mmol), and diacetin (44 mg,
0.25 mmol) were added to a solution of docosahexaenoic acid (75 mg, 0.23 mmol) in anhydrous
CH2Cl2 (5 mL) at 0 °C. The reaction was allowed to stir for 4h. Upon completion, the reaction
mixture was diluted with CH2Cl2 and H2O. The organic layer was separated, dried over MgSO4,
and removed under reduced pressure. The resulting residue was chromatographed on silica gel
(0% to 30% ethyl acetate/hexanes) to yield to 11a (111 mg, 99%) as a colorless oil. Rf = 0.55
(30% ethyl acetate/hexanes). 1H NMR (500MHz ,CHLOROFORM-d) δ = 5.47 - 5.32 (m, 12 H),
5.30 - 5.21 (m, 1 H), 4.29 (dd, J = 4.4, 11.7 Hz, 2 H), 4.16 (dd, J = 5.9, 12.2 Hz, 2 H), 2.93 - 2.77
(m, 10 H), 2.40 (d, J = 2.9 Hz, 4 H), 2.14 - 2.02 (m, 6 H), 0.98 (t, J = 7.6 Hz, 3 H). The 13C
spectral data (100 MHz, CDCl3) and IR data are in agreement with literature values.27 HRMS for
C29H42O6Na (MNa+) 509.2880. Calcd. 509.2879.
O
O
OH
OH
(4Z,7Z,10Z,13Z,16Z,19Z)-1,3-dihydroxypropan-2-yl docosa-4,7,10,13,16,19-hexaenoate
(11b). C. antarctica: 45 mg, 63%; R. miehei: 63 mg, 76%; colorless oil. Rf = 0.29 (30%
acetone/hexanes). 1H NMR (399MHz ,CHLOROFORM-d) δ = 5.52 - 5.22 (m, 12 H), 4.92 (quin,
J = 4.6 Hz, 1 H), 3.82 (t, J = 5.1 Hz, 4 H), 2.91 - 2.77 (m, 10 H), 2.49 - 2.37 (m, 4 H), 2.22 (t, J =
6.2 Hz, 2 H), 2.07 (quin, J = 7.5 Hz, 2 H), 0.97 (t, J = 7.3 Hz, 3 H). 13C NMR (100MHz
![Page 118: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/118.jpg)
118
,CHLOROFORM-d) δ = 173.5, 132.3 (2C), 129.8 (2C), 128.8, 128.6, 128.5 (2C), 128.3 (2C),
128.1, 127.9, 75.4, 62.6 (2C), 34.4, 25.8 (5C), 23.0 (2C), 20.8. IR (neat) cm-1 3401, 3013, 2663,
1736, 1390. HRMS for C25H38O4Na (MNa+) 425.2666. Calcd. 425.2668.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3H3C(H2C)20
2-(docosanoyloxy)propane-1,3-diyl dibutyrate (12a). 201 mg, 56%, colorless oil. Rf = 0.48
(15% ethyl acetate/hexanes). MP = 27-28 °C. 1H NMR (399MHz ,CHLOROFORM-d) δ = 5.32 -
5.23 (m, 1 H), 4.30 (dd, J = 4.4, 11.7 Hz, 2 H), 4.16 (dd, J = 5.9, 11.7 Hz, 2 H), 2.36 - 2.26 (m, 6
H), 1.71 - 1.57 (m, 6 H), 1.25 (s, 36 H), 0.95 (t, J = 7.3 Hz, 6 H), 0.88 (t, J = 6.6 Hz, 3 H). 13C
NMR (100MHz ,CHLOROFORM-d) δ = 173.4 (2C), 173.2, 69.1, 62.3 (2C), 36.0 (2C), 34.4,
32.2, 29.95 (9C), 29.91 (2C), 29.88, 29.7, 29.6, 29.5, 29.3, 25.1, 22.9, 18.6 (2C), 14.4, 13.9 (2C).
IR (neat) cm-1 2923. 2853, 1742, 1462. HRMS for C33H62O6Na (MNa+) 577.4446. Calcd.
577.4444.
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3H3C(H2C)20
1,3-dihydroxypropan-2-yl docosanoate (12b). C. antarctica: 32mg, 40%; R. miehei: 70 mg,
88%, white solid. Rf = 0.27 (30% acetone/hexanes). MP = 79-80 °C. 1H NMR (399MHz
,CHLOROFORM-d) δ = 4.93 (quin, J = 4.6 Hz, 1 H), 3.88 - 3.81 (m, 4 H), 2.38 (t, J = 7.7 Hz, 2
H), 2.08 (s, 2 H), 1.69 - 1.59 (m, 2 H), 1.38 - 1.19 (m, 36 H), 0.88 (t, J = 6.2 Hz, 3 H). 13C NMR
(100MHz ,CHLOROFORM-d) δ = 174.3, 75.2, 62.8 (2C), 34.6, 32.2, 31.8, 29.94 (7C), 29.90
(2C), 29.8, 29.7, 29.6, 29.5, 29.3, 25.2, 22.94, 22.89, 14.4. IR (neat) cm-1 3313, 297, 2850, 1730,
1472. HRMS for C25H50O4Na (MNa+) 437.3610. Calcd. 437.3607.
![Page 119: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/119.jpg)
119
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3
2-(3-phenylpropanoyloxy)propane-1,3-diyl dibutyrate (13a). 280mg, 98%, colorless oil. Rf =
0.48 (35% ethyl acetate/hexanes). 1H NMR (399MHz ,CHLOROFORM-d) δ = 7.33 - 7.25 (m, 2
H), 7.24 - 7.15 (m, 3 H), 5.31 - 5.23 (m, 1 H), 4.28 (dd, J = 4.4, 11.7 Hz, 2 H), 4.13 (dd, J = 5.9,
11.7 Hz, 2 H), 2.96 (t, J = 7.7 Hz, 2 H), 2.66 (t, J = 8.1 Hz, 2 H), 2.34 - 2.24 (m, 6 H), 1.64 (sxt,
J = 7.3 Hz, 4 H), 0.94 (t, J = 7.3 Hz, 6 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 173.3
(2), 172.2, 140.4, 128.7 (2), 128.5 (2), 126.6, 69.4, 62.2 (2), 36.1 (2), 35.9, 31.0, 18.6 (2), 13.9
(2C). IR (neat) cm-1 3027, 2966, 2877, 1737, 1455. HRMS for C20H28O6Na (MNa+) 387.1787.
Calcd. 387.1784.
O
O
OH
OH
1,3-dihydroxypropan-2-yl 3-phenylpropanoate (13b). C. antarctica: 38mg, 83%; R. miehei: 8
mg, 40%; white foam. Rf = 0.18 (40% acetone/hexanes). 1H NMR (399MHz ,CHLOROFORM-
d) δ = 7.36 - 7.28 (m, 2 H), 7.26 - 7.18 (m, 3 H), 4.89 (td, J = 4.5, 9.3 Hz, 1 H), 3.79 - 3.71 (m, 4
H), 3.02 - 2.96 (m, 2 H), 2.77 - 2.70 (m, 2 H), 1.91 - 1.83 (m, 2 H). 13C NMR (100MHz
,CHLOROFORM-d) δ = 175.2, 140.4, 128.8 (2), 128.5 (2), 126.7, 75.5, 62.6 (2), 36.1, 31.8. IR
(neat) cm-1 3412, 3029, 2935, 2881, 1731, 1454. HRMS for C12H16O4Na (MNa+) 247.0945.
Calcd. 247.0946.
![Page 120: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/120.jpg)
120
O
O
OCO(CH2)2CH3
OCO(CH2)2CH3
2-(5-phenylpentanoyloxy)propane-1,3-diyl dibutyrate (14a). 298mg, 99%, colorless oil. Rf =
0.63 (35% ethyl acetate/hexanes). 1H NMR (500MHz ,CHLOROFORM-d) δ = 7.31 - 7.24 (m, 2
H), 7.21 - 7.14 (m, 3 H), 5.31 - 5.23 (m, 1 H), 4.30 (dd, J = 4.4, 11.7 Hz, 2 H), 4.14 (dd, J = 5.9,
11.7 Hz, 2 H), 2.63 (t, J = 7.1 Hz, 2 H), 2.35 (t, J = 6.8 Hz, 2 H), 2.29 (t, J = 6.8 Hz, 4 H), 1.71 -
1.58 (m, 8 H), 0.94 (t, J = 7.3 Hz, 6 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 173.4 (2C),
172.9, 142.2, 128.6 (2C), 128.6 (2C), 126.0, 69.2, 62.3 (2C), 36.1 (2C), 35.8, 34.2, 31.0, 24.7,
18.6 (2C), 13.8 (2C). IR (neat) cm-1 3028, 2965, 2876, 1738, 1454. HRMS for C22H32O6Na
(MNa+) 415.2094. Calcd. 415.2097.
O
O
OH
OH
1,3-dihydroxypropan-2-yl 5-phenylpentanoate (14b). C. antarctica: 50mg, 83%; R. miehei:
24mg, 37%; white foam. Rf = 0.26 (40% acetone/hexanes). 1H NMR (399MHz
,CHLOROFORM-d) δ = 7.31 - 7.25 (m, 2 H), 7.22 - 7.13 (m, 3 H), 4.92 (td, J = 4.8, 9.5 Hz, 1
H), 3.86 - 3.76 (m, 4 H), 2.64 (t, J = 7.0 Hz, 2 H), 2.41 (t, J = 7.0 Hz, 2 H), 2.17 - 2.11 (m, 2 H),
1.74 - 1.60 (m, 4 H). 13C NMR (100MHz ,CHLOROFORM-d) δ = 174.0, 142.2, 128.6 (4C),
126.1, 75.2, 62.7 (2C), 35.8, 34.4, 31.0, 24.7. IR (neat) cm-1 3414, 3027, 2936, 2882, 1731, 1454.
HRMS for C14H20O4Na (MNa+) 275.1257. Calcd. 275.1259.
![Page 121: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/121.jpg)
121
O
NH
OH
(5Z,8Z,11Z,14Z)-N-(2-hydroxyethyl)icosa-5,8,11,14-tetraenamide (15).
Novozym 435 (100 mg) and ethanolamine (06 uL, 0.096 mmol) were added to a stirred solution
of methyl arachidonate (25 mg, 0.08 mmol) in a 1:1 mixture of hexanes and isopropyl ether (1
mL). The reaction was heated to 45 °C and stirred until completion (TLC monitoring, 2 h). The
reaction mixture was diluted with diethyl ether and filtered. The solvent was evacuated off under
reduced pressure and the resulting residue was chromatographed on silica gel to yield 15 (24 mg,
89%) as an oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 5.79 - 5.95 (m, 1H), 5.28 - 5.46 (m,
8H), 3.73 (q, J = 4.3 Hz, 2H), 3.41 - 3.45 (m, 2H), 2.78 - 2.87 (m, 6H), 2.22 (t, J = 7.3 Hz, 2H),
2.13 (q, J = 7.1 Hz, 2H), 2.06 (q, J = 7.3 Hz, 2H), 1.74 (quin, J = 7.5 Hz, 2H), 1.33 - 1.40 (m,
2H), 1.26 - 1.33 (m, 4H), 0.89 (t, J = 6.7 Hz, 3H).
O
NH
OH
(5Z,8Z,11Z,14Z)-N-((R)-1-hydroxypropan-2-yl)icosa-5,8,11,14-tetraenamide (16). The
procedure for 15 was followed to synthesize 16 (28 mg, 98%, 24 h). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 5.46 - 5.53 (m, 1 H) 5.29 - 5.44 (m, 8 H) 4.25 - 4.34 (m, 1 H) 4.13
(dd, J=11.0, 5.5 Hz, 1 H) 4.00 (dd, J=11.0, 4.3 Hz, 1 H) 2.73 - 2.90 (m, 7 H) 2.34 (t, J=7.6 Hz, 2
H) 2.15 (q, J=7.3 Hz, 2 H) 2.06 (q, J=6.7 Hz, 2 H) 1.71 (quin, J=7.5 Hz, 2 H) 1.36 (quin, J=6.7
Hz, 2 H) 1.25 - 1.32 (m, 4 H) 1.16 (d, J=6.7 Hz, 3 H) 0.89 (t, J=7.0 Hz, 3 H).
![Page 122: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/122.jpg)
122
O
NH
(5Z,8Z,11Z,14Z)-N-cyclopropylicosa-5,8,11,14-tetraenamide (17). The procedure for 15 was
followed to synthesize 17 (mg, 85%, 3 h). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.56
(br. s., 1 H) 5.24 - 5.46 (m, 8 H) 2.82 (dq, J=12.4, 6.1 Hz, 6 H) 2.70 (tq, J=7.1, 3.6 Hz, 1 H) 2.09
- 2.15 (m, 4 H) 2.01 - 2.08 (m, 2 H) 1.70 (quin, J=7.5 Hz, 2 H) 1.33 - 1.40 (m, 2 H) 1.25 - 1.33
(m, 4 H) 0.89 (t, J=6.7 Hz, 2 H) 0.74 - 0.79 (m, 2 H) 0.45 - 0.50 (m, 2 H).
OH
O
NH
OH
(5Z,8Z,11Z)-13-hydroxy-N-(2-hydroxyethyl)trideca-5,8,11-trienamide (18). The procedure
for 15 was followed to synthesize 18 (mg, 85%, 24 h). 1H NMR (500 MHz, CHLOROFORM-d)
δ ppm 6.32 (br. s., 1 H) 5.58 - 5.71 (m, 1 H) 5.47 - 5.57 (m, 1 H) 5.25 - 5.46 (m, 4 H) 4.22 (d,
J=6.7 Hz, 2 H) 3.70 (t, J=4.9 Hz, 2 H) 3.40 (q, J=5.5 Hz, 2 H) 2.87 (t, J=6.4 Hz, 2 H) 2.81 (t,
J=6.1 Hz, 2 H) 2.22 (t, J=7.3 Hz, 2 H) 2.09 - 2.15 (m, 2 H) 1.72 (quin, J=7.5 Hz, 2 H).
N3
O
NH
(5Z,8Z,11Z)-13-azido-N-cyclopropyltrideca-5,8,11-trienamide (19). The procedure for 15
was followed to synthesize 19 (mg, 60%, 24 h). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm
5.66 - 5.86 (m, 1 H) 5.48 - 5.64 (m, 1 H) 5.33 - 5.46 (m, 4 H) 3.69 - 3.75 (m, 2 H) 2.86 (t, J=5.8
Hz, 2 H) 2.75 - 2.80 (m, 2 H) 2.70 (tq, J=7.0, 3.5 Hz, 1 H) 2.06 - 2.15 (m, 4 H) 1.70 (quin, J=7.5
Hz, 2 H) 0.74 - 0.79 (m, 2 H) 0.45 - 0.51 (m, 2 H).
![Page 123: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/123.jpg)
123
O
NH
N-cyclohexyloleamide (20). The procedure for 15 was followed to synthesize 20 (mg, 41%, 24
h). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.29 - 5.39 (m, 2 H) 2.36 (br. s., 2 H) 1.98 -
2.04 (m, 4 H) 1.58 - 1.67 (m, 2 H) 1.22 - 1.37 (m, 24 H) 0.88 (t, J=7.3 Hz, 3 H).
O
NH
(4Z,7Z,10Z,13Z,16Z,19Z)-N-cyclopropyldocosa-4,7,10,13,16,19-hexaenamide (21). The
procedure for 15 was followed to synthesize 21 (mg, 85%, 3 h). 1H NMR (399 MHz,
CHLOROFORM-d) δ ppm 5.61 (br. s., 1 H) 5.23 - 5.47 (m, 12 H) 2.75 - 2.91 (m, 10 H) 2.70
(ddt, J=10.8, 7.1, 3.1, 3.1 Hz, 1 H) 2.40 (q, J=7.1 Hz, 2 H) 2.18 (t, J=7.3 Hz, 2 H) 2.02 - 2.12 (m,
2 H) 0.97 (t, J=6.6 Hz, 3 H) 0.73 - 0.80 (m, 2 H) 0.44 - 0.51 (m, 2 H).
O
NH
H3C(H2C)14
N-(prop-2-ynyl)palmitamide (22). The procedure for 15 was followed to synthesize 22 (mg,
84%, 3 h). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.51 - 5.60 (m, 1 H) 4.06 (dd, J=5.2,
2.7 Hz, 2 H) 2.23 (t, J=2.4 Hz, 1 H) 2.19 (t, J=7.3 Hz, 2 H) 1.59 - 1.67 (m, 2 H) 1.20 - 1.33 (m,
24 H) 0.88 (t, J=7.0 Hz, 3 H)
O
NH
N-benzylhex-5-ynamide (23). The procedure for 15 was followed to synthesize 23 (mg, 95%,
24 h). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 7.32 - 7.37 (m, 2 H) 7.27 - 7.31 (m, 3 H)
![Page 124: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/124.jpg)
124
5.75 (br. s., 1 H) 4.45 (d, J=6.1 Hz, 2 H) 2.37 (t, J=7.3 Hz, 2 H) 2.28 (td, J=6.9, 2.7 Hz, 2 H)
1.96 (t, J=2.7 Hz, 1 H) 1.90 (quin, J=7.0 Hz, 2 H).
O
NH
OH
N-(2-hydroxyethyl)-3-phenylpropanamide (24). The procedure for 15 was followed to
synthesize 24 (mg, 90%, 24 h). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 7.27 - 7.33 (m, 2
H) 7.18 - 7.24 (m, 3 H) 5.79 (br. s., 1 H) 3.63 (q, J=4.9 Hz, 2 H) 3.33 - 3.38 (m, 2 H) 2.98 (t,
J=7.6 Hz, 2 H) 2.51 (t, J=7.6 Hz, 2 H) 2.40 (t, J=5.2 Hz, 1 H).
O
NH
N-benzylbenzamide (25). The procedure for 15 was followed to synthesize 25 (mg, 91%, 24 h).
1H NMR (500 MHz, CHLOROFORM-d) δ ppm 7.34 - 7.37 (m, 2 H) 7.27 - 7.32 (m, 5 H) 7.19 -
7.24 (m, 3 H) 5.82 (br. s., 1 H) 4.47 (d, J=6.1 Hz, 2 H).
![Page 125: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/125.jpg)
125
3.6 References 1. Busquets-Garcia, A.; Puighermanal, E.; Pastor, A.; de la Torre, R.; Maldonado, R.; Ozaita, A. Differential role of anandamide and 2-arachidonoylglycerol in memory and anxiety-like responses. Biological Psychiatry 2011, 70, 479-86. 2. Higuchi, S.; Irie, K.; Yamaguchi, R.; Katsuki, M.; Araki, M.; Ohji, M.; Hayakawa, K.; Mishima, S.; Akitake, Y.; Matsuyama, K.; Mishima, K.; Iwasaki, K.; Fujiwara, M. Hypothalamic 2-arachidonoylglycerol regulates multistage process of high-fat diet preferences. PLoS One 2012, 7, e38609. 3. Jung, K. M.; Clapper, J. R.; Fu, J.; D'Agostino, G.; Guijarro, A.; Thongkham, D.; Avanesian, A.; Astarita, G.; DiPatrizio, N. V.; Frontini, A.; Cinti, S.; Diano, S.; Piomelli, D. 2-arachidonoylglycerol signaling in forebrain regulates systemic energy metabolism. Cell Metab 2012, 15, 299-310. 4. Seif, T.; Makriyannis, A.; Kunos, G.; Bonci, A.; Hopf, F. W. The endocannabinoid 2-arachidonoylglycerol mediates D1 and D2 receptor cooperative enhancement of rat nucleus accumbens core neuron firing. Neuroscience 2011, 193, 21-33. 5. Boswinkel, G.; Derksen, J.; van't Riet, K.; Cuperus, F. Kinetics of acyl migration in monoglycerides and dependence on acyl chainlength. Journal of the American Oil Chemists' Society 1996, 73, 707-711. 6. Lyubachevskaya, G.; Boyle-Roden, E. Kinetics of 2-monoacylglycerol acyl migration in model chylomicra. Lipids 2000, 35, 1353-1358. 7. Stelt, M. v. d.; Kuik, J. A. v.; Bari, M.; Zadelhoff, G. v.; Leeflang, B. R.; Veldink, G. A.; Finazzi-Agro`, A.; Vliegenthart, J. F. G.; Maccarrone, M. Oxygenated Metabolites of Anandamide and 2-Arachidonoylglycerol: Conformational Analysis and Interaction with Cannabinoid Receptors, Membrane Transporter, and Fatty Acid Amide Hydrolase. Journal of Medicinal Chemistry 2002, 45, 3709-3720. 8. Kingsley, P. J.; Marnett, L. J. Analysis of endocannabinoids by Ag+ coordination tandem mass spectrometry. Analytical Biochemistry 2003, 314, 8-15. 9. Martin, J. B. The Equilibrium between Symmetrical and Unsymmetrical Monoglycerides and Determination of Total Monoglycerides. Journal of the American Chemical Society 1953, 75, 5483-5486. 10. Han, L.; Razdan, R. K. Total synthesis of 2-Arachidonylglycerol (2-Ara-Gl). Tetrahedron Letters 1999, 40, 1631-1634. 11. Seltzman, H. H.; Fleming, D. N.; Hawkins, G. D.; Carroll, F. I. Facile synthesis and stabilization of 2-arachidonylglycerol via its 1,3-phenylboronate ester. Tetrahedron Letters 2000, 41, 3589-3592. 12. Stamatov, S. D.; Stawinski, J. Regioselective opening of an oxirane system with trifluoroacetic anhydride. A general method for the synthesis of 2-monoacyl- and 1,3-symmetrical triacylglycerols. Tetrahedron 2005, 61, 3659-3669. 13. Uwe T, B. Lipase-catalyzed syntheses of monoacylglycerols. Enzyme and Microbial Technology 1995, 17, 578-586. 14. Berger, M.; Laumen, K.; Schneider, M. Enzymatic esterification of glycerol I. Lipase-catalyzed synthesis of regioisomerically pure 1,3-sn -diacylglycerols. Journal of the American Oil Chemists' Society 1992, 69, 955-960.
![Page 126: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/126.jpg)
126
15. Berger, M.; Schnelder, M. Enzymatic esterification of glycerol II. Lipase-catalyzed synthesis of regioisomerically pure 1(3)-rac -monoacylglycerols. Journal of the American Oil Chemists' Society 1992, 69, 961-965. 16. Piyatheerawong, W.; Yamane, T.; Nakano, H.; Iwasaki, Y. Enzymatic preparation of enantiomerically pure sn -2,3-diacylglycerols: A stereoselective ethanolysis approach. Journal of the American Oil Chemists' Society 2006, 83, 603-607. 17. Irimescu, R.; Yasui, M.; Iwasaki, Y.; Shimidzu, N.; Yamane, T. Enzymatic synthesis of 1,3-dicapryloyl-2-eicosapentaenoylglycerol. Journal of the American Oil Chemists' Society 2000, 77, 501-506. 18. Rosu, R.; Yasui, M.; Iwasaki, Y.; Yamane, T. Enzymatic synthesis of symmetrical 1,3-diacylglycerols by direct esterification of glycerol in solvent-free system. Journal of the American Oil Chemists' Society 1999, 76, 839-843. 19. Schmid, U.; Bornscheuer, U. T.; Soumanou, M. M.; McNeill, G. P.; Schmid, R. D. Highly selective synthesis of 1,3-oleoyl-2-palmitoylglycerol by lipase catalysis. Biotechnology and Bioengineering 1999, 64, 678-684. 20. Byun, H.-G.; Eom, T.-K.; Jung, W.-K.; Kim, S.-K. Lipase catalyzed production of monoacylglycerols by the esterification of fish oil fatty acids with glycerol. Biotechnology and Bioprocess Engineering 2007, 12, 491-496. 21. Waldinger, C.; Schneider, M. Enzymatic esterification of glycerol III. Lipase-catalyzed synthesis of regioisomerically pure 1,3-sn -diacylglycerols and 1 (3)- rac -monoacylglycerols derived from unsaturated fatty acids. Journal of the American Oil Chemists' Society 1996, 73, 1513-1519. 22. Schmid, U.; Bornscheuer, U.; Soumanou, M.; McNeill, G.; Schmid, R. Optimization of the reaction conditions in the lipase-catalyzed synthesis of structured triglycerides. Journal of the American Oil Chemists' Society 1998, 75, 1527-1531. 23. Soumanou, M. M.; Bornscheuer, U. T.; Schmid, U.; Schmid, R. D. Crucial Role of Support and Water Activity on the Lipase-Catalyzed Synthesis of Structured Triglycerides. Biocatalysis and Biotransformation 1999, 16, 443-459. 24. Soumanou, M.; Bornscheuer, U.; Schmid, R. Two-step enzymatic reaction for the synthesis of pure structured triacylglycerides. Journal of the American Oil Chemists' Society 1998, 75, 703-710. 25. Wongsakul, S.; Prasertsan, P.; Bornscheuer, U. T.; H-Kittikun, A. Synthesis of 2-monoglycerides by alcoholysis of palm oil and tuna oil using immobilized lipases. European Journal of Lipid Science and Technology 2003, 105, 68-73. 26. Irimescu, R.; Iwasaki, Y.; Hou, C. Study of TAG ethanolysis to 2-MAG by immobilized Candida antarctica lipase and synthesis of symmetrically structured TAG. Journal of the American Oil Chemists' Society 2002, 79, 879-883. 27. Devane, W. A.; Dysarz, F. A.; Johnson, M. R.; Melvin, L. S.; Howlett, A. C. Determination and characterization of a cannabinoid receptor in rat brain. Molecular Pharmacology 1988, 34, 605-613. 28. Vadivel, S. K.; Whitten, K. M.; Makriyannis, A. Chemoenzymatic synthesis of 2-arachidonoylglycerol, an endogenous ligand for cannabinoid receptors. Tetrahedron Letters 2011, 52, 1149-1150. 29. Duclos, R. I.; Johnston, M.; Vadivel, S. K.; Makriyannis, A.; Glaser, S. T.; Gatley, S. J. A Methodology for Radiolabeling of the Endocannabinoid 2-Arachidonoylglycerol (2-AG). The Journal of Organic Chemistry 2011, 7, 2049–2055.
![Page 127: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/127.jpg)
127
30. Halldorsson, A.; Magnusson, C. D.; Haraldsson, G. G. Chemoenzymatic synthesis of structured triacylglycerols by highly regioselective acylation. Tetrahedron 2003, 59, 9101-9109. 31. Takagi, T.; Ando, Y. Stereospecific analysis of triacyl-<i>sn</i>-glycerols by chiral high-performance liquid chromatography. Lipids 1991, 26, 542-547. 32. Irimescu, R.; Furihata, K.; Hata, K.; Iwasaki, Y.; Yamane, T. Two-step enzymatic synthesis of docosahexaenoic acid-rich symmetrically structured triacylglycerols <i>via</i> 2-monoacylglycerols. Journal of the American Oil Chemists' Society 2001, 78, 743-748. 33. Coulon, D.; Faure, L.; Salmon, M.; Wattelet, V.; Bessoule, J.-J. N-Acylethanolamines and related compounds: Aspects of metabolism and functions. Plant Science 2012, 184, 129-140. 34. Ezzili, C.; Otrubova, K.; Boger, D. L. Fatty acid amide signaling molecules. Bioorganic & Medicinal Chemistry Letters 2010, 20, 5959-5968. 35. Ueda, N.; Tsuboi, K.; Uyama, T. Enzymological studies on the biosynthesis of N-acylethanolamines. Biochimica et Biophysica Acta (BBA) - Molecular and Cell Biology of Lipids 2010, 1801, 1274-1285. 36. Abadji, V.; Lin, S.; Taha, G.; Griffin, G.; Stevenson, L. A.; Pertwee, R. G.; Makriyannis, A. (R)-Methanandamide: A Chiral Novel Anandamide Possessing Higher Potency and Metabolic Stability. Journal of Medicinal Chemistry 1994, 37, 1889-1893. 37. Goutopoulos, A.; Fan, P.; Khanolkar, A. D.; Xie, X.-Q.; Lin, S.; Makriyannis, A. Stereochemical Selectivity of Methanandamides for the CB1 and CB2 Cannabinoid Receptors and Their Metabolic Stability. Bioorganic & Medicinal Chemistry 2001, 9, 1673-1684. 38. Bezuglov, V.; Bobrov, M.; Gretskaya, N.; Gonchar, A.; Zinchenko, G.; Melck, D.; Bisogno, T.; Di Marzo, V.; Kuklev, D.; Rossi, J.-C.; Vidal, J.-P.; Durand, T. Synthesis and biological evaluation of novel amides of polyunsaturated fatty acids with dopamine. Bioorganic & Medicinal Chemistry Letters 2001, 11, 447-449. 39. El Fangour, S.; Balas, L.; Rossi, J.-C.; Fedenyuk, A.; Gretskaya, N.; Bobrov, M.; Bezuglov, V.; Hillard, C. J.; Durand, T. Hemisynthesis and preliminary evaluation of novel endocannabinoid analogues. Bioorganic & Medicinal Chemistry Letters 2003, 13, 1977-1980. 40. Urbani, P.; Cavallo, P.; Cascio, M. G.; Buonerba, M.; De Martino, G.; Di Marzo, V.; Saturnino, C. New metabolically stable fatty acid amide ligands of cannabinoid receptors: Synthesis and receptor affinity studies. Bioorganic & Medicinal Chemistry Letters 2006, 16, 138-141. 41. Li, C.; Xu, W.; Vadivel, S. K.; Fan, P.; Makriyannis, A. High affinity electrophilic and photoactivatable covalent endocannabinoid probes for the CB1 receptor. J Med Chem 2005, 48, 6423-9. 42. Yao, F.; Li, C.; Vadivel, S. K.; Bowman, A. L.; Makriyannis, A. Development of novel tail-modified anandamide analogs. Bioorganic & Medicinal Chemistry Letters 2008, 18, 5912-5915. 43. Bundesmann, M. W.; Coffey, S. B.; Wright, S. W. Amidation of esters assisted by Mg(OCH3)2 or CaCl2. Tetrahedron Lett. 2010, 51, 3879-3882. 44. Hoegberg, T.; Stroem, P.; Ebner, M.; Raemsby, S. Cyanide as an efficient and mild catalyst in the aminolysis of esters. Journal of Organic Chemistry 1987, 52, 2033-2036. 45. Ohshima, T.; Hayashi, Y.; Agura, K.; Fujii, Y.; Yoshiyama, A.; Mashima, K. Sodium methoxide: a simple but highly efficient catalyst for the direct amidation of esters. Chemical Communications 2012, 48, 5434-5436.
![Page 128: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/128.jpg)
128
46. Gnanaprakasam, B.; Milstein, D. Synthesis of amides from esters and amines with liberation of H2 under neutral conditions. J. Am. Chem. Soc. 2011, 133, 1682-1685. 47. Han, C.; Lee, J. P.; Lobkovsky, E.; Porco, J. A. Catalytic Ester−Amide Exchange Using Group (IV) Metal Alkoxide−Activator Complexes. Journal of the American Chemical Society 2005, 127, 10039-10044. 48. Ishihara, K.; Kuroki, Y.; Hanaki, N.; Ohara, S.; Yamamoto, H. Antimony-Templated Macrolactamization of Tetraamino Esters. Facile Synthesis of Macrocyclic Spermine Alkaloids, (±)-Buchnerine, (±)-Verbacine, (±)-Verbaskine, and (±)-Verbascenine. Journal of the American Chemical Society 1996, 118, 1569-1570. 49. Nuijens, T.; Cusan, C.; Kruijtzer, J. A. W.; Rijkers, D. T. S.; Liskamp, R. M. J.; Quaedflieg, P. J. L. M. Enzymatic Synthesis of C-Terminal Arylamides of Amino Acids and Peptides. Journal of Organic Chemistry 2009, 74, 5145-5150. 50. Gotor, V. Non-conventional hydrolase chemistry: amide and carbamate bond formation catalyzed by lipases. Bioorganic & Medicinal Chemistry 1999, 7, 2189-2197. 51. Bistline, R.; Bilyk, A.; Feairheller, S. Lipase catalyzed formation of fatty amides. Journal of the American Oil Chemists' Society 1991, 68, 95-98. 52. Adamczyk, M.; Grote, J. Pseudomonas cepacia lipase mediated amidation of benzyl esters. Tetrahedron Letters 1996, 37, 7913-7916. 53. Dhake, K. P.; Qureshi, Z. S.; Singhal, R. S.; Bhanage, B. M. Candida antarctica lipase B-catalyzed synthesis of acetamides using [BMIm(PF6)] as a reaction medium. Tetrahedron Letters 2009, 50, 2811-2814. 54. Tufvesson, P.; Annerling, A.; Hatti-Kaul, R.; Adlercreutz, D. Solvent-free enzymatic synthesis of fatty alkanolamides. Biotechnology and Bioengineering 2007, 97, 447-53. 55. Nechab, M.; Azzi, N.; Vanthuyne, N.; Bertrand, M.; Gastaldi, S.; Gil, G. Highly selective enzymatic kinetic resolution of primary amines at 80 degrees C: a comparative study of carboxylic acids and their ethyl esters as acyl donors. Journal of Organic Chemistry 2007, 72, 6918-23. 56. Couturier, L.; Taupin, D.; Yvergnaux, F. Lipase-catalyzed chemoselective aminolysis of various aminoalcohols with fatty acids. Journal of Molecular Catalysis B: Enzymatic 2009, 56, 29-33. 57. Whitten, K. M.; Makriyannis, A.; Vadivel, S. K. Application of chemoenzymatic hydrolysis in the synthesis of 2-monoacylglycerols. Tetrahedron 2012, 68, 5422-5428. 58. Whitten, K. M.; Makriyannis, A.; Vadivel, S. K. Enzymatic synthesis of N-Acylethanolamines: Direct method for the aminolysis of esters. Tetrahedron Letters 2012, 53, 5753-5755.
![Page 129: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/129.jpg)
129
CHAPTER 4
CHEMICALLY AND METABOLICALLY STABLE 2-ARACHIDONOYLGLYCEROL
ANALOGS
![Page 130: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/130.jpg)
130
4.1 Introduction
Through the use of chemoenzymatic methods we minimized the acyl migration of 2-AG
during synthesis, however, the chemical and metabolic instability of 2-AG is an issue during
storage, in vitro assays, and during in vivo pharmacological profile experiments. The chemical
instability of 2-AG leads to acyl migration to 1-AG, which can produce different effects, while
metabolic instability results in rapid hydrolysis to arachidonic acid and glycerol. The first
reported stable 2-AG analog discovered was 2-arachidonyl glycerol ether1 (2-AGE, Figure 4.1);
which was synthesized and evaluated by Sugiura, et al.2 2-AGE is an analog with comparable
although weaker) cannabinergic in vitro and in vivo properties than 2-AG. This observation led
to the discussion of 2-AGE being labeled as the third endocannabinoid.3
A common technique to improve metabolic stability of a compound is the introduction of
steric moieties at the site of hydrolysis.4 This technique was tested with 2-AG by α-methylation
of the glycerol ester carbonyl (1, Figure 4.1).5 At the same time the glycerol hydroxyl groups
were replaced with fluorine in an attempt to prevent acyl migration, as seen with 2 and 3.
However, the introduction of this methyl resulted in a significant decrease in CB1 affinity as
compared to 2-AG. α-Methylation was also unsuccessful in preventing acyl migration in a
membrane free buffer solution, although a 50% decrease in hydrolysis to arachidonic acid was
observed. Mono-fluorination of 2-AG, 2, showed a dramatic decrease in affinity, while 3 had
even less activity at the CB receptor. Parkkari, et al., replaced the -C5H11 tail of 2-AG with a
dimethylheptyl group, however, no improvement in activity or efficacy over 2-AG was
observed.6 These results support the importance of the free hydroxyl groups of the glycerol as
crucial features for high affinity and efficacy of 2-AG type compounds in the CB system.
![Page 131: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/131.jpg)
131
O
O
OH
OHO
O
OH
FO
O
F
F
O
OH
OH
OH
OH
OH
OH
OH
OHO OH
O
OHO
OHO
OHO
OHO
OHO
OH
meso-7 meso-9±8
2-AG
1 2 3
4 5 6
HO OO
O
OH
OH10
5 10
O
OH
OH
2-AGE
O
Figure 4.1 2-AG and published 2-AG analogs
The most obvious method to prevent hydrolysis would be to remove the ester, as seen in
2-AGE. Suhara, et al., did this by replacing the ester with a ketone, as in 4, followed by a
reduction of the ketone to the racemic alcohol (5), and finally the conversion to straight alkyl
linkage in 6. While this increased metabolic stability, it markedly reduced the binding affinity as
compared to 2-AG.7
![Page 132: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/132.jpg)
132
Our lab has synthesized conformationally constrained 2-AG analogs designed to increase
chemical and metabolic stability. Meso-7 showed minimal hydrolysis by FAAH and MGL,
while 8 and meso-9 were only stable towards MGL. However, their binding affinities for the CB
receptors were reduced as compared to 2-AG.8
More recently, Brizzi, et al., developed resorcinol-sn-glycerol derivatives as 2-AG
analogs.9 Compound 10 displayed exceptional CB1 binding affinity (10 nM), however, this class
of compounds exhibited very low efficacy in multiple assays. The authors’ findings also
suggested that these compounds possessed acceptable metabolic stability. The weak functional
activity of the glycerol compounds was proposed to be from rapid acyl migration to the 1-AG
variant of the analog which would produce reduced activity.
The preparation of 2-AG analogs that maintain sufficient affinity and efficacy in vitro
and in vivo while simultaneously surmounting chemical and metabolic instabilities has so far
been unsuccessful. The identification of a stable 2-AG analog is critical for understanding the
pharmacological profile and complete biological function.
4.2 Synthesis of Biphenyl 2-AG Analogs
The first strategy was to synthesize 2-AG analogs that replaced the fatty acid backbone
with a biphenyl moiety. In endocannabinoids the unsaturated region of the arachidonic chain
folds itself into a ‘U’ or ‘J’ conformation10 in which the alkyl chain wraps itself around and the
C5H11 tail is in the vicinity of the ester head-group. It’s hypothesized that the length of the tail
influences the acyl migration of the glycerol ester of 2-MAG, as the rate of acyl migration has
observed to decrease with shorter fatty acid chains.11 The arachidonic chain is also believed to
mimic the tricyclic structure of THC,12 therefore, by replacing a long saturated chain with a
![Page 133: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/133.jpg)
133
biphenyl moiety we may be able to reduce acyl migration while maintaining cannabinoid
potency and efficacy.
The first analogs were synthesized from biphenyl-4-carboxaldehyde 11. Treatment with
methyl (triphenylphosphoranylidene)acetate yielded the Wittig product 12 as mostly the trans
isomer (Scheme 4.1). While the cis isomer was separated from 12, ensuing hydrolysis
isomerized the Z-alkene to result in 13. Biphenyl acid 14 was the product of 11 treated with (2-
carboxyethyl)triphenylphosphonium bromide and potassium tert-butoxide.
Scheme 4.1 Synthesis of biphenyl 2-AG analogs
H
O
O
O
O
On
O
O
O
O
O
On
OH
O
O
O
On
OH
OH
O
O
O
O
O
O
O
O
O
O
OHO
O
OH
OH
O
OHn
13 n = 014 n = 1
Ph3 P
O
O
51%
Ph3P
O
OHBr
KOtBu, THF, -78 °C
46%
LiOH, THF57%
EDCI, 1,3-DBGDMAP, DCM
83-84%
15 n = 016 n = 1
C. antarcticaethanol
35-67%
17 n = 019 n = 1 18 n = 0
12Pd/C, H2, EtOAc
82%
O
O
O
OHLiOH, THF
63%
EDCI, 1,3-DBGDMAP, DCM
61%
C. antarcticaethanol
59%/35%
20 21
22 23 24
11
12
In performing these Wittig reactions, use of an ylide or phosphonium salt containing an
acid, as opposed to the methyl ester, was preferred in order to bypass the hydrolysis step.
![Page 134: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/134.jpg)
134
However, ylides of methyl esters were the only stable ylides available from commercial sources.
Otherwise, phosphonium bromides containing an acid were vigorously dried under vacuum with
phosphorous pentoxide prior to use.
Acids 13 and 14 were esterified with 1,3-dibutyrylglycerol (1,3-DBG) in the presence of EDCI
and DMAP to yield 15 and 16. Treatment of the ‘ABA’ triglycerides with CAL yielded
diglycerides 17 and 19 along with 2-MAG 18 when the reaction was stopped after 1 h. As
observed in Chapter 3, additional reaction time resulted in full consumption of the diglyceride.
Compound 12 was treated with palladium on carbon and hydrogen. And after hydrolysis,
esterification, and lipase induced-hydrolysis, diglyceride 23 and 2-MAG 24 were isolated.
While the Wittig method is useful for creating shorter biphenyl compounds, synthesizing
analogs with longer carbon chains can be cumbersome, as the hygroscopicity of ylides and
Wittig salts can reduce reaction yields. To continue this method the phosphonium bromide salts
would be synthesized and vigorously dried prior to use.
As an alternative to the Wittig method, a microwave-mediated Sonagashira reaction was
investigated. The terminal alkynes were commercially available and therefor preparation of
reagents is minimal. This method also allows for easy conversion of the alkyne to the cis-alkene
through partial hydrogenation.
The reaction of 4-bromobiphenyl 25 with methyl 5-hexynoate 26,
bis(triphenylphosphine)palladium(II) chloride, copper iodide, and triethylamine using
microwave irradiation gave ester 27 in good yield (Scheme 4.2). When this reaction was
attempted using the acid as opposed to the ester, the yields were markedly reduced. Therefore,
ester 27 was hydrolyzed with lithium hydroxide to give acid 28 which was then coupled to 1,3-
DBG utilizing carbodiimide conditions to yield ‘ABA’ triglyceride 29. C. antarctica was
![Page 135: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/135.jpg)
135
applied in two separate reactions, with the first being stopped after 1 h to yield diglyceride 30 in
79% yield, and a second reaction allowed to go to completion to yield 2-MAG 31 in 78% yield.
Scheme 4.2 Continued synthesis of biphenyl 2-AG analogs
BrO
O
O
OH
O
O
O
O
O
O
O
O
O
O
OH
O
O
OH
OH
O
O
O
O
O
OO
O
O
O
O
O
O
O
O
O
OH
O
O
OH
OH
O
O
O
O
OH
O
O
OH
OH
25 27 28
29
30
31
32 33
34
35
36
37
Pd(PPh3)2Cl2Et3N, CuI, DMF
62%
LiOH, THF
91%
1,3-DBG, DCMEDCI, DMAP
80%
C. antarcticaethanol
78-79%
C. antarcticaethanol
8-65%
Pd/C, H2ether
76%
Ni(OAc)2, NaBH4, NH2(CH2)2NH2
79%
O
O26
Triglyceride 29 was fully saturated to give 32, after which treatment with CAL yielded
the diglyceride and 2-MAG, 34 and 35. To provide the cis-alkene, 29 was treated with P-2 nickel
![Page 136: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/136.jpg)
136
catalyst (created in situ) and hydrogen to yield 33 in 79% yield. This gave 36 and 37 after
reaction with CAL.
For the next analogs the goal was to insert an ether linkage between the core benzene
rings. This substitution would decrease the hydrophobicity of these 2-AG analogs, possibly
increasing the ability to permeate cells. 2-AG and anandamide are brought into cells by
transporters13 due to their high lipophilicity.
Scheme 4.3 Synthesis of biphenyl ether 2-AG analogs
OH
O 1,3-DBG, DCMEDCI, DMAP
72%
O
OO
O
O
O
O
O
O
O
O
O
O
O
Br Pd(PPh3)2Cl2Et3N, CuI, DMF
42%
C. antarcticaethanol
O
O
O
OH
OH
Ni(OAc)2, NaBH4, NH2(CH2)2NH2
63%
O
O
O
O
O
O
OC. antarcticaethanol O
O
OH
OH
O
79%
75%
38 39 40
41 42
43 44
As previous Sonagashira reactions with acid-containing alkynes were poor, 4-pentynoic
acid 38 was esterified with 1,3-DBG to yield 39 (Scheme 4.3). 39 was then subjected to
Sonagashira conditions using microwave irradiation with 4-bromobiphenyl ether 40 to yield
![Page 137: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/137.jpg)
137
triglyceride 41. 41 was partially hydrogenated with P-2 nickel to yield cis-alkene 43. 41 and 43
were treated with CAL to yield 2-MAG 42 and 44 respectively in good yields.
4.2.1 Biphenyl 2-AG Analog Cannabinoid Binding Data
Literature values for the binding affinity of 2-AG to CB1 and CB2 vary over a significant
range. The reported Ki values of 2-AG to CB1 are 100,14 472,15 538,16 and 2400 nM;17 while
values for CB2 are 100,14 1100,18 and 1400 nM.15 Based on these values we were interested in
any compounds that would have binding affinities <1000 nM.
The first two biphenyl analogs synthesized were 18 and 19 (Table 4.1). It was expected
that the fully deprotected 2-MAG, 18, would have the greater binding affinity as it more closely
resembled 2-AG. However, the intermediate product, diglyceride 19, showed binding affinities
towards the CB1 receptor, with and without PMSF, of ~730 nM and ~440 nM respectively,
whereas the glycerol ester had affinities >1000 nM. It was also expected that the FAAH
inhibitor, PMSF, would enhance the binding affinity of any glycerol compounds, as it has been
reported that 2-AG is a substrate for hydrolysis from FAAH.19 With the diglyceride having a
higher affinity towards the CB1 than the glycerol ester, we continued to isolate the intermediate
along with the glycerol product to observe if this trend continued, as the diglycerides may
establish a desired stabilization of the molecule.
Most of the synthesized compounds had CB1 and CB2 binding affinities of >1000 nM.
Besides 18, there were three additional analogs that displayed submicromolar affinities. Fully
saturated biphenyl analog 25 exhibited CB1 Ki values of ~900 and ~780 nM for CB1, with and
without PMSF respectively. Analog 35, with a longer carbon chain between the biphenyl and
ester groups, had the best CB1 binding affinities of ~460 and ~780 nM, and biphenyl ether
analog 42 had CB1 binding affinities of ~700 and >1000 nM. These compounds were
![Page 138: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/138.jpg)
138
reevaluated using 8-pt binding assays, however, complete curves were not obtained, thereby
limiting the reliability of these results.
With 2-AG exhibiting relatively weaker binding affinities to the CB receptors while
being extremely efficacious, solely relying on in vitro binding assays may be misleading. Since
accurate 8-pt binding data was not available, we were curious to observe any in vivo activity of
these ligands before pursuing additional biphenyl type 2-AG analogs. Compounds 18, 19 and 35
were submitted to Dr. Järbe for in vivo studies in mice. Preliminary locomotion analysis studies
were conducted in which mice were dosed with the ligands at 3, 10, and 30 mg/Kg.
Unfortunately, none of these compounds displayed a significant difference in locomotion
compared to vehicle.
Table 4.1 2-point cannabinoid receptor binding assay data Cmpd No. AM Structure rCB1 (nM) CB2 (nM)
untreated w/ PMSF mouse human
17 9076 O
OO
OH
O
~730 ~440 >1000 >1000
18 9077
O
OOH
OH
>1000 >1000 >1000 >1000
19 9080 O
O
OH
O
O
>1000 >1000 >1000 >1000
23 9078 O
O
O
O
OH
>1000 >1000 >1000 >1000
![Page 139: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/139.jpg)
139
24 9075
O
O
OH
OH
~900 ~780 >1000 >1000
30 9087 O
O
O
O
OH
>1000 >1000 >1000 >1000
31 9086 O
O
OH
OH
>1000 >1000 >1000 >1000
34 9089 O
O
O
O
OH
>1000 >1000 >1000 >1000
35 9090 O
O
OH
OH
~460 ~780 >1000 >1000
36 10321
O
O
O
O
OH
>1000 >1000 >1000 >1000
37 10322
O
O
OH
OH
>1000 >1000 >1000 >1000
42 10330
O
O
O
OH
OH
~700 >1000 >1000 >1000
44 10331 O
O
OH
OH
O
>1000 >1000 >1000 >1000
![Page 140: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/140.jpg)
140
4.3 Modification of the Glycerol Head Group
With evidence indicating that biphenyl moieties are not suitable replacements for the
arachidonic tail of 2-AG we shifted our focus to modifications of the glycerol ester in order
reduce the chemical and metabolic instability of this functional group. Other syntheses of 2-AG
analogs indicated that the two hydroxyl groups of the glycerol ester were important for
interactions with the CB receptor. This was indicated by the markedly reduced CB activity when
the hydroxyl groups were replaced with fluorine5 or conformationally constrained in a ring
system.8
We had previously synthesized compounds containing a methyl in the head group to
increase metabolic stability (see Chapter 2), based on its success on other arachidonic analogs.4
Parkkari, et al., reported that α-methylation to the ester showed a slight increase in metabolic
stability, but there was no indication that this would also limit any acyl migration.5 Therefore, we
decided to investigate the addition of methyl groups at the sn-1 and 3 positions to increase
metabolically stablity towards FAAH and MGL, while preventing acyl migration as described in
Chapter 3.
4.3.1 Synthesis of 2,4-dihydroxypentan-3-arachidonoates
Due to the instability of 2-AG, any modifications on the molecule would have to be
completed before the glycerol ester is formed, as reactions performed in the presence of the
glycerol ester may cause acyl migration or hydrolysis. We started with the bromination of acetyl
acetone 45 to give 46, which existed as tautomers, with the keto-enol form favored over the
diketone in the NMR using chloroform-d as the solvent. The keto-enol form is less polar than the
keto form due to intramolecular hydrogen bonding, which is why the keto-enol form is favored
in chloroform. Arachidonic acid was treated with NaH at 0 °C to create sodium arachidonate in
![Page 141: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/141.jpg)
141
situ, which was then treated with 46 and heated to 50 °C. This reaction yielded arachidonic ester
47 in 60% yield (Scheme 4.4). Treatment of diketone 47 with NaBH4 yielded a racemic ±48 as
the major isomer (81%), along with minor isomers 49 (5%) and 50 (14%). The addition of
diethylmethoxyborane to coordinate to the diketones directed a syn-borohydride reduction. This
produced the syn-diols 49 (26%) and 50 (67%) as the major product, with ±48 (7%) as the minor
isomer.
Because the reduction of the diketone using NaBH4 yielded a mix of isomers that still
needed to be separating, other methods were investigated to yield isomers in high enantiomeric
excess. Milder reducing conditions were attempted to yield a β-hydroxy ketone so that the
subsequent reduction of the ketone could be stereochemically controlled. Reactions with
Catecholborane, BH3-THF, and Corey-Bakshi-Shibata catalyst were all attempted, however, no
reduction was observed. These attempted reagents are used to synthesize stereochemically
controlled 1,3-diols from β-hydroxy ketones, and apparently are not suitable for 1,3-diketone
reduction.
Scheme 4.4 Synthesis of to 2,4-dihydroxypentan-3-arachidonoates
O O Br2, H2O, CCl4 O O
Br
OH O
Br
O
OHNaH, DMF0-50 °C
O
OO
O
60%
45 46
46
47
![Page 142: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/142.jpg)
142
O
OOH
OHO
OOH
OHO
OOH
OH
50meso-(2R, 3r, 4S)
49meso-(2R, 3s, 4S)
±48(2R, 4R) & (2S, 4S)
O
OO
O
O
OO
O
NaBH4THF/MeOH-78 °C
Et2BOMeNaBH4THF/MeOH-78 °C
67%26%7%
14%5%81%
~60%
~60%
47
47
4.3.2 Synthesis of 1,3-dihydroxybutan-2-arachidonoates
After synthesizing the dimethyl-glycerols, we were interested in the properties of a
monomethyl-glycerol analog of 2-AG (53, Scheme 4.5). With no methyl-substituted glycerols
available, a keto-oxirane opening was attempted first. Epoxide 52 was synthesized by
epoxidation of α,β-unsaturated ketone 51. Following methodologies for the synthesis of 47,
arachidonic acid was treated with sodium hydride to generate the arachidonic anion in attempt to
open the epoxide ring activated by diethylmethoxyborane to direct the nucleophilic attack.
Unfortunately, no ring opening product was observed. This is most likely due to the conjugate
base of arachidonic acid being a weak nucleophile from the negative charge shared over the two
oxygen molecules.
Scheme 4.5 Attempted keto-oxirane ring opening
O
OH
O
O
OH
ONaH, Et2BOMeTHF, DMFO H2O2, NaHCO3, 3h
O
O
51 52 53
![Page 143: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/143.jpg)
143
Recently, (±)butane-1,2,3-triol (54, Scheme 4.6) became commercially available, which
allowed us to pursue of the chemoenzymatic strategy towards a mono-methyl analog of 2-AG, as
was used in the synthesis of 2-AG. We started with CAL catalyzed 1,3-esterification of 54,
however, the C3 hydroxyl was not esterified by the immobilized lipase. Rather, CAL preferably
esterified the C1 and C2 hydroxyls (56, Scheme 4.6). Alternatively, 3-esterification may have
occurred followed by rapid transesterification. Therefore, chemoenzymatic methods were not
suitable for the generation of 55 based on unsuccessful experiements.
Scheme 4.6 Chemoenzymatic esterification of ±butane-1,2,3-triol
C. antarcticaCH2Cl2OHHO
OH
OOOH
O O
OHOO
O
O
213
213
54
55
56
With the ‘ABA’ triglyceride strategy not readily accessible through this method, the next
attempt was to synthesize an ‘AAA’ (symmetrical) triglyceride and proceed through lipase
catalyzed hydrolysis. An excess of arachidonic acid was coupled to 54 with EDCI and DMAP to
produce ‘AAA’ triglyceride 57 in 96% yield. With the issue of esterifying 54 with C. antarctic,
hydrolysis was expected to be slower than during 2-AG synthesis. Treatment of 57 with CAL
resulted in 30% conversion after 2 h. Due to the slow rate, a second portion of lipase was added
and the reaction continued until a halt in progress was observed. Reaction was complete after 4
h, and 53 was isolated in 73% yield (Scheme 4.7).
![Page 144: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/144.jpg)
144
Scheme 4.7 Successful synthetic strategy towards a monomethyl 2-AG analog
O
OH 54
EDCI, DMAPCH2Cl2
O
O
O
O
O
C19H31
O
C19H31
57
O
O
OH
OH
53
C. antarcticaethanol, 4 h
96%
73%
4.4 Purification and Isolation of 2,4-dihydroxypentan-3-arachidonoate Isomers
With asymmetric synthesis of the 1,3-diols unsuccessful, we then concentrated on the
separation and identification of each individual isomer. From TLC analysis, it appeared that a
chromatographic separation would be possible, but the solvent system would have to be
optimized as it was unclear how many products were formed from each reaction. The NMR
spectrum of the mixture of products indicated that there were three isomers, which was most
apparent from the α-CH2 protons (labeled Z, Figure 4.2). Analysis of protons X and Y indicate
that there were probably two major products and one minor one.
![Page 145: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/145.jpg)
145
Figure 4.2.esp
4.80 4.75 4.70 4.65 4.60Chemical Shift (ppm)
0
0.005
0.010
0.015
0.020
0.025
0.030
0.035
0.040
0.045N
orm
aliz
ed In
tens
ity
Y
Y
O
OOH
OHX
X
YZ
Figure 4.2.esp
4.35 4.30 4.25 4.20 4.15 4.10 4.05 4.00Chemical Shift (ppm)
0
0.005
0.010
0.015
0.020
0.025
0.030
0.035
Nor
mal
ized
Inte
nsity
X
X
O
OOH
OHX
X
YZ
Figure 4.2 1H NMR of 1,3-diol products after NaBH4 reduction of 1,3-diketone
![Page 146: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/146.jpg)
146
Figure 4.2.esp
2.65 2.60 2.55 2.50 2.45 2.40 2.35 2.30Chemical Shift (ppm)
0
0.01
0.02
0.03
0.04
0.05
0.06
0.07
0.08
0.09
Nor
mal
ized
Inte
nsity
Z
Z
Z
O
OOH
OHX
X
YZ
Figure 4.2 1H NMR of 1,3-diol products after NaBH4 reduction of 1,3-diketone
The first attempt at separating the three isomers was performed on an extended column
with a solvent gradient from 0 to 35% ethyl acetate in hexanes. This successfully gave pure
fractions for each isomer, however, most of the material remained impure due to separation
overlaps. This would require additional chromatographic purifications.
To obtain a better separation of the three products, the solvent system needed to be
optimized. From the first solvent system (35% ethyl acetate / hexanes) we moved to a less polar
solvent with hexanes, but at a higher percentage. This led to the trial of using 90% ether /
hexanes and 100% ether. While the products had higher Rf values, the separation was worse
(Figure 4.3). The next solvent attempted was 100% CH2Cl2, which is much more polar than
ether and was expected to increase the Rf of the very polar glycerol products. However,
unexpectedly the products did not move from the baseline. This was thought to occur from an
absence of hydrogen bonding interactions between the glycerol moiety and the CH2Cl2. CH2Cl2
![Page 147: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/147.jpg)
147
was then used in place of hexanes as the base solvent while mixed with 50% ether or 50% ethyl
acetate. This led to better separation of the three products as compared to using hexanes as the
base solvent. The final attempt to optimize separation utilized 10% acetone / CH2Cl2. This
solvent system produced the best separation as the isomers did not overlap, and were most
efficient in obtaining the greatest isolated yields of each pure isomer.
10% acetone in CH2Cl2
50% ethyl acetate in CH2Cl2
50% ether in CH2Cl2
10% hexanes in ether
100% ether 100% CH2Cl2
Figure 4.3 Product separation from TLC analysis of tested solvent systems
4.5 Identification of pent-2,4-ol-3-arachidonoate Stereochemistry
Reduction of 2-4 diketones can result in either syn- or anti-2-4 diols (Figure 4.4). Syn-
diols result in a pseudo-asymmetric carbon at the C3 position. This C3 has a relative chirality
resulting in two meso compounds: an all syn-meso (2R, 3r, 4S) and an 2,3-anti meso (2R, 3s, 4S)
compound. When the 2-4 diols are anti the C3 is no longer pseudo-asymmetric resulting in a
pair of enantiomers (Figure 4.4). Thus the three products observed through TLC and from the
mixed NMR are the racemate ±48, meso-(2R, 3r, 4S) 49, and meso-(2R, 3s, 4S) 50.
![Page 148: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/148.jpg)
148
ROOH
OH
ROOH
OH
ROOH
OH
ROOH
OH
ROOH
OH
ROOH
OH
meso-(2R, 3r, 4S) meso-(2R, 3s, 4S)(2R, 4R) (2S, 4S)
1
32
45
Figure 4.4 Expected products from NaBH4 reduction of a 2-4 diketone
After identification of all possible products as a result of reduction, and the ability to
isolate each product, difficulty lies in distinguishing the different stereoisomers. The first
fraction, with an Rf of 0.42 (10% acetone / CH2Cl2), was the easiest to distinguish because of an
obvious doublet of doublets (dd) at 4.67 ppm (Figure 4.5). The dd splitting indicates the
adjacent protons at the C2 and C4 positions are not equivalent. We know that in (±)48 the C3
proton will have a syn-hydrogen and anti-hydrogen in both enantiomers. The coupling to each of
these should be different, which is why a dd is observed. The mutliplets at 4.23 and 4.08 ppm
also indicate the difference between the relationships of the C2-C3 protons compared to the the
C3-C4 protons.
For the two meso compounds one would expect to observe a triplet for the C3 proton as it
would have an equivalent stereochemical relationship to the C2 and C4 protons. This would
result in a triplet as opposed to the dd observed for the racemic product (±48). As seen in Figure
4.5, both 49 and 50 display clean triplets at 4.68 and 4.73 ppm respectively.
![Page 149: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/149.jpg)
149
+-48.esp
4.65 4.60 4.55 4.50 4.45 4.40 4.35 4.30 4.25 4.20 4.15 4.10 4.05Chemical Shift (ppm)
0
0.05
0.10
Nor
mal
ized
Inte
nsity
0.760.750.73
M02(dd) M03(quind) M04(m)
4.67
4.67
4.66
4.66
4.25
4.25
4.24
4.24
4.23
4.22
4.22
4.21
4.20
4.20
4.11
4.10
4.09
4.07
4.06
4.05
O
OOH
OH
±48
49.esp
4.70 4.65 4.60 4.55 4.50 4.45 4.40 4.35 4.30 4.25 4.20 4.15 4.10 4.05 4.00 3.95Chemical Shift (ppm)
0
0.05
0.10
0.15
Nor
mal
ized
Inte
nsity
1.950.92
J(M01)=6.41 Hz
J(M01)=6.41 Hz
M01(t)
M03(m)
4.02
4.03
4.03
4.04
4.67
4.68
4.70
O
OOH
OH
49
Figure 4.5 Expansion of splitting patterns of C2, C3, and C4 protons
![Page 150: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/150.jpg)
150
50.esp
4.80 4.75 4.70 4.65 4.60 4.55 4.50 4.45 4.40 4.35 4.30 4.25 4.20 4.15 4.10 4.05Chemical Shift (ppm)
0
0.025
0.050
0.075
Nor
mal
ized
Inte
nsity
2.000.95
J(M01)=3.05 Hz
J(M01)=3.05 Hz
M01(t)
M02(td)
4.11
4.12
4.12
4.13
4.14
4.14
4.72
4.73
4.74
O
OOH
OH
50
Figure 4.5 Cont’d Expansion of splitting patterns of C2, C3, and C4 protons
To correctly assign 49 and 50 to the proper meso compounds, one must closely examine
the coupling constants. One triplet has a J2-3 and J3-4 of 6.41 Hz, and the other 3.05 Hz. If we
visualize the Newman projections of 49 and 50, the simplest forms, based on their
stereochemistry, show the dihedral angle of HA-HB to be 180° for the meso-(2R, 3s, 4S) and 60°
for the meso-(2R, 3r, 4S). Based on studies of Karplus20 and Stiles, et al.,21 one would associate
a dihedral angle of 60° with a smaller coupling constant than one from a dihedral angle of 180°
(Figure 4.6). Based on these observations it is speculated that the second eluting product (Rf =
0.35, 10% acetone / CH2Cl2), with a JAB of 6.10 Hz, is associated with meso-(2R, 3s, 4S) 49.
The last eluting product (Rf = 0.25, 10% acetone / CH2Cl2), with a JAB of 3.05 Hz, is speculated
to be meso-(2R, 3r, 4S) 50.
![Page 151: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/151.jpg)
151
HBR
HHOHAHO
RHB
HHOHAHO
22 334 4
OHHA
C4
HB R
OHHA
C4
R HB
O
OOH
OH2
4
3O
OOH
OH2
4
3
60°
180°3.05 Hz6.41 Hz
49 50
C2-C3 C2-C3
meso-(2R, 3s, 4S) meso-(2R, 3r, 4S)
Figure 4.6 Newman projects of the two meso compounds: 49 & 50
4.6 Chemically and Metabolically Stable 2-AG Analog Data
4.6.1 Chemical Stability of 2-AG Analogs
As described previously, the tendency of 2-AG to undergo facile acyl migration can be a
hindrance when preparing large quantities, or storing over long periods of time. However, it has
been observed (through NMR) that the initial ratio of 2-AG to 1-AG has a large effect on the rate
at which acyl migration occurs. Very pure samples are better suited for long term storage, while
impure samples initiate acyl migration at higher rates. A sample of 2-AG (>98%), sent for use in
pharmacological studies, was stored in ethanol at -80 °C while being warmed to room
temperature and re-cooled numerous times. After six weeks this same sample was analyzed by
NMR and the sample was 92% 2-AG compared to the 98% after synthesis. However, this
observation only indicates that purer samples of 2-AG are fairly stable in storage, and provided
![Page 152: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/152.jpg)
152
no indication of the tendency for acyl migration when 2-AG is subjected to in vitro assays or
when administered in vivo.
While the ratio of 2-AG to 1-AG can vary slightly for each synthesis, crude NMR of
NaBH4 reductions of 47 to ±48, 49, and 50 indicated no formation of a 1-AG variant after
reaction (2 h). However, 1-AG analogs (±48, 49, and 50) were isolated when the reaction was
allowed to occur overnight and also when the reaction was neutralized with citric acid as
opposed to hydrochloric acid. Even if a minimal amount of the 1-AG variant of these analogs
was observed, column chromatography was able to separate them, as the 1-AG dimethyl analog
could be separated from the desired compound; whereas, natural 1-AG and 2-AG are not
separable by column chromatography.
4.6.2 Metabolic Stability of 2-AG Analogs Compared to 2-AG
To compare the metabolic stability of our synthesized 2-AG analogs to that of 2-AG, we
performed a hMGL substrate assay. This assay exposed 2-AG, (±)48, 49, 50, and 53 to hMGL
and measured the concentration of the initial ligand and arachidonic acid produced from
metabolic hydrolysis after 30 minutes (Table 4.2).
The important data was the accumulation of AA after 30 minutes of incubation with
hMGL. 2-AG was almost fully metabolized by the 30 min with 86% AA accumulation. The
graph shows that the majority of 2-AG is hydrolyzed by hMGL within 3-5 minutes. Analog
(±)48 appeared to be the most metabolically stable compound as there was no measurable AA
measured after 30 m. The 2,3-anti analog 49 exhibited 18% AA accumulation, and the 2,3-cis
analog 50 was almost 3x more stable with only 6.6% AA accumulated. Mono-methyl analog 53
was, as expected, not as stable as the dimethyl analogs, but still more metabolically stable than 2-
AG. An interesting observation after 30 m was the reduction in the amount of original substrate
![Page 153: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/153.jpg)
153
remaining while a non-proportional amount of AA accumulated. It is postulated that the
formation of an enzyme-substrate complex occurred where the ligand entered the binding
domain of hMGL but was not hydrolyzed, evident by the lack of AA formation, and may behave
as an inhibitor.
Table 4.2 hMGL substrate assay results
Compound AM After 30 minutes
% Substrate remaining
% AA accumulated
2-AG 2-AG 6.0 86 ±48 10336 52 0.0 49 10335 51 18 50 10334 65 6.6 53 10342 15 22
0
50
100
150
200
0 5 10 15 20 25 30 35
Conc
entr
atio
n (u
M)
Time (minutes)
2-AG Stability with hMGL
[2-AG] (uM)
[AA] (uM)
-50
0
50
100
150
200
250
0 5 10 15 20 25 30 35
Conc
entr
atio
n (u
M)
Time (minutes)
±48 (AM-10336) Stability with hMGL
[AM-10336] (uM)
[AA] (uM)
![Page 154: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/154.jpg)
154
4.6.3 Cannabinoid In Vitro Binding Assay Data
For in vitro binding data we were able to measure the inhibition of cAMP release for
(±)48, 49, and 50. The data are summarized in Table 4.3. Compounds (±)48, 49, and 50 all
-50
0
50
100
150
200
250
0 5 10 15 20 25 30 35
Conc
entr
atio
n (u
M)
Time (minutes)
49 (AM-10335) Stability with hMGL
[AM-10335] (uM)
[AA] (uM)
-50
0
50
100
150
200
250
0 5 10 15 20 25 30 35
Conc
entr
atio
n (u
M)
Time (minutes)
50 (AM-10334) Stability with hMGL
[AM-10334] (uM)
[AA] (uM)
0
50
100
150
200
250
0 5 10 15 20 25 30 35
Conc
entr
atio
n (u
M)
Time (minutes)
53 (AM-10342) Stability with hMGL
[AM-10342] (uM)
[AA] (uM)
![Page 155: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/155.jpg)
155
behaved as agonists in the cAMP assay with 67%, 49%, and 58% decrease in stimulation,
respectively.
Table 4.3 Cyclic AMP assay for 2-AG dimethyl analogs
Compound AM rCB1 IC50 (μM) 2-AG 0.010 (±)48 10336 1.3
49 10335 1.3 50 10334 2.6
4.6.4 Pharmacological Data of 2-AG, 1-AG, AA, and 2-AG Analogs In Vivo
Compounds (±)48 and 50 were submitted for a pharmacological comparison to 2-AG.
Locomotor and rearing activity were examined in mice, dosed with 2-AG, 1-AG, arachidonic
acid, (±)48, and 50. The locomotion test uses open-field observation of movement in mice after
being dosed, while rearing is the tendency for the mice to stand on its hind legs after
administration.
The dose-dependent response curves for locomotion (Figure 4.7) and rearing (Figure 4.8)
of 2-AG compared to (±)48 and 50, exhibit significantly different profiles. Dosing of 2-AG
showed an immediate attenuation of locomotion (and rearing) in mice after 15 minutes,however,
this effect dissipated after 30 minutes. When observing (±)48 and 50 in the same experiment, the
subjects experienced a delayed onset of action from these analogs that was not observed with 2-
AG. The 30 mg/kg dose of (±)48 had a similar effect at 30 minutes as the 10 mg/kg dose of 2-
AG produced at 15 minutes (first reading).
To establish whether these observed effects are CB1 mediated, compounds were
administered along with the CB1 inverse agonist SR141716 (SR, Rimonabant). If an attenuation
of action was observed then it would indicate the response was an effect of CB1 activation.
Administering 2-AG with SR showed no change in the pharmacological profile (data not shown).
![Page 156: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/156.jpg)
156
On the other hand, treatment of 10 mg/kg of SR with 30 mg/kg of (±)48 attenuated the response
to that of the 10 mg/kg dose of (±)48. This implied that the effects of (±)48 were a result of
ligand interactions with the CB1 receptor.
Figure 4.7 Locomotor activity following administration of 2-AG analogs (All data is obtained from one single experiment).
0
200
400
600
800
1000
1200
1400
1600
1800
2000
15 30 45 60
Measured Bin Time (min)
Locomotion in 2-AG Dosed Mice
Vehicle
1mg/kg 2-AG
3mg/kg 2-AG
10mg/kg 2-AG
0.00
200.00
400.00
600.00
800.00
1000.00
1200.00
1400.00
1600.00
1800.00
2000.00
15 30 45 60
Measured Bin Time (min)
Locomotion with 2-AG Analogs
Vehicle
10mg/kg ±48
30mg/kg ±48
30mg/kg ±48+10mg/kgSR
10mg/kg 50
![Page 157: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/157.jpg)
157
Figure 4.8 Rearing activity following administration of 2-AG analogs (All data is obtained from one single experiment).
The CB1 inverse agonist, SR, did not attenuate the pharmacological effects of 2-AG.
This implied that the observed pharmacological profile may not be strictly from 2-AG, if at all.
We know that 2-AG did not go through acyl migration prior to injection; yet it is unknown
0
20
40
60
80
100
120
15 30 45 60
Measured Bin Time (min)
Rearing in 2-AG Dosed Mice
Vehicle
1mg/kg 2-AG
3mg/kg 2-AG
10mg/kg 2-AG
0
20
40
60
80
100
120
15 30 45 60
Measured Bin Time (min)
Rearing with 2-AG Analogs
Vehicle
10mg/kg ±48
30mg/kg ±48
30mg/kg ±48+10mg/kgSR
10mg/kg 50
![Page 158: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/158.jpg)
158
whether this migration can occur in vivo. To resolve this issue, mice were given a dosage of 1-
AG (3 mg/kg) and the results were compared to those for 2-AG. Figure 4.9 illustrates that the
profiles of 1-AG and 2-AG at 3 mg/kg very similar in regards to locomotion and rearing. With
1-AG and 2-AG exhibiting similar pharmacological profiles, this suggests that a metabolite of
these compounds may be causing these effects and acting somewhere other than the CB
receptors as SR is unable to attenuate any of these effects.
It was thought that 1-AG and 2-AG were immediately hydrolyzed by MGL post
administration. If this were the case, glycerol and arachidonic acid would be present as
byproducts of hydrolysis. Therefore, mice were administered arachidonic acid and the profile
was compared to 1-AG and 2-AG. The effects of arachidonic acid resembled those of 1-AG and
2-AG, leaving one unable to draw any conclusions regarding the biological effects observed.
The next experiments will have to include MGL inhibitors as well as the administration of 2-AG
to possible understand any pharmacological data pertaining to effects caused by 2-AG.
0
200
400
600
800
1000
1200
1400
1600
1800
2000
15 30 45 60
Measured Bin Time (min)
Locomotion in 2-AG Dosed Mice
Vehicle
1mg/kg 2-AG
3mg/kg 2-AG
10mg/kg 2-AG
3mg/kg 1-AG
10mg_kg_ArachidonicA
3mg_kgArachidonicA
![Page 159: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/159.jpg)
159
Figure 4.9 Locomotor and rearing activity following administration of 2-AG, 1-AG, and arachidonic acid (All data is obtained from a single experiment).
4.7 Conclusion
The study of the true pharmacological properties of 2-AG can be difficult. Administration
of 1-AG, 2-AG, and AA showed similar profiles when administered in vivo, suggesting that the
observed results were not an accurate representation of the pharacodynamics of 2-AG. It is
believed this occurs due to the rapid metabolism from MGL. Therefore, we developed a strategy
to synthesize chemically and metabolically stable 2-AG analogs that would exhibit a longer
duration of action in order to observe a true pharmacological profile.
Our first attempt at synthesizing ligands where the hydrophobic unsaturated arachidonic
tail was replaced with various biphenyl moieties, improved chemical stability but did not render
the ligand resistant to hydrolysis. Through in vitro and in vivo experiments it was determined
these compounds did not display activity and efficacy similar to that of 2-AG. A second strategy
was to modify the glycerol head group and leave the unsaturated arachidonic tail intact. This
was successful in providing chemical and metabolic stability, where no acyl migration was
observed and hydrolysis was drastically reduced (even eliminated in the case of (±)48).
0
20
40
60
80
100
120
140
15 30 45 60
Measured Bin Time (min)
Rearing in 2-AG Dosed Mice Vehicle
1mg/kg 2-AG
3mg/kg 2-AG
10mg/kg 2-AG
3mg/kg 1-AG
10mg_kg_ArachidonicA
3mg_kgArachidonicA
![Page 160: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/160.jpg)
160
In pharmacological studies, it was observed that the 2-AG analogs exhibited a different
profile when observing locomotion. The stable analogs did not have an immediate onset of
action and the effects appeared to last longer than that observed with 2-AG. The effects of the
analogs were also noted to be CB mediated, as an antagonist was able to attenuate the observed
effects. This makes ±48 a promising candidate as a 2-AG replacement and tool to understand the
endogenous effects of the lipid signaling compound.
In summary, the addition of chiral groups into the glycerol ester head-group of 2-AG is a
viable strategy to overcome the chemical and metabolic instabilities observed in 2-AG. It also
appears that the structural moieties that stray from the arachidonic acid tail are not well tolerated
in the CB receptors. While (±)48 appeared to be a chemically and metabolically stable analog of
2-AG, its effects compared the endogenous analog are not fully understood as pharmacological
profiles of 2-AG are not fully understood.
![Page 161: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/161.jpg)
161
4.8 Experimental
O
O
(E)-methyl 3-(biphenyl-4-yl)acrylate, 12. Methyl(triphenylphosphoranylidene)acetate (2.81 g,
8.39 mmol) was added to a solution of biphenyl-4-carbaldehyde (1.52 g, 8.39 mmol) in 20 mL of
anhydrous CH2Cl2 at 0 °C. The reaction was allowed to warm to room temperature and stir
overnight. The solvent was evaporated off under reduced pressure and the residue was
chromatographed on silica gel to yield 12 (1.012 g, 51%) as a white solid. Rf = 0.52 (20% ethyl
acetate / hexanes).
O
OH
(E)-3-(biphenyl-4-yl)acrylic acid, 13. A 1.0M solution of LiOH (0.88 mL, 0.88 mmol) was
added to a solution of (Z)-methyl 3-(biphenyl-4-yl)acrylate (105 mg, 0.44 mmol) in 4mL of
THF. The reaction was allowed to stir under argon for 48 hours. Upon completion, a 1.0M
solution of HCl was added until the reaction mixture was slightly acidic. The product was
extracted with Et2O washed with water, brine, and dried over MgSO4. The organic layer was
concentrated to yield 13 (78 mg, 78%) as a white solid. 1H NMR (500 MHz, CHLOROFORM-
d) δ ppm 7.73 (d, J=7.81 Hz, 2 H) 7.58 - 7.64 (m, 4 H) 7.45 (t, J=7.57 Hz, 2 H) 7.37 (s, 1 H)
7.10 (d, J=12.70 Hz, 1 H) 6.01 (d, J=12.70 Hz, 1 H).
![Page 162: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/162.jpg)
162
O
OH
(E)-4-(biphenyl-4-yl)but-3-enoic acid, 14. A 1.0M solution of potassium tert-butoxide in THF
(1.1 mL, 1.1 mmol) was added to a suspension of (2-carboxyethyl) triphenylphosphonium
bromide (342 mg, 0.83 mmol) in 5 mL of anhydrous THF at -78°C. After 10 minutes biphenyl-4-
carbaldehyde (100 mg, 0.55 mmol) was added portion wise. The reaction was allowed to warm
slowly to room temperature. The reaction was quenched with 1.0M HCl (1.0 mL) and diluted
with ether. The organic layer was separated, dried over MgSO4, and concentrated. The residue
was chromatographed on silica gel to yield 14 (60 mg, 46%) as a white solid. Rf = 0.25 (70%
ethyl acetate / hexane). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 7.54 - 7.62 (m, 4 H)
7.41 - 7.48 (m, 4 H) 7.31 - 7.37 (m, 1 H) 6.57 (d, J=16.11 Hz, 1 H) 6.30 - 6.39 (m, 1 H) 3.34 (d,
J=6.84 Hz, 2 H).
O
OO
O
O
O
(E)-2-(3-(biphenyl-4-yl)acryloyloxy)propane-1,3-diyl dibutyrate, 15. EDCI (220 mg, 1.15
mmol), DMAP (6 mg, 0.046 mmol) and 1,3-dibutyrate glycerol (106 mg, 0.46mmol) were added
to a solution of 13 (52 mg, 0.23 mmol) in 5mL of anhydrous THF/DCM (1:1). The reaction was
allowed to stir under argon for 4 hours. Upon completion the reaction was diluted with CH2Cl2
and water. The organic layer was concentrated and the residue was chromatographed on silica
gel to yield 15 (85 mg, 84%) as a white solid. Rf = 0.22 (20% ethyl acetate/hexane). 1H NMR
(500 MHz, CHLOROFORM-d) δ ppm 7.76 (d, J=15.63 Hz, 1 H) 7.54 - 7.68 (m, 6 H) 7.46 (t,
![Page 163: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/163.jpg)
163
J=7.57 Hz, 2 H) 7.36 - 7.40 (m, 1 H) 6.49 (d, J=16.11 Hz, 1 H) 4.25 - 4.38 (m, 4 H) 2.30 (t, J =
7.32 Hz, 4H), 1.65 (sxt, J = 7.30 Hz, 4H), 0.95 (t, J = 7.57 Hz, 6H).
O
O
O
O
O
O
(E)-2-(4-(biphenyl-4-yl)but-3-enoyloxy)propane-1,3-diyl dibutyrate, 16. The procedure for
15 was followed to synthesize 16 (93 mg, 83%) as an oil. Rf = 0.64 (35% ethyl acetate /
hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ 7.54 - 7.62 (m, 4H), 7.41 - 7.47 (m, 4H),
7.34 (s, 1H), 6.54 (d, J = 15.63 Hz, 1H), 6.32 (td, J = 7.3, 15.6 Hz, 1H), 5.25 - 5.35 (m, 1H), 4.32
(ddd, J = 3.9, 7.8, 18.0 Hz, 2H), 4.18 (ddd, J = 5.8, 12.2, 19.0 Hz, 4H), 3.29 (dd, J = 1.2, 7.1 Hz,
2H), 2.26 - 2.34 (m, 4H), 1.60 - 1.70 (m, 4H), 0.90 - 0.98 (m, 6H)
O
OO
OH
O
(E)-2-(3-(biphenyl-4-yl)acryloyloxy)-3-hydroxypropyl butyrate, 17, AM9076. Candida
antarctica (150 mg) was added to a solution of 15 (150 mg, 0.39 mml) stirred at room
temperature in anhydrous ethanol (1 mL). The reaction was stirred for 75 minutes. After
consumption of starting material the reaction was halted and was filtered and diluted with
CH2Cl2. The organic layer was removed under reduced pressure and the residue was
chromatographed silica gel to yield 17 (10 mg, 18%) as a white solid. Rf = 0.48 (40% ethyl
acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ 7.76 (d, J = 16.11 Hz, 1H), 7.54 -
7.69 (m, 6H), 7.40 - 7.48 (m, 2H), 7.34 - 7.40 (m, 1H), 6.50 (d, J = 16.11 Hz, 1H), 5.24 (quin, J
= 5.01 Hz, 1H), 4.36 - 4.41 (m, 2H), 3.81 - 3.85 (m, 2H), 2.34 (t, J = 7.32 Hz, 2H), 1.61 - 1.70
![Page 164: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/164.jpg)
164
(m, 2H), 0.93 - 0.98 (m, 3H). 13C NMR (126 MHz, CHLOROFORM-d) δ 174.0, 166.8, 145.7,
140.3, 129.2 (2C), 129.0 (5C), 128.2, 127.8 (2C), 127.3 (2C), 72.8, 62.4, 61.9, 36.2 (3C).
O
OOH
OH
(E)-1,3-dihydroxypropan-2-yl 3-(biphenyl-4-yl)acrylate, 18, AM9077. The reaction
producing 17 also produced 18 (34 mg, 49%) as a white solid. Rf = 0.36 (40% ethyl acetate /
hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ 7.78 (d, J = 16.1 Hz, 1H), 7.54 - 7.67 (m,
6H), 7.42 - 7.51 (m, 2H), 7.34 - 7.41 (m, 1H), 6.54 (d, J = 15.6 Hz, 1H), 5.08 (quin, J = 4.7 Hz,
1H), 3.94 (t, J = 5.1 Hz, 4H), 2.26 (t, J = 5.9 Hz, 2H). 13C NMR (126 MHz, CHLOROFORM-d)
δ 167.4, 145.8, 143.6, 129.2 (2C), 129.0 (5C), 128.2, 127.8 (2C), 127.3 (2C), 80.2, 62.9 (2C).
O
O
O
O
OH
(E)-1-(butyryloxy)-3-hydroxypropan-2-yl 4-(biphenyl-4-yl)but-3-enoate, 19, AM9080. The
procedure for 17 was used synthesize 19 (23 mg, 35%) as a colorless oil. Rf = 0.65 (50% ethyl
acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ 7.52 - 7.62 (m, 4H), 7.40 - 7.47
(m, 4H), 7.31 - 7.37 (m, 1H), 6.55 (d, J = 15.6 Hz, 1H), 6.33 (td, J = 6.4, 16.1 Hz, 1H), 5.14
(quin, J = 5.0 Hz, 1H), 4.34 - 4.39 (m, 1H), 4.22 - 4.31 (m, 1H), 3.75 - 3.78 (m, 2H), 3.32 (dd, J
= 1.2, 7.1 Hz, 2H), 2.30 (t, J = 7.6 Hz, 2H), 2.02 - 2.20 (m, 1H), 1.60 - 1.69 (m, 2H), 0.92 (t, J =
7.6 Hz, 3H). 13C NMR (100 MHz, CHLOROFORM-d) δ 173.8, 171.4, 140.7, 135.9, 129.0 (2C),
127.6 (5C), 127.5, 127.2 (2C), 127.0 (2C), 72.9, 62.9, 62.1, 61.7, 38.6, 18.6, 13.9.
![Page 165: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/165.jpg)
165
O
O
methyl 3-(biphenyl-4-yl)propanoate, 20. 10% Pd/C (50 mg) was added to a solution of 12 (800
mg, 3.35 mmol) in 20 mL of ethyl acetate and was evacuated and purged with H2 (3x). Upon
completion the reaction mixture was filtered and the solvent was removed under reduced
pressure to yield methyl 20 (663 mg, 82%) as a white crystalline. Rf = 0.73 (40% ethyl acetate /
hexane). 1H NMR (500 MHz, CHLOROFORM-d) d ppm 7.50 - 7.60 (m, 4 H) 7.43 (t, J=7.81
Hz, 2 H) 7.31 - 7.36 (m, 1 H) 7.28 (d, J=7.81 Hz, 2 H) 3.69 (s, 3 H) 3.00 (t, J=7.81 Hz, 2 H) 2.68
(t, J=7.81 Hz, 2 H).
O
OH
3-(biphenyl-4-yl)propanoic acid, 21. The procedure for 13 was followed to synthesize 21 (353
mg, 63%) as a white solid. Rf = 0.30 (50% ethyl acetate / hexane). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 7.55 (dd, J=21.97, 7.81 Hz, 4 H) 7.43 (t, J=7.57 Hz, 2 H) 7.33 (t,
J=7.81 Hz, 1 H) 7.29 (d, J=8.30 Hz, 2 H) 3.01 (t, J=7.81 Hz, 2 H) 2.74 (t, J=7.81 Hz, 2 H).
O
O
O
O
O
O
2-(3-(biphenyl-4-yl)propanoyloxy)propane-1,3-diyl dibutyrate, 22. The procedure for 15 was
followed to synthesize 22 (416 mg, 61%) as an oil. Rf = 0.67 (35% ethyl acetate / hexane). 1H
![Page 166: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/166.jpg)
166
NMR (500 MHz, CHLOROFORM-d) δ ppm 7.50 - 7.59 (m, 4 H) 7.43 (t, J=7.57 Hz, 2 H) 7.30 -
7.36 (m, 1 H) 7.26 - 7.29 (m, 2 H) 5.23 - 5.33 (m, 1 H) 4.25 - 4.34 (m, 2 H) 4.09 - 4.20 (m, 2 H)
2.99 (td, J=7.81, 3.42 Hz, 2 H) 2.66 - 2.73 (m, 2 H) 2.25 - 2.31 (m, 4 H) 1.58 - 1.68 (m, 4 H)
0.93 (td, J=7.45, 4.64 Hz, 6 H).
O
O
O
O
OH
2-(3-(biphenyl-4-yl)propanoyloxy)-3-hydroxypropyl butyrate, 23, AM9078. The procedure
for 17 was followed to synthesize 23 (165 mg, 59%) as a white solid. Rf = 0.46 (40% acetone /
hexane). 1H NMR (500 MHz, CHLOROFORM-d) δ 7.49 - 7.59 (m, 4H), 7.41 (t, J = 7.6 Hz,
2H), 7.29 - 7.34 (m, 1H), 7.22 - 7.28 (m, 2H), 5.08 (quin, J = 5.13 Hz, 1H), 4.34 (dd, J = 4.4,
11.7 Hz, 1H), 4.23 (dd, J = 5.9, 11.7 Hz, 1H), 3.63 - 3.70 (m, 2H), 2.98 (t, J = 7.6 Hz, 2H), 2.65 -
2.71 (m, 2H), 2.46 (t, J = 5.6 Hz, 1H), 2.30 (t, J = 7.6 Hz, 2H), 1.60 - 1.68 (m, 2H), 0.93 (t, J =
7.1 Hz, 3H). 13C NMR (100 MHz, CHLOROFORM-d) δ 173.6, 173.1, 141.1, 139.6, 129.0,
129.0, 127.5, 127.4, 127.2, 72.2, 62.7, 61.5, 36.4, 35.8, 30.7, 18.7, 13.8.
O
O
OH
OH
1,3-dihydroxypropan-2-yl 3-(biphenyl-4-yl)propanoate, 24, AM9075. The reaction producing
23 also resulted in 24 (100 mg, 35%) as a colorless oil. Rf = 0.14 (40% acetone / hexane). 1H
NMR (399 MHz, CHLOROFORM-d) δ 7.53 - 7.58 (m, 2H), 7.47 - 7.53 (m, 2H), 7.37 - 7.45 (m,
2H), 7.29 - 7.35 (m, 1H), 7.23 - 7.28 (m, 2H), 4.89 (quin, J = 4.95 Hz, 1H), 3.73 (d, J = 4.40 Hz,
![Page 167: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/167.jpg)
167
4H), 2.99 (t, J = 7.33 Hz, 2H), 2.77 (br. s., 1H), 2.72 (t, J = 8.06 Hz, 2H). 13C NMR (100 MHz,
CHLOROFORM-d) δ 173.4, 141.0, 139.6, 139.5, 129.0, 129.0, 127.5, 127.5, 127.2, 75.3, 62.2,
36.0, 30.8.
O
O
methyl 6-(biphenyl-4-yl)hex-5-ynoate, 27. Pd(PPh3)2Cl2 (147 mg, 0.21 mmol), copper iodide
(40 mg, 0.21 mmol) and triethylamine (1.2 mL, 8.6 mmol) were added to a solution of 4-
bromobiphenyl (1.0 g, 4.3 mmol) and methyl 5-hexynoate (561 μL, 4.3 mmol) in 7 mL of
anhydrous DMF under an atmosphere of argon at 65 °C. The reaction was allowed to stir for
18hrs, diluted with Et2O and quenched with water. The organic layer was separated, dried over
NaSO4 and concentrated. The resulting residue was chromatographed on silica gel to yield 27
(742 mg, 62%) as an oil. Rf = 0.70 (35% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 7.58 (dd, J=7.3, 1.0 Hz, 2 H) 7.50 - 7.54 (m, 2 H) 7.41 - 7.48 (m, 4
H) 7.31 - 7.38 (m, 1 H) 3.66 - 3.71 (m, 3 H) 2.46 - 2.58 (m, 4 H) 1.95 (quin, J=7.2 Hz, 2 H) -0.04
- 0.02 (m, 1 H).
O
OH
6-(biphenyl-4-yl)hex-5-ynoic acid, 28. The procedure for 13 was followed to synthesize 28 (641
mg, 91%) as a white solid. Rf = 0.25 (25% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 7.55 - 7.60 (m, 2 H) 7.49 - 7.54 (m, 2 H) 7.40 - 7.48 (m, 4 H) 7.31 -
7.38 (m, 1 H) 2.58 (t, J=7.3 Hz, 2 H) 2.54 (t, J=7.1 Hz, 2 H) 1.96 (quin, J=7.1 Hz, 2 H).
![Page 168: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/168.jpg)
168
O
O
O
O
O
O
2-(6-(biphenyl-4-yl)hex-5-ynoyloxy)propane-1,3-diyl dibutyrate, 29. The procedure for 15
was followed to synthesize 29 (930 mg, 80%) as a colorless oil. Rf = 0.67 (25% ethyl acetate /
hexanes). 1H NMR (399 MHz, CHLOROFORM-d) δ ppm 7.58 (d, J=7.3 Hz, 2 H) 7.50 - 7.55
(m, 2 H) 7.40 - 7.49 (m, 4 H) 7.32 - 7.38 (m, 1 H) 5.25 - 5.35 (m, 1 H) 4.33 (dd, J=12.1, 4.0 Hz,
2 H) 4.17 (dd, J=11.7, 5.9 Hz, 2 H) 2.53 (dt, J=12.5, 7.0 Hz, 4 H) 2.31 (t, J=7.7 Hz, 4 H) 1.95
(quin, J=7.3 Hz, 2 H) 1.65 (sxt, J=7.3 Hz, 5 H) 0.94 (t, J=8.1 Hz, 6 H).
O
O
O
O
OH
1-(butyryloxy)-3-hydroxypropan-2-yl 6-(biphenyl-4-yl)hex-5-ynoate, 30, AM9087. The
procedure for 17 was followed to synthesize 30 (27 mg, 79%) as a colorless oil. Rf = 0.30 (35%
ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 7.55 - 7.60 (m, 2 H)
7.50 - 7.55 (m, 2 H) 7.40 - 7.48 (m, 4 H) 7.32 - 7.38 (m, 1 H) 5.12 (quin, J=5.0 Hz, 1 H) 4.35
(dd, J=12.0, 4.6 Hz, 1 H) 4.25 (dd, J=12.2, 5.9 Hz, 1 H) 3.70 - 3.78 (m, 2 H) 2.58 (t, J=7.3 Hz, 2
H) 2.53 (t, J=6.8 Hz, 2 H) 2.32 (t, J=7.3 Hz, 2 H) 2.09 (br. s., 1 H) 1.96 (quin, J=7.2 Hz, 2 H)
1.63 - 1.70 (m, 2 H) 0.94 (t, J=7.6 Hz, 3 H). 13C NMR (100 MHz, CHLOROFORM-d) δ 173.6,
173.1, 132.2, 129.1, 127.7, 127.2, 127.1, 122.8, 89.5, 81.7, 71.6, 62.2, 61.7, 36.2, 33.3, 24.1,
19.1, 18.6, 13.9.
![Page 169: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/169.jpg)
169
O
O
OH
OH
1,3-dihydroxypropan-2-yl 6-(biphenyl-4-yl)hex-5-ynoate, 31, AM9086. Candida antarctica
(100 mg) was added to a solution of 29 (80 mg, 0.17 mmol) stirred in anhydrous ethanol (1 mL)
under an atmosphere of argon. After starting material was consumed additional lipase (100 mg)
was added. After an additional 1h the reaction was diluted with CH2Cl2 and the lipase was
filtered off. The solvent was removed under reduced pressure, and the resulting residue was
chromatographed on methanol washed silica gel to yield 31 (44 mg, 78%) as white solid. Rf =
0.28 (70% ethyl acetate / hexanes). mp 82-84 °C. 1H NMR (399 MHz, CHLOROFORM-d) δ
ppm 7.58 (d, J=8.1 Hz, 2 H) 7.50 - 7.55 (m, 2 H) 7.40 - 7.49 (m, 4 H) 7.31 - 7.38 (m, 1 H) 4.95
(dt, J=9.3, 4.5 Hz, 1 H) 3.84 (br. s., 4 H) 2.61 (t, J=7.7 Hz, 2 H) 2.53 (t, J=7.0 Hz, 2 H) 2.22 (br.
s., 2 H) 1.97 (dt, J=14.1, 7.2 Hz, 2 H). 13C NMR (100 MHz, CHLOROFORM-d) δ 173.6, 140.7,
140.6, 132.2, 129.1, 127.8, 127.2, 89.6, 81.7, 62.7, 33.4, 24.1, 19.1.
O
O
O
O
O
O
2-(6-(biphenyl-4-yl)hexanoyloxy)propane-1,3-diyl dibutyrate, 32. The procedure for 20 was
followed to synthesize 32 (100 mg, 76%) as a colorless oil. Rf = 0.59 (35% ethyl acetate /
hexanes). 1H NMR (399 MHz, CHLOROFORM-d) δ ppm 7.56 - 7.60 (m, 2 H) 7.49 - 7.54 (m, 2
H) 7.39 - 7.46 (m, 2 H) 7.29 - 7.35 (m, 1 H) 7.24 (d, J=8.1 Hz, 2 H) 5.23 - 5.31 (m, 1 H) 4.30
![Page 170: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/170.jpg)
170
(dd, J=11.7, 4.4 Hz, 2 H) 4.15 (dd, J=11.7, 5.9 Hz, 2 H) 2.65 (t, J=8.1 Hz, 2 H) 2.26 - 2.37 (m, 6
H) 1.59 - 1.74 (m, 8 H) 1.35 - 1.48 (m, 2 H) 0.95 (t, J=7.3 Hz, 6 H).
O
O
O
O
O
O
(Z)-2-(6-(biphenyl-4-yl)hex-5-enoyloxy)propane-1,3-diyl dibutyrate, 33. To a solution of
Ni(OAc)2•4H2O (373 mg, 1.5 mmol) in anhydrous methanol (10 mL), was added NaBH4 (64
mg, 1.7 mmol) at room temperature under and an argon atmosphere. This mixture was
immediately put under vacuum and purged with H2 (3 times) and allowed to stir for 5 minutes.
The solution was treated with ethylenediamine (147 μL, 2.2 mmol) and stirred for an additional 5
minutes, at which, 29 (400 mg, 0.85 mmol) in 5mL of anhydrous methanol was added. The
mixture was stirred at room temp under an atmosphere of H2 for 2 h. The reaction mixture was
filtered through celite, and the filtrate was diluted with Et2O and brine. The organic phase was
separated and the aqueous phase was extracted 5 times with Et2O, and the combined organic
layers were washed dried over MgSO4. The resulting solution was concentrated and
chromatographed on silica gel to yield 33 (319 mg, 79%) as a colorless oil. Rf = 0.54 (25% ethyl
acetate / hexanes). 1H NMR (399 MHz, CHLOROFORM-d) δ ppm 7.59 (dd, J=12.5, 8.1 Hz, 4
H) 7.44 (t, J=7.7 Hz, 2 H) 7.31 - 7.38 (m, 3 H) 6.49 (d, J=11.7 Hz, 1 H) 5.66 (dt, J=11.5, 7.1 Hz,
1 H) 5.22 - 5.31 (m, 1 H) 4.29 (dd, J=12.1, 4.0 Hz, 2 H) 4.14 (dd, J=11.7, 5.9 Hz, 2 H) 2.44 (q,
J=7.3 Hz, 2 H) 2.38 (t, J=7.7 Hz, 2 H) 2.28 (t, J=7.3 Hz, 4 H) 1.82 (quin, J=7.5 Hz, 2 H) 1.63
(sxt, J=7.5 Hz, 4 H) 0.93 (t, J=7.7 Hz, 6 H).
![Page 171: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/171.jpg)
171
O
O
O
O
OH
1-(butyryloxy)-3-hydroxypropan-2-yl 6-(biphenyl-4-yl)hexanoate, 34, AM9089. The
procedure for 17 was followed to synthesize 34 (18 mg, 21%) as a colorless oil. Rf = 0.73 (70%
ethyl acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 7.56 - 7.60 (m, 2 H)
7.50 - 7.53 (m, 2 H) 7.40 - 7.45 (m, 2 H) 7.30 - 7.34 (m, 1 H) 7.24 (d, J=8.3 Hz, 2 H) 5.09 (quin,
J=5.1 Hz, 1 H) 4.32 (dd, J=11.2, 4.9 Hz, 1 H) 4.23 (dd, J=11.7, 5.9 Hz, 1 H) 3.72 (dd, J=4.6, 1.7
Hz, 2 H) 2.66 (t, J=7.8 Hz, 2 H) 2.37 (t, J=7.6 Hz, 2 H) 2.31 (t, J=7.3 Hz, 2 H) 1.60 - 1.73 (m, 7
H) 1.36 - 1.45 (m, 2 H) 0.95 (t, J=7.6 Hz, 3 H). 13C NMR (100 MHz, CHLOROFORM-d) δ
173.8, 173.5, 141.8, 130.5, 130.4, 129.0, 128.9, 127.2, 72.6, 62.2, 61.8, 36.2, 35.5, 34.4, 31.2,
28.9, 25.0, 18.6.
O
O
OH
OH
1,3-dihydroxypropan-2-yl 6-(biphenyl-4-yl)hexanoate, 35, AM9090. The reaction for 34 also
produced 35 (27 mg, 38%) as a white solid. Rf = 0.27 (70% ethyl acetate / hexanes). Mp 78-80
°C. 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 7.55 - 7.60 (m, 2 H) 7.49 - 7.53 (m, 2 H)
7.39 - 7.45 (m, 2 H) 7.30 - 7.35 (m, 1 H) 7.22 - 7.25 (m, 2 H) 4.92 (quin, J=4.8 Hz, 1 H) 3.81 (t,
J=5.1 Hz, 4 H) 2.66 (t, J=7.6 Hz, 2 H) 2.39 (t, J=7.6 Hz, 2 H) 2.08 (t, J=5.9 Hz, 2 H) 1.64 - 1.74
(m, 4 H) 1.37 - 1.45 (m, 2 H). 13C NMR (100 MHz, CHLOROFORM-d) δ 174.2, 141.8, 141.3,
138.9, 129.0, 128.9, 127.2, 72.6, 62.7, 35.5, 34.5, 31.2, 28.9, 25.1.
![Page 172: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/172.jpg)
172
O
O
O
O
OH
(Z)-1-(butyryloxy)-3-hydroxypropan-2-yl 6-(biphenyl-4-yl)hex-5-enoate, 36, AM10321. The
procedure for 17 was followed to synthesize 36 (10 mg, 8%) as a white solid. Rf = 0.79 (75%
ethyl acetate / hexanes). 1H NMR (399 MHz, CHLOROFORM-d) δ ppm 7.51 - 7.66 (m, 4 H)
7.39 - 7.48 (m, 2 H) 7.31 - 7.37 (m, 3 H) 6.49 (d, J=11.7 Hz, 1 H) 5.66 (dt, J=11.7, 7.3 Hz, 1 H)
5.07 (quin, J=5.1 Hz, 1 H) 4.30 (dd, J=11.7, 4.4 Hz, 1 H) 4.21 (dd, J=11.7, 5.9 Hz, 1 H) 3.70 (d,
J=5.1 Hz, 2 H) 2.37 - 2.48 (m, 4 H) 2.28 (t, J=7.3 Hz, 2 H) 1.83 (dt, J=15.2, 7.4 Hz, 2 H) 1.62 (s,
2 H) 1.26 (t, J=7.3 Hz, 1 H) 0.93 (t, J=7.7 Hz, 3 H).
O
O
OH
OH
(Z)-1,3-dihydroxypropan-2-yl 6-(biphenyl-4-yl)hex-5-enoate, 37, AM10322. The reaction for
36 also produced 37 (64 mg, 65%) as a white solid. Rf = 0.29 (75% ethyl acetate / hexanes). 1H
NMR (500 MHz, CHLOROFORM-d) δ ppm 7.56 - 7.63 (m, 4 H) 7.42 - 7.47 (m, 2 H) 7.31 -
7.37 (m, 3 H) 6.50 (d, J=11.7 Hz, 1 H) 5.66 (dt, J=11.5, 7.2 Hz, 1 H) 4.89 (quin, J=4.8 Hz, 1 H)
3.77 (d, J=4.9 Hz, 4 H) 2.38 - 2.47 (m, 6 H) 1.83 (quin, J=7.4 Hz, 2 H). 13C NMR (100 MHz,
CHLOROFORM-d) δ 174.0, 141.0, 139.7, 136.7, 129.9, 129.6, 129.2, 127.4, 127.3, 126.9, 75.4,
62.5, 34.0, 28.2, 25.3.
![Page 173: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/173.jpg)
173
O
OO
O
O
O
2-(pent-4-ynoyloxy)propane-1,3-diyl dibutyrate, 39. The procedure for 15 was followed to
synthesize 39 (3.27 g, 73%) as a colorless oil. Rf = 0.63 (35% ethyl acetate / hexanes). 1H NMR
(399 MHz, CHLOROFORM-d) δ ppm 5.27 - 5.34 (m, 1 H) 4.32 (dd, J=12.5, 3.7 Hz, 2 H) 4.17
(dd, J=11.7, 5.9 Hz, 2 H) 2.55 - 2.62 (m, 2 H) 2.48 - 2.55 (m, 2 H) 2.31 (t, J=7.3 Hz, 4 H) 1.98
(t, J=2.2 Hz, 1 H) 1.65 (sxt, J=7.5 Hz, 4 H) 0.91 - 0.99 (m, 6 H).
O
O
O
O
O
O
O
2-(5-(4-phenoxyphenyl)pent-4-ynoyloxy)propane-1,3-diyl dibutyrate, 41. The procedure for
27 was followed to synthesize 41 (800 mg, 42%) as a colorless oil. Rf = 0.56 (25% ethyl acetate /
hexanes). 1H NMR (399 MHz, CHLOROFORM-d) δ ppm 7.30 - 7.40 (m, 4 H) 7.08 - 7.17 (m, 1
H) 7.01 (d, J=7.3 Hz, 2 H) 6.87 - 6.93 (m, 2 H) 5.25 - 5.36 (m, 1 H) 4.33 (dd, J=12.1, 4.0 Hz, 2
H) 4.18 (dd, J=11.7, 5.9 Hz, 2 H) 2.69 - 2.76 (m, 2 H) 2.61 - 2.68 (m, 2 H) 2.24 - 2.31 (m, 4 H)
1.63 (sxt, J=7.3 Hz, 4 H) 0.89 - 0.96 (m, 6 H) 0.00 (s, 1 H). 13C NMR (100 MHz,
CHLOROFORM-d) δ 173.4, 171.3, 157.4, 156.8, 133.4, 130.1, 123.9, 119.5, 118.6, 118.3, 87.1,
81.0, 69.7, 62.2, 36.1, 33.8, 18.6, 15.5, 13.8.
O
O
O
OH
OH
![Page 174: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/174.jpg)
174
1,3-dihydroxypropan-2-yl 5-(4-phenoxyphenyl)pent-4-ynoate, 42, AM10330. The procedure
for 31 was followed to synthesize 42 (51 mg, 71%) as a colorless oil. Rf = 0.24 (75% ethyl
acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 7.32 - 7.38 (m, 4 H) 7.09 -
7.16 (m, 1 H) 6.98 - 7.04 (m, 2 H) 6.88 - 6.93 (m, 2 H) 5.00 (quin, J=4.8 Hz, 1 H) 3.82 - 3.89 (m,
4 H) 2.73 - 2.79 (m, 2 H) 2.67 - 2.73 (m, 2 H) 1.99 - 2.09 (m, 2 H).
O
O
O
O
O
O
O
(Z)-2-(5-(4-phenoxyphenyl)pent-4-enoyloxy)propane-1,3-diyl dibutyrate, 43. The procedure
for 33 was followed to synthesize 43 (222 mg, 63%) as a colorless oil. Rf = 0.60 (25% ethyl
acetate / hexanes). 1H NMR (399 MHz, CHLOROFORM-d) δ ppm 7.31 - 7.38 (m, 2 H) 7.22 -
7.26 (m, 2 H) 7.08 - 7.14 (m, 1 H) 7.03 (d, J=8.8 Hz, 2 H) 6.95 - 7.00 (m, 2 H) 6.43 (d, J=11.7
Hz, 1 H) 5.57 (dt, J=11.5, 7.1 Hz, 1 H) 5.21 - 5.35 (m, 1 H) 4.31 (dd, J=12.1, 4.0 Hz, 2 H) 4.15
(dd, J=11.7, 5.9 Hz, 1 H) 2.62 - 2.71 (m, 2 H) 2.44 - 2.51 (m, 2 H) 2.29 (t, J=7.3 Hz, 4 H) 1.59 -
1.69 (m, 4 H) 0.94 (t, J=7.7 Hz, 6 H). 13C NMR (100 MHz, CHLOROFORM-d) δ 173.4, 172.3,
156.3, 132.4, 130.4, 130.0, 123.6, 119.2, 118.7, 94.7, 72.7, 62.2, 36.1, 34.5, 18.6, 13.9, 12.8.
O
O
OH
OH
O
(Z)-1,3-dihydroxypropan-2-yl 5-(4-phenoxyphenyl)pent-4-enoate, 44, AM10331. The
procedure for 31 was followed to synthesize 44 (54 mg, 75%) as a colorless oil. Rf = 0.28 (75%
ethyl acetate / hexanes). 1H NMR (399 MHz, CHLOROFORM-d) δ ppm 7.31 - 7.38 (m, 2 H)
7.22 - 7.28 (m, 2 H) 7.08 - 7.14 (m, 1 H) 7.00 - 7.06 (m, 2 H) 6.95 - 7.00 (m, 2 H) 6.44 (d,
J=11.7 Hz, 1 H) 5.58 (dt, J=11.7, 7.0 Hz, 1 H) 4.92 (quin, J=4.8 Hz, 1 H) 3.75 - 3.85 (m, 4 H)
![Page 175: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/175.jpg)
175
2.69 (q, J=7.3 Hz, 2 H) 2.53 (t, J=7.3 Hz, 2 H) 2.24 - 2.32 (m, 2 H). 13C NMR (100 MHz,
CHLOROFORM-d) δ 173.3, 157.2, 156.4, 130.4, 130.0, 129.9, 129.6, 123.6, 119.2, 118.7, 75.4,
62.5, 34.7, 24.3.
O O
Br
3-bromopentane-2,4-dione, 46. Bromine (5.4 mL, 105 mmol) was slowly added drop wise to a
solution of acetyl acetone (10.0 g, 100 mmol) in 40 mL of a 1:1 solution water:carbon
tetrachloride. After completion the reaction was diluted with DCM, and the organic layer was
washed with water (3x) and sat. sodium thiosulfate solution (2x). The organic layer was dried
over MgSO4, and evaporation of solvent under reduced pressure gave 3-bromopentane-2,4-dione
(11.3 g, 63%) as an oil. 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 15.86 (s, 1 H) 4.74 (s, 1
H) 2.61 (s, 3 H) 2.42 (s, 3 H) 2.34 - 2.35 (m, 6 H).
O
OO
O
(5Z,8Z,11Z,14Z)-2,4-dioxopentan-3-yl icosa-5,8,11,14-tetraenoate, 47, AM10332.
Arachidonic acid (300 mg, 1.0 mmol) was added to a solution of 60% NaH in mineral oil (40
mg, 1.0 mmol) in 5 mL of anhydrous DMF at 0 °C. After 0.5 h, 46 (35 mg, 0.2 mmol) was added
to the solution and was heated to 50 °C for 2 h. Upon completion the reaction was diluted with
water and ether. The organic layer was separated, dried over MgSO4, concentrated, and
chromatographed on silica gel to yield, 47 (64 mg, 79%) as a colorless oil. Rf = 0.71 (35% ethyl
acetate / hexanes). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.29 - 5.48 (m, 8 H) 2.77 -
2.88 (m, 6 H) 2.49 - 2.55 (m, 2 H) 2.30 (s, 4 H) 2.14 - 2.22 (m, 2 H) 2.06 (q, J=6.9 Hz, 2 H) 2.01
(s, 2 H) 1.75-1.83 (m, 2 H) 1.32 - 1.40 (m, 2 H) 1.24 - 1.32 (m, 4 H) 0.89 (t, J=7.0 Hz, 3 H). 13C
![Page 176: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/176.jpg)
176
NMR (100 MHz, CHLOROFORM-d) δ 173.8, 170.8, 169.7, 130.7, 129.4, 128.8, 128.6, 128.5,
128.3, 128.1, 127.7, 85.2, 45.7, 33.3, 31.7, 29.6, 27.6, 27.5, 26.6, 25.9, 24.9, 24.8, 22.8, 14.3.
O
OOH
OH
(5Z,8Z,11Z,14Z)-((2S,4S)-2,4-dihydroxypentan-3-yl) icosa-5,8,11,14-tetraenoate, ±48,
AM10336. A solution of 47 (607 mg, 1.51 mmol) in 5 mL of THF was added dropwise to a
suspension of NaBH4 (58mg, 1.51mmol) in 5 mL of MeOH at -78 °C. After 2h, 0.1M HCl was
slowly added to the reaction mixture which was then diluted with H2O and Et2O. The ethereal
layer was separated, dried over MgSO4, and evaporated under reduced pressure. The oily
residue was chromatographed on silica gel to yield ±48, (255 mg, 42%) as a colorless oil. Rf =
0.42 (10% acetone / CH2Cl2). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.31 - 5.45 (m, 8
H) 4.67 (dd, J=5.2, 2.7 Hz, 1 H) 4.23 (quind, J=6.3, 6.3, 6.3, 6.3, 2.4 Hz, 1 H) 4.04 - 4.12 (m, 1
H) 2.78 - 2.87 (m, 6 H) 2.62 (dd, J=5.5, 2.4 Hz, 2 H) 2.42 (t, J=7.3 Hz, 2 H) 2.14 (dt, J=7.9, 6.7
Hz, 2 H) 2.06 (q, J=7.3 Hz, 2 H) 1.75 (quin, J=7.5 Hz, 2 H) 1.33 - 1.39 (m, 2 H) 1.27 - 1.33 (m,
4 H) 1.25 (d, J=6.7 Hz, 3 H) 1.19 (d, J=6.7 Hz, 3 H) 0.89 (t, J=6.7 Hz, 2 H). 13C NMR (100
MHz, CHLOROFORM-d) δ 173.7, 130.9, 129.4, 129.1, 128.9, 128.6, 128.4, 128.1, 127.8, 78.6,
68.6, 66.8, 34.0, 31.9, 29.7, 27.6, 26.9, 26.0, 25.2, 22.9, 19.9, 19.8, 14.4.
O
OOH
OH
(5Z,8Z,11Z,14Z)-((2R,3s,4S)-2,4-dihydroxypentan-3-yl) icosa-5,8,11,14-tetraenoate, 49,
AM10335. 1.0M Et2BOMe in THF (0.5 ml, 0.5 mmol) was added to a solution of 47 (200 mg,
![Page 177: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/177.jpg)
177
0.5 mmol) in 6 mL of a 5:1 THF/methanol solution cooled to -78 °C. After 20 minutes NaBH4
was added portion wise (38 mg, 1.0 mmol). After 2 h the reaction was warmed to rt and then
quenched with 1M HCl. The solution was then diluted with H2O and Et2O. The ethereal layer
was separated, dried over MgSO4, and evaporated under reduced pressure. The oily residue was
chromatographed on silica gel to yield 49 (27 mg, 13%) as a colorless oil. Rf = 0.35 (10%
acetone / CH2Cl2). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.29 - 5.46 (m, 8 H) 4.68 (t,
J=6.4 Hz, 1 H) 3.98 - 4.08 (m, 2 H) 2.76 - 2.88 (m, 6 H) 2.42 (d, J=3.1 Hz, 2 H) 2.37 (t, J=7.3
Hz, 2 H) 2.13 (q, J=7.3 Hz, 2 H) 2.06 (q, J=7.3 Hz, 2 H) 1.73 (quin, J=7.5 Hz, 2 H) 1.25 - 1.40
(m, 6 H) 1.22 (d, J=6.7 Hz, 6 H) 0.87 - 0.91 (m, 3 H). 13C NMR (126 MHz, CHLOROFORM-d)
δ 173.7, 130.8, 129.3, 129.0, 128.9, 128.5, 128.3, 128.1, 127.8, 80.4, 69.1, 34.0, 31.8, 29.6, 27.5,
26.8, 25.9, 25.1, 22.8, 19.9, 14.3.
O
OOH
OH
(5Z,8Z,11Z,14Z)-((2R,3r,4S)-2,4-dihydroxypentan-3-yl) icosa-5,8,11,14-tetraenoate, 50
AM10334. The reaction for 49 also produced 50 (69 mg, 35%) as a colorless oil. Rf = 0.25 (10%
acetone / CH2Cl2). 1H NMR (500 MHz, CHLOROFORM-d) δ ppm 5.30 - 5.46 (m, 8 H) 4.73 (t,
J=3.1 Hz, 2 H) 4.13 (quind, J=6.3, 6.3, 6.3, 6.3, 3.1 Hz, 2 H) 2.79 - 2.87 (m, 7 H) 2.47 (t, J=7.3
Hz, 2 H) 2.36 - 2.40 (m, 2 H) 2.13 - 2.19 (m, 2 H) 2.06 (q, J=7.3 Hz, 2 H) 1.77 (quin, J=7.5 Hz,
2 H) 1.33 - 1.40 (m, 2 H) 1.27 - 1.33 (m, 4 H) 1.20 (d, J=6.7 Hz, 6 H) 0.89 (t, J=7.0 Hz, 3 H). 13C
NMR (126 MHz, CHLOROFORM-d) δ 173.7, 130.9, 129.3, 129.1, 128.9, 128.5, 128.3, 128.1,
127.8, 80.6, 69.1, 34.1, 31.8, 29.6, 27.5, 26.8, 25.9, 25.1, 22.8, 19.9, 14.4.
O
O
![Page 178: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/178.jpg)
178
1-(oxiran-2-yl)ethanone, 52. Hydrogen peroxide (30%, 1.2 mL, 10.7 mmol) was added to a
stirred solution of methyl vinyl ketone 51 (0.593 mL, 7.1 mmol) and sodium bicarbonate (5.9 g,
71 mmol) in water (20 mL). After 3 h the product was extracted with ether (3x) and the organic
layer was then concentrated. The resulting residue was chromatographed on silica gel to yield 52
(70 mg, 11%) as an oil. Rf = 0.23 (10% ethyl acetate / hexanes). 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 3.41 (dd, J=4.3, 2.4 Hz, 1 H) 2.99 - 3.05 (m, 1 H) 2.90 (dd, J=5.5,
2.4 Hz, 1 H) 2.07 (s, 3 H).
O
O
OH
OH
(5Z,8Z,11Z,14Z)-1,3-dihydroxybutan-2-yl icosa-5,8,11,14-tetraenoate, 53. Immobillized
Candida antarctica (200 mg) was added to a stirred solution of 57 (100 mg, 0.1 mmol) in
anhydrous ethanol (1.5 mL) at room temperature. The reaction was stirred for 2 h, at which an
additional lipase (100 mg) was added. After 2 h the reaction mixture was filtered, the ethanol
was removed under reduced pressure and the residue was chromatographed on a silica gel to
yield AM10342 (29 mg, 73%) as a colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ ppm
5.31 - 5.46 (m, 8 H) 4.77 (td, J=4.9, 3.7 Hz, 1 H) 4.07 (qd, J=6.7, 1.8 Hz, 1 H) 3.92 (dd, J=12.2,
4.9 Hz, 1 H) 3.84 (dd, J=12.2, 3.7 Hz, 1 H) 2.77 - 2.88 (m, 6 H) 2.40 (t, J=7.3 Hz, 2 H) 2.14 (q,
J=6.7 Hz, 2 H) 2.06 (q, J=6.9 Hz, 2 H) 1.74 (quin, J=7.3 Hz, 2 H) 1.33 - 1.40 (m, 2 H) 1.27 -
1.33 (m, 4 H) 1.26 (d, J=6.1 Hz, 4 H) 0.89 (t, J=6.7 Hz, 3 H).
O
O
O
O
O
C19H31
O
C19H31
![Page 179: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/179.jpg)
179
1,2,3-tri[(5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenoate]-4-methyl-sn-glycerol, 57. EDCI
(1.33g, 6.9 mmol), DMAP (56 mg, 0.46 mmol), and 1,3-dibutoylglycerol (700 mg, 3.0 mmol)
were added to a stirred solution of arachidonic acid (700 mg, 2.31 mmol) in anhydrous CH2Cl2
(15 mL) at 0°C. The reaction was allowed to stir under argon for 4 hours. Upon completion the
reaction was diluted with CH2Cl2 and water. The organic layer was concentrated and the residue
was chromatographed on silica gel to yield 57 (1.15 g, 96%) as an oil. 1H NMR (500 MHz,
CHLOROFORM-d) δ ppm 5.29 - 5.44 (m, 24 H) 5.14 - 5.19 (m, 1 H) 5.07 - 5.14 (m, 1 H) 4.31
(dd, J=11.9, 3.4 Hz, 1 H) 4.13 (dd, J=11.9, 7.0 Hz, 1 H) 2.75 - 2.88 (m, 18 H) 2.27 - 2.36 (m, 6
H) 2.08 - 2.15 (m, 6 H) 2.05 (q, J=7.3 Hz, 6 H) 1.64 - 1.74 (m, 6 H) 1.26 - 1.40 (m, 18 H) 1.25
(d, J=6.1 Hz, 3 H) 0.89 (t, J=7.0 Hz, 9 H).
![Page 180: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/180.jpg)
180
4.9 References 1. Katona, I.; Sperlágh, B.; Sık, A.; Käfalvi, A.; Vizi, E. S.; Mackie, K.; Freund, T. F. Presynaptically Located CB1 Cannabinoid Receptors Regulate GABA Release from Axon Terminals of Specific Hippocampal Interneurons. The Journal of Neuroscience 1999, 19, 4544-4558. 2. Sugiura, T.; Kodaka, T.; Nakane, S.; Miyashita, T.; Kondo, S.; Suhara, Y.; Takayama, H.; Waku, K.; Seki, C.; Baba, N.; Ishima, Y. Evidence That the Cannabinoid CB1 Receptor Is a 2-Arachidonoylglycerol Receptor. Journal of Biological Chemistry 1999, 274, 2794-2801. 3. Marsicano, G.; Lutz, B. Expression of the cannabinoid receptor CB1 in distinct neuronal subpopulations in the adult mouse forebrain. European Journal of Neuroscience 1999, 11, 4213-4225. 4. Abadji, V.; Lin, S.; Taha, G.; Griffin, G.; Stevenson, L. A.; Pertwee, R. G.; Makriyannis, A. (R)-Methanandamide: A Chiral Novel Anandamide Possessing Higher Potency and Metabolic Stability. Journal of Medicinal Chemistry 1994, 37, 1889-1893. 5. Parkkari, T.; Myllymäki, M.; Savinainen, J. R.; Saario, S. M.; Castillo-Meléndez, J. A.; Laitinen, J. T.; Nevalainen, T.; Koskinen, A. M. P.; Järvinen, T. α-Methylated derivatives of 2-arachidonoyl glycerol: Synthesis, CB1 receptor activity, and enzymatic stability. Bioorganic & Medicinal Chemistry Letters 2006, 16, 2437-2440. 6. Parkkari, T.; Salo, O. M. H.; Huttunen, K. M.; Savinainen, J. R.; Laitinen, J. T.; Poso, A.; Nevalainen, T.; Järvinen, T. Synthesis and CB1 receptor activities of dimethylheptyl derivatives of 2-arachidonoyl glycerol (2-AG) and 2-arachidonyl glyceryl ether (2-AGE). Bioorganic & Medicinal Chemistry 2006, 14, 2850-2858. 7. Suhara, Y.; Oka, S.; Kittaka, A.; Takayama, H.; Waku, K.; Sugiura, T. Synthesis and biological evaluation of several structural analogs of 2-arachidonoylglycerol, an endogenous cannabinoid receptor ligand. Bioorganic & Medicinal Chemistry 2007, 15, 854-867. 8. Vadivel, S. K.; Vardarajan, S.; Duclos Jr, R. I.; Wood, J. T.; Guo, J.; Makriyannis, A. Conformationally constrained analogues of 2-arachidonoylglycerol. Bioorganic & Medicinal Chemistry Letters 2007, 17, 5959-5963. 9. Brizzi, A.; Cascio, M. G.; Frosini, M.; Ligresti, A.; Aiello, F.; Biotti, I.; Brizzi, V.; Pertwee, R. G.; Corelli, F.; Di Marzo, V. Resorcinol-sn-Glycerol Derivatives: Novel 2-Arachidonoylglycerol Mimetics Endowed with High Affinity and Selectivity for Cannabinoid Type 1 Receptor. Journal of Medicinal Chemistry 2011. 10. Wagner, J. A.; Járai, Z.; Bátkai, S.; Kunos, G. Hemodynamic effects of cannabinoids: coronary and cerebral vasodilation mediated by cannabinoid CB1 receptors. European Journal of Pharmacology 2001, 423, 203-210. 11. Boswinkel, G.; Derksen, J.; van't Riet, K.; Cuperus, F. Kinetics of acyl migration in monoglycerides and dependence on acyl chainlength. Journal of the American Oil Chemists' Society 1996, 73, 707-711. 12. Szabo, B.; Nordheim, U.; Niederhoffer, N. Effects of Cannabinoids on Sympathetic and Parasympathetic Neuroeffector Transmission in the Rabbit Heart. Journal of Pharmacology and Experimental Therapeutics 2001, 297, 819-826. 13. Fowler, C. J. Anandamide uptake explained? Trends in Pharmacological Sciences 2012, 33, 181-185. 14. Stelt, M. v. d.; Kuik, J. A. v.; Bari, M.; Zadelhoff, G. v.; Leeflang, B. R.; Veldink, G. A.; Finazzi-Agro`, A.; Vliegenthart, J. F. G.; Maccarrone, M. Oxygenated Metabolites of
![Page 181: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/181.jpg)
181
Anandamide and 2-Arachidonoylglycerol: Conformational Analysis and Interaction with Cannabinoid Receptors, Membrane Transporter, and Fatty Acid Amide Hydrolase. Journal of Medicinal Chemistry 2002, 45, 3709-3720. 15. Mechoulam, R.; Ben-Shabat, S.; Hanus, L.; Ligumsky, M.; Kaminski, N. E.; Schatz, A. R.; Gopher, A.; Almog, S.; Martin, B. R.; Compton, D. R.; Pertwee, R. G.; Griffin, G.; Bayewitch, M.; Barg, J.; Vogel, Z. Identification of an endogenous 2-monoglyceride, present in canine gut, that binds to cannabinoid receptors. Biochemical Pharmacology 1995, 50, 83-90. 16. Ghafouri, N.; Tiger, G.; Razdan, R. K.; Mahadevan, A.; Pertwee, R. G.; Martin, B. R.; Fowler, C. J. Inhibition of monoacylglycerol lipase and fatty acid amide hydrolase by analogues of 2-arachidonoylglycerol. British Journal of Pharmacology 2004, 143, 774-784. 17. Sugiura, T.; Kondo, S.; Sukagawa, A.; Nakane, S.; Shinoda, A.; Itoh, K.; Yamashita, A.; Waku, K. 2-Arachidonoylgylcerol: A Possible Endogenous Cannabinoid Receptor Ligand in Brain. Biochemical and Biophysical Research Communications 1995, 215, 89-97. 18. Mukherjee, S.; Adams, M.; Whiteaker, K.; Daza, A.; Kage, K.; Cassar, S.; Meyer, M.; Yao, B. B. Species comparison and pharmacological characterization of rat and human CB2 cannabinoid receptors. European Journal of Pharmacology 2004, 505, 1-9. 19. Goparaju, S. K.; Ueda, N.; Yamaguchi, H.; Yamamoto, S. Anandamide amidohydrolase reacting with 2-arachidonoylglycerol, another cannabinoid receptor ligand. FEBS Letters 1998, 422, 69-73. 20. Croci, T.; Manara, L.; Aureggi, G.; Guagnini, F.; Rinaldi-Carmona, M.; Maffrand, J.-P.; Le Fur, G.; Mukenge, S.; Ferla, G. In vitro functional evidence of neuronal cannabinoid CB1 receptors in human ileum. British Journal of Pharmacology 1998, 125, 1393-1395. 21. Rodrıguez, J. J.; Mackie, K.; Pickel, V. M. Ultrastructural Localization of the CB1 Cannabinoid Receptor in μ-Opioid Receptor Patches of the Rat Caudate Putamen Nucleus. The Journal of Neuroscience 2001, 21, 823-833.
![Page 182: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/182.jpg)
182
CHAPTER 5
N-ACYLETHANOLAMINE-HYDROLYZING ACID AMIDASE INHIBITORS
![Page 183: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/183.jpg)
183
5.1 Introduction and Background
NAEs are signaling molecules consisting of a fatty acid coupled to ethanolamine through
an amide bond and are found in plants and animals.1, 2 Anandamide has been the most studied
NAE because of its role in the endocannabinoid system.3 Palmitoylethanolamine (PEA) and
Oleoylethanolamine (OEA) are NAEs that have been extensively studied and which exhibit anti-
inflammatory properties through their activation of the PPARα receptor,4 in addition to
producing effects relating to neuroprotection,5 and analgesia.6 PEA also has an affinity to the
GPR55 and GPR119 receptors;7 and whether PEA activates the cannabinoid receptors (CB1 &
CB2) has been debated.8 It has been postulated that PEA activates the CB2 receptor but it may be
that the effects of PEA are not directly related to receptor activation. This may be the result of
an ‘entourage effect’ where PEA and other NAEs compete for their degradation by FAAH, and
thus increase the biological activity of anandamide by impeding its degradation.9 Studies
utilizing FAAH-deficient mice10-12 and selective FAAH inhibitors13, 14 suggest that FAAH is
primarily responsible for the metabolism of NAEs in the mammalian brain, while NAAA
metabolizes PEA in many mammalian tissues, organs, and some components of the immune
system.15-18 Thus, inhibition of NAAA and the subsequent increase of PEA could amplify anti-
inflammatory and anti-nociceptive effects of greater anandamide concentrations, as well as
increased PEA levels.
NAEs were believed to be degraded only by FAAH to the free fatty acid and
ethanolamine, until recently when NAAA was purified and characterized to be distinctively
different than FAAH and responsible for NAE metabolism.19 NAAA is primarily localized in
lysosomes,20 while FAAH is distributed in the cytosolic and luminal sides of intracellular
membranes. NAAA also has a modest homology (30%) with FAAH which was determined after
![Page 184: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/184.jpg)
184
the enzyme was cloned from rat, mouse, and human cDNA.21 NAAA belongs to the N-terminal
nuecleophile hydrolase superfamily, containing an N-terminal cysteine (126 in human) as the
catalytic residue.21, 22 Most importantly, NAAA has been shown to have optimum catalytic
activity at an acidic pH (4.5) compared to FAAH which has an ideal activity at pH 8.5-10.23 The
primary substrates of each enzyme differ as well. NAAA hydrolyzes PEA 40 times greater than
that of anandamide,16 while FAAH hydrolyzed anandamide eight times greater than PEA.24
5.1.1 Current NAAA inhibitors
After the identification,17 cloning, and characterization of NAAA,16 several research
efforts began into the development of novel inhibitors to increase NAE levels and thus amplify
their pharmacological benefits. The first reported NAAA inhibitors were a series of esters,
retroesters, and retroamides of palmitic acid (Figure 5.1).25 These compounds were assayed
utilizing a radioactive TLC assay, with NAAA from rat lung, at a concentration of 100 μM for
each inhibitor. Analogs of palmitoyl ester 1, reteroester 2 and the retroamine 3, had an inhibititon
of 84%, 71% and 77% respectively. PEA, the natural substrate for NAAA, had an inhibition of
34% at a concentration of 100 μM. While the first reported inhibitors were not a great
improvements over the substrate for inhibiting NAAA, compounds 2 and 3 showed that the
sensitivity of NAAA to retroesters and retroamides was different to that for FAAH, as no
significant inhibition of FAAH at the same concentration by 2 and 3 was observed.25 Saturnino,
et al., completed an SAR study based on these esters, retroester and retroamides using the human
NAAA enzyme. From this study, 5 exhibited an improved inhibition of 85% at 50 μM.26
![Page 185: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/185.jpg)
185
O
O1
O
O
2
NH
O
HO
3
O
NH
OH
4
O
O5
Figure 5.1 Best NAAA inhibitors derived from palmitic esters, 1 & 5; retroesters, 2;
retroamides, 3; along with palmitoylethanolamine (PEA) 4.
More recently, a new class of inhibitors containing a β-lactone displayed an improved
inhibition of NAAA. Using computer models based on the conserved catalytic N-terminal
region of conjugated bile acid hydrolase, compound 6 (Figure 5.2) was designed, synthesized
and shown to have an IC50 of 420 nM with rat NAAA. It also appears that NAAA displays
selective recognition, as the enantiomer of 6, compound 7, had a dramatic reduction of inhibition
to 6000 nM. In vivo experiments using 6 to inhibit NAAA increased endogenous levels of PEA,
thus preventing acute inflammation which appears to act through PPAR-α.27
This β-lactone scaffold led to the development of potent inhibitors 8 (102 nM), 9 (90
nM), and 10 (115 nM).28 Duranti, et al., continued SAR studies of this scaffold as the amide-
lactone functionality lacks the desired chemical stability, as these α-amino-β-lactones react with
other bionucleophiles and can be hydrolyzed in aqueous media. The chemical stability of these
compounds was improved by replacing the amide with a carbamate moiety, resulting in
compound 11 (Figure 5.2), with an IC50 of 130 nM, and a 10 fold increase in chemical stability
in rat and human plasma, and in the presence of bovine serum albumin.29
![Page 186: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/186.jpg)
186
O
NHO
O O
NHO
O
6 7
O
NHO
O O
NHO
O
O
O
NHO
O
8 9 10
O
NHO
O
O
11
Figure 5.2 Reported β-lactone NAAA inhibitors
5.2 Design, Synthesis, and Biological Evaluation of NAAA Inhibitors
5.2.1 Retroamides
In our search to find a class of compounds that selectively inhibited NAAA over other
enzymes present in the endocannabinoid system, we decided to start with a series of retroamides.
This decision was based on that the observation that retroamides were known to be more stable
in the presence of FAAH and MGL, and would hopefully have selectivity towards NAAA.30 All
retroamides (Table 5.1) were prepared starting with palmitylamine. The formation of the amide
![Page 187: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/187.jpg)
187
bond was achieved with either an acyl chloride in the presence of catalytic DMAP (12-16 and
18, Scheme 5.1), or an acid using EDCI and DMAP (17).
Compound 20 was synthesized from the p-nitrophenyl derivative of 18 which was treated with
palladium and hydrogen gas to yield amine 19. 19 was then treated with 1,1-thiocarbonyl-2(1H)-
dipyridone to yield isothiocyanate 20. While each of these retroamides did not show significant
activity at either FAAH or MGL (Table 5.1), there was also no significant inhibition of NAAA.
It appears that aryl and large cyclic groups placed at the head position of the compound were not
suitable for inhibition of NAAA, unlike the low μM inhibition observed from compounds 1 and
5.
Scheme 5.1 Synthesis of retroamide inhibitors
H2NO
ClR
NH
R
Ocat. DMAPCH2Cl2, 0 °C
12-16, 18
H2NO
OH
NH
OEDCI, DMAPCH2Cl2, 0 °C
17
1878%
Pd/C, EtOAcNH
O
H2N54%
NH
O
SCN
NO
NS O
14
19 20
![Page 188: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/188.jpg)
188
Table 5.1 IC50 values for compounds 12-20 towards NAAA, FAAH, and MGL enzymes. Cmpd
No. AM Structure IC50 (μM) hNAAA rFAAH hMGL
12 9024 NH
O
~100 >100 >100
13 9026 NH
O
O 10-100 - -
14 9027 NH
O
~100 >100 ~100
15 9028 NH
O
~100 >100 ~100
16 9030 NH
O
F >100 >100 >100
17 9031 O
HN
~100 >100 >100
18 9033 O
NH
O2N ~100 >100 >100
19 9034 O
NH
H2N >100 >100 >100
20 9035 O
NH
SCN >100 >100 >100
5.2.2 Carbonates and Carbamates
To capitalize on the catalytic cysteine residue of NAAA, we further investigated the
activity of carbonate and carbamate containing ligands as possible inhibitors. To maximize the
electrophilic nature of the functional group, a p-nitrobenzene was introduced to act as a good
leaving group. The electron withdrawing properties of the nitro group makes the phenyl a better
leaving group after nucleophilic attack of the electrophilic carbonyl moiety.
The synthesis of carbonates was conducted by reacting a series of alcohols 21-23 with p-
nitrophenyl chloroformate 24, in the presence of triethylamine and DMAP (Scheme 5.2).
Carbamates 33-36 were synthesized with a p-cyanophenyl group as the leaving group. While
cyano is a weaker electron withdrawing group than nitro, it provides more functional stability.
![Page 189: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/189.jpg)
189
These were synthesized starting with the treatment of alkylamines 28-31 with triethylamine and
phosgene to form the intermediate carbamic chloride, which was subsequently treated with 4-
hydroxybenzonitrile 32 to yield carbamates 33-36 (Scheme 5.3).
10-phenyldecanol 22 was converted to azide 37 with DPPA and DBU in excellent yield.
In two steps azide 37 was reduced to the amine and reacted with 24 to yield carbamate 38 in low
yield. Amines 39 and 40 were reacted with 24 in the presence of triethylamine and DMAP to
yield carbamates 41 and 42 in 98% and 32% yields respectively (Scheme 5.3).
SAR studies noted the differences of the IC50 values compared among enzymes NAAA,
FAAH and MGL (Table 5.2). Overall, carbamates exhibited greater NAAA inhibition as
compared to carbonates. The moderately potent carbonate 27 (AM9056) exhibited an IC50 of 5.8
μM towards NAAA, while having no inhibition of FAAH or MGL (>100 μM), however, it was
quickly apparent that the carbamates were generally more potent. Evaluation of SAR of
carbonates was not pursued at this time, although they may be selective.
Scheme 5.2 Synthesis of Carbonates 25-27
NO2
OCl
OOH
Xn
21 n = 15 X = CH322 n = 7 X = Ph23 n = 9 X = Ph
OX
nO
ONO2
25 n = 15 X = CH326 n = 7 X = Ph27 n = 9 X = Ph
24
Et3N, DMAPTHF
71-98%
![Page 190: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/190.jpg)
190
Scheme 5.3 Synthesis of Carbamates 33-36, 38 and 40-41
NH2nn = 10, 12-14
28-31
CN
HO NHn
O
OCN
n = 10, 12-1433-36
NHn
O
ONO2
X NH2n
28 n = 11 X = CH339 n = 0 X = p-benzyloxybenzene
X
40 n = 11 X = CH341 n = 0 X = p-benzyloxybenzene
Et3N, DMAPTHF
23DPPA, DBUDMF, 120 °C
N3n
1) Pd/C H22) 24, CH2Cl2
37
32
NHn
O
ONO2
38
Et3N, COCl2CH2Cl2, 0 °C
n = 10 n = 10
12-79%
13%95%
32-98%24
With regards to carbamate inhibitors, the functional group para to the carbamate had a
slight effect with activity. Compounds 33 and 34 which had a cyano in the para position had a
higher IC50 (486 nM and 308 nM respectively) after 3h incubation as compared to nitro
carbamate 41 (IC50 = 255 nM). The biggest difference between these compounds was their
selectivity towards FAAH. Compound 33 was actually more selective towards FAAH (IC50 =
313 nM for FAAH, 486 nM for NAAA), while 34 had 2x the selectivity for NAAA (IC50 = 812
nM for FAAH, 308 nM for NAAA).
The SAR study of carbamates culminated with the introduction of shorter alkyl chain and
a phenyl group at the tail end. Compound 38 (AM9058) is our the most potent and selective
(22x) carbamate inhibitor with an IC50 of 32 nM and 716 nM for NAAA and FAAH respectively.
![Page 191: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/191.jpg)
191
Replacement of the phenylalkyl chain with a more bulky two-ring system, 41, resulted in a drop
of inhibition towards NAAA.
These compounds were expected to behave as covalent inhibitors, which are indicated by
the large increase in inhibition when compounds are incubated with the enzyme for longer
periods of time. 33, 34 and 38 all showed improved inhibition when the incubation time was
increased from 15 m to 3 h, which allowed more covalent interactions to occur with the catalytic
cysteine of the NAAA enzyme before its activity to hydrolyze PAMCA is measured.
Table 5.2 Carbonates and Carbamates
R X( )n
O
O
Y
Cmpd No. AM R X Y N
IC50 (μM) NAAA NAAA
rFAAHb hMGLb 15m 3h
25 9048 CH3 O NO2 16 10-100 - >100 >100
26 9057 Ph O NO2 8 10-100 - 10-100 >100
27 9056 Ph O NO2 10 5.8±3.6a - >100 >100
33 9052 CH3 NH CN 11 1.3±0.16a 0.49±0.41a 0.31 ~10
34 9051 CH3 NH CN 13 1.4±0.11a 0.31±0.18a 0.81 1-10
35 9050 CH3 NH CN 14 ~10 - 1.9 >100
36 9049 CH3 NH CN 15 10-100 - ~10 >100
38 9058 Ph NH NO2 10 0.085±0.008a 0.032±0.004a 0.72 ~10
40 9054 CH3 NH NO2 11 0.26±0.012a 2.4 10-100
41 9072 O NH NO2 0 2.36 >100 >100
aData from three experiments each run in triplicate. bData from one experiment run in triplicate.
![Page 192: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/192.jpg)
192
5.2.3 Optimization of AM9058
Of the carbonates and carbamates, AM9058 (38, Table 5.2) exhibited the greatest
inhibition of NAAA (IC50 = 31.9 nM) and was 22 times more selective over FAAH. In an
attempt to improve enzyme selectivity, various leaving groups were examined. This was
completed through parallel synthesis of 23 using a series of chloroformates 42-48 to yield
carbamates 49-55 in 25-100% yield (Scheme 5.4).
Scheme 5.4 Parallel synthesis of carbamates
23OCl
OR
42 R = Ph 46 = 2-NO2 43 R = 4-F 47 = 4-OMe44 R = 2-Cl 48 = 4-Br45 R = 3-CF3
DMAP, CH2Cl20 °C
25-100% ONH
OR
49 R = Ph 53 = 2-NO2 50 R = 4-F 54 = 4-OMe51 R = 2-Cl 55 = 4-Br52 R = 3-CF3
n n = 10
While it was hoped that improve the NAAA/FAAH selectivity of the carbamates would
be improved by altering the leaving group, the opposite effect was observed. Only 52 and 53
exhibited significant NAAA inhibition. Compound 52 had an IC50 of 7.35 μM for 15 m
preincubation which improved to 0.713 μM after 3 h preincubation. While 53 exhibited an IC50
of 4.08 μM after 15 m preincubation and an improved inhibition of 0.988 μM after 3 h
preincubation (Table 5.3). While these ligands exhibited no significant MGL inhibition; they all
were selective for FAAH over NAAA with all ligands exhibiting <μM (IC50) FAAH inhibition.
Compounds 49-51 and 54-55 all had IC50 values <100 nM towards FAAH, with 55 being the
most potent at 5.9 nM. It appears that the carbamate moiety may not be suitable for optimal
NAAA inhibitors, as they are prone to attack from the catalytic serine of FAAH.
![Page 193: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/193.jpg)
193
Table 5.3 Carbamate inhibitors with alternate phenyl leaving groups
HN
10O
OR
Cmpd No. AM R
IC50 (μM) NAAA NAAA rFAAHb hMGLb 15m 3h
49 9061
10-100 - 0.02 10-100
50 9062 F
10-100 - 0.02 10-100
51 9063 Cl
10-100 - 0.08 ~10
52 9064
CF3
7.4±0.9a 0.71±0.04a 0.1 1-10
53 9065 NO2
4.1±0.9a 1.0±0.5a 0.40 >100
54 9066 O
>100 - 0.006 1-10
55 9067 Br
10-100 - 0.09 ~10
aData from three separate experiments run in triplicate. bData from one experiment run in triplicate.
5.2.4 Isothiocyanates
Based on cysteine being established as the catalytic amino acid residue of NAAA, and
also capable of inhibition through covalent interaction with carbamates and β-lactones, it was
hypothesized that isothiocyanates would behave as covalent inhibitors. This was based on
covalent interactions previously observed between the isothiocyanate moiety and cysteine
residues in the cannabinoid receptors.31-33 Also, isothiocyanates are not susceptible to
nucleophilic attack from serine, which should improve selectivity over FAAH.
![Page 194: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/194.jpg)
194
Synthesis began with EDCI coupling of acids 56 and 90 with ethanolamine to yield
amides 57 and 91. The hydroxyl group of the ethanolamide was transformed to the azide using
DPPA and DBU, which was converted to the isothiocyanate with PPh3 and CS2 to yield
inhibitors 59 and 53 (Scheme 5.5).
Amines 60-65 and 94-101 were treated with 1,1`-thiocarbonyldipyridin-2(1H)-one to
yield isothicyanates 66-71 and 102-109 in excellent yields. This reagent is simpler and more
efficient compared to previous methods of using carbon disulfide and triethylamine followed by
treatement with p-toluenesulfonyl chloride. The reaction with 1,1`-thiocarbonyldipyridin-2(1H)-
one was carried out at room temperature and reaction went to completion within 30 m. Yields
were mostly quantitative
Phenylalkanols 72-74 and 22-23 were first converted to azides 75-78 and 37 which led to
inhibitors 79-83 through established conditions. Although the transformation of azides to
isothiocyanates with PPh3 and CS2 can take 48 h, this method is preferred to reducing the azide
to the amine first as loss of compound is observed during purification, even though the
subsequent step can be quantitative.
To synthesize 89, 2-bromonaphthalene 84 and methyl hept-6-ynoate were treated with
trans-dichlorobis(triphenylphosphine)palladium (II), copper iodide, and triethylamine
(Sonogashira conditions) in the microwave for 20 minutes at 100°C to yield the coupled product
85. The alkyne was reduced to alkane 86 with palladium and hydrogen. Reduction of methyl
ester 86 to the alcohol using lithium aluminumhydride yielded alcohol 87, which was converted
to isothiocyanate 89 utilizing existing methods.
![Page 195: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/195.jpg)
195
Scheme 5.5 Synthesis of Isothiocyanate NAAA inhibitors
R OH
O
56 R = (CH2)6C10H790 R = C15H32
R NH
OOH
R NH
ONCS
R NH
ON3
57 R = (CH2)6C10H791 R = C15H32
58 R = (CH2)6C10H792 R = C15H32
59 R = (CH2)6C10H793 R = C15H32
R NH2 R NCS
66-71, 102-10960-65, 94-101
OHn
n = 4-6,8,10
N3n
n = 4-6,8,10
NCSn
n = 4-6,8,1079-8372-74, 22, 23 75-78, 37
4
Br
OH7
87
84 85
methyl hept-6-ynoate, Pd(PPh3)2Cl2, Et3N, CuI Pd/C, H2
O
O6
86O
O
N37
88
NCS7
89
PPh3, CS2, THFDPPA, DBU, DMF, 120 °C
LAH, THF
EDCI, DMAPethanolamine
DPPA, DBU, DMF, 120 °C
CS2, PPh3, THF
NO
NS O
DPPA, DBU, DMF, 120 °C CS2, PPh3, THF
Since NAAA hydrolyzes NAEs at the amide group, it was first decided to synthesize an
analog of PEA where the hydroxyl of the ethanolamide was replaced with an isothiocyanate
![Page 196: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/196.jpg)
196
group. The hypothesis was that this amide side of the ligand interacts with the catalytic triad of
the enzyme, and by placing a group known for covalent interactions with cysteines near the site
of enzymatic attack, a preference will be had for the isothiocyanate and the compound will act as
an irreversible inhibitor. This was the case with 59 where an IC50 of 900 nM was observed
towards NAAA, while having no interaction with FAAH.
Compound 66 was a result of shortening of the alkyl chain to 15 carbons and removing
the amide group. This showed an improvement in inhibition to 350 nM (Table 5.4). Shortening
the chain further increased inhibition as seen with 67 (14 carbons, IC50 = 150 nM) and 68 (12
carbons, IC50 = 170 nM). A significant reduction in potency was observed when the chain was
shortened to 10 carbons (69) as the IC50 for inhibition was around 10 μM. A further decrease of
inhibition to >100 μM was seen when a methyl was introduced α to the isothiocyanate group
(70).
The length of ligand chain was further shortened and a phenyl group was also placed at
the tail to improve NAAA inhibition. Compounds 79-81 had alkyl spacers of four, five, and six
carbons respectively, although no significant inhibition was observed. When there were eight
carbons between the phenyl and isothiocyanate groups the IC50 improved to 410 nM (82). The
increase in chain length culminated with compound 83 (AM9053) which exhibited an IC50 of 39
nM towards the enzyme. This coincides with the length of the best alkyl chain based inhibitors
67 and 68 in terms of optimal length of the compound. To expand on AM9053, the phenyl was
replaced with the larger naphthyl group while shortening the chain to seven carbons in 89.
While an increase of inhibition was not observed, this compound was still one of the better
inhibitors, with an IC50 of 260 nM. Modification of 89 to include an amide group as in 93,
however, resulted in a drastic loss of inhibitory activity.
![Page 197: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/197.jpg)
197
Based on results of the best ligand AM9053, compounds were made to produce a series
of ring systems in place of the alkyl tail. Compounds containing a combination of phenyl,
pyridinyl, piperazinyl, morpholinyl, piperidinyl, and/or pyrazinyl ring systems were examined.
Unfortunately, none of these ligands showed any inhibition towards NAAA.
Table 5.4 Inhibition data of isothiocyanate compoudns Cmpd
No. AM Structure IC50 (μM) hNAAA rFAAH hMGL
59 9019 O
NH
NCS14
0.90±0.07a ~100 -
66 9023 13NCS
0.35±0.07a 10-100 ~10
67 9046 12NCS
0.15±0.03a ~100 -
68 9045 10NCS
0.17±0.07a 10-100 -
69 9042 8NCS
~10 10-100 -
70 9043 8
NCS
>100 >100 -
71 9044 SNCS
O
>100 >100 -
79 9038 NCS4
>100 ~10 ~100
80 9037 NCS5
>100 10-100 ~100
81 9036 NCS6
>100 1-10 10-100
82 9047 NCS8
0.41±0.11a 10-100 ~100
83 9053 NCS10
0.039±0.009a ~100 >100
89 9060 NCS7
0.26±0.03a >100 ~100
![Page 198: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/198.jpg)
198
93 9071 O
NH
NCS6
10-100 10-100 1-10
102 10318 NNCS
>100 - -
103 10323 NCS
NN
>100 - >100
104 10324 NCS
ON
>100 - >100
105 10325 NCS
N
>100 10-100 >100
106 10326 NCSO
N >100 >100 >100
107 10327 N
O
ONCS
10-100 10-100 ~10
108 10328 NCS
ON
N 10-100 10-100 10-100
109 10329 NCS
O
10-100 ~10 ~10
aAll data obtained from three separate experiments run in triplicate
5.3 Evaluation of AM9053 Mode of Inhibition
The mechanism of inactivation of NAAA by β-lactones has been recently reported to
proceed through an S-acylation by the catalytic N-terminal cysteine (Scheme 5.6).34 We have
recently corroborated this result as well as identifying irreversible inhibition through cysteine
attack on the urea moiety of AM6701 (Scheme 5.7).35
![Page 199: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/199.jpg)
199
Scheme 5.6 S-alkylation inhibition mechanism of β-lactones
O
O NH
O
OREnzyme-S
SEnzyme
ONH
O
OR
HO
Scheme 5.7 Irreversible inhibition by AM6701
Enzyme-S NN
NN
O
N SEnzyme
O
N
Our most potent inhibitor AM9053 (83, Table 5.4) was expected to behave as an
irreversible inhibitor when the catalytic N-terminal cysteine attacks the electrophilic
isothiocyanate group to form a covalent bond.32, 33, 36
During NAAA inhibition assays of carbamate ligands, the amount of inhibition was
related to the preincubation time. Compounds 33, 34 and 38 (Table 5.2) were assayed with
preincubation times of 15 m and 3 h. A dramatic increase of inhibition was observed with
increased preincubation. This is consistent with a covalent interaction of between the carbamate
moiety and N-terminal catalytic cysteine of the enzyme. However, for concentration dependent
inhibition of NAAA by AM9053, when preincubated for either 15 m and 3 h, there was no
discernible difference in activity (Figure 5.3).
![Page 200: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/200.jpg)
200
Figure 5.3 Concentration dependent inhibition of human NAAA by AM9053 15 minutes preincubation with the compound (filled circles, solid line) and after 3 hours preincubation (open circles, dotted line).
To confirm this observation, MALDI-TOF MS was utilized to examine a tryptic digest of
the catalytic region of NAAA with and without treatment of AM9053. The control (A, Figure
5.4) consisted of the tryptic digest of human NAAA without treatment with AM9053. This
sequence contained the catalytic cysteine and has a mass of 1079.5 Da. The spectrum of the
tryptic digest of NAAA after treatment with AM9053 (B, Figure 5.4) exhibited no peak for the
expected combined mass of NAAA and AM9053 (1354.5 Da), while the control peak of 1079.5
Da representing NAAA was undiminished. This indicated there was no covalent activity
associated with the interaction between the peptide containing Cys126 of NAAA and AM9053.
AM9053 was determined to be a competitive inhibitor that binds reversibly within the
active site of NAAA. This was determined by incubation of our fluorogenic substrate PAMCA
with NAAA at various concentrations in the presence and absence of the inhibitor AM9053. This
data was analyzed using a Lineweaver-Burk plot which indicated the competitive nature of
AM9053 (Figure 5.5).
![Page 201: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/201.jpg)
201
Inte
nsity
M/z
Figure 5.4 Tryptic digest of purified human NAAA obtained by MALDI-TOF MS for protein neat (A) and AM9053 treated enzyme (B). The tryptic peptide containing the catalytic nucleophile cysteine is noted with an asterisk (sequence: CTSIVAQDSR, mass: 1079.5 Da). Note that the intensity of the 1079.5 Da peak is undiminished after treatment with AM9053 and the absence of a peak for the covalently modified peptide (expected mass of approximately 1354.5 Da).
*
A
B
*
![Page 202: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/202.jpg)
202
Figure 5.5 Lineweaver-Burk plot analysis of AM9053 inhibition of hNAAA. hNAAA was incubated with the fluorogenic substrate PAMCA at different concentrations in the presence (open cirles) and absence of AM9053 (closed circles) at a concentration of 50 nM. The intersection of the lines at x=0 is indicative of a competitive inhibitor.
5.4 Conclusions
NAEs are known to induce anti-nociceptive and anti-inflammatory responses through
their activation of the PPAR-α receptor. Inhibition of NAAA increases levels of PEA,
oleoylethanolamine, and possibly anandamide, resulting in increased therapeutic benefits. With
a limited availability of NAAA inhibitors we prepared and evaluated various classes of
compounds.
Dual inhibition of endocannabinoid enzymes (FAAH and MGL) has shown promising
results related to drug abuse.37 While inhibition of FAAH and NAAA may have some future
value with overlapping benefits, it is important to identify potent and selective NAAA inhibitors.
With the investigation of NAAA being relatively imprecise, developing ligands as selective
![Page 203: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/203.jpg)
203
inhibitors (as opposed to known ligands that inhibit other cannabinoid metabolizing enzymes) is
important to understand the specific actions of NAAA and its potential as a therapeutic target.
The first attempt at selective NAAA inhibitors used retroamides as it was shown that the
analogs of anandamide containing a retro-amide were metabolically stable in the presence of
FAAH. The synthesized retro-amides exhibited no inhibition of FAAH or MGL, and they were
inactive towards NAAA as well.
The next two classes that we explored were carbonates and carbamates. Utilizing strong
leaving groups, the catalytic cysteine of NAAA could then attack the δ+ carbonyl carbon of the
carbonate or carbamate, resulting in covalent modification of the enzyme which leads to
inhibition of NAAA’s metabolizing actions. The best carbonate derivative (27) had an IC50 of
5.8 μM while retaining selectivity. However, the carbamates were much more potent inhibitors.
The chemical moiety para to the carbamate had a significant effect on NAAA inhibition.
Ligands containing the stronger electron withdrawing group- nitro were better inhibitors
compared to the p-cyano compounds. In addition, the p-nitro compounds were more selective to
NAAA over FAAH. The best compound (38) exhibited an IC50 of 32 nM and 22x selectivity
over FAAH, however, p-nitrophenols as leaving groups can generally be toxic in biological
systems.
We decided to pursue isothiocyanate compounds as covalent inhibitors, as we observed
covalent cysteine-isothiocyanate interactions with the cannabinoid receptors. We identified
pentadecylisothiocyanate (36, IC50 350nM) as being NAAA selective. We continued to reduce
the alkyl chain length and ultimately added a phenyl ring to the tail. This progress gave our best
inhibitor, AM9053 (83) with an IC50 of 39 nM and no activity observed at either FAAH or MGL.
However, our hypothesis that these would behave as covalent modifiers appeared to be incorrect.
![Page 204: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/204.jpg)
204
Fluorescence-based assays did not show a change in slope (fluorescence vs. time) when AM9053
was preincubated with NAAA for either 15 minutes or 3 hours. A reversible mode of action was
also observed when a decrease in inhibition was observed after a rapid dilution assay. This was
supported by a tryptic digest of purified human NAAA- neat and treated with AM9053. No
observable difference in mass spectra of untreated and treated NAAA digests was observed, and
no peak of 1354.5 Da, which would be expected if AM9053 was covalently bound to the
catalytic cysteine nucleophile of NAAA, was present.
This information will focus our continued research on the inhibition of NAAA to pursue
isothiocyanate analogs. Current reported inhibitors of NAAA currently include retroamides
exhibiting micromolar inhibition, and potent, covalent, β-lactone inhibitors that are unstable in
plasma. Multiple tests indicate that these isothiocyanate compounds do not behave through a
covalent mechanism and are selective for NAAA over FAAH and MGL. Isothiocyanates are
stable chemical moieties and are currently very potent NAAA inhibitors. SAR studies of the best
ligands reported here will determine functionalities tolerated by NAAA and possibly improve on
the potency of these inhibitors.
![Page 205: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/205.jpg)
205
5.5 Experimental
NH
O
N-hexadecylcinnamamide, 12, AM9024. Cinnamoyl chloride (22 mg, 0.13 mmol) was added to
a solution of hexadecylamine (32 mg, 0.13 mmol) and catalytic DMAP (3 mg) in CH2Cl2 (4
mL). Upon completion (TLC monitoring) the reaction was washed with water and the organic
layer was separated and filtered through an Isolute® PEAX and SCX-2 column. The filtrate was
collected and the solvent was removed under reduced pressure to yield 12, (15 mg, 32%) as a
white solid. mp 72-75 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.63 (d, J = 15.6 Hz, 1H),
7.50 (dd, J = 1.71, 7.6 Hz, 2H), 7.35 - 7.38 (m, 3H), 6.37 (d, J = 15.6 Hz, 1H), 3.39 (s, 2H), 1.52
- 1.61 (m, 3H), 1.16 - 1.42 (m, 26H), 0.88 (t, J = 6.8 Hz, 3H).
NH
O
O
N-hexadecyl-4-methoxybenzamide, 13, AM9026. Synthesized following the procedure for 12,
(31mg, 33%) white solid. mp 87-88 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.72 (d, J =
8.8 Hz, 2H), 6.92 (d, J = 8.8 Hz, 2H), 5.95 - 6.02 (br. s., 1H), 3.85 (s, 3H), 3.40 - 3.46 (m, 2H),
1.60 (quin, J = 7.3 Hz, 2H), 1.22 - 1.41 (m, 26H), 0.88 (t, J = 6.4 Hz, 2H).
NH
O
N-hexadecyl-2-adamantamide, 14, AM9027. Synthesized following the procedure for 12, (78
mg, 78%) white solid. MP = 78-81 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 5.51 - 5.60
![Page 206: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/206.jpg)
206
(br. s., 1H), 3.19 - 3.26 (m, 2H), 2.04 (m, 3H), 1.84 (d, J = 2.4 Hz, 6H), 1.65 - 1.78 (m, 6H), 1.48
(quin, J = 6.8 Hz, 2H), 1.20 - 1.34 (m, 26H), 0.88 (t, J = 6.8 Hz, 3H).
NH
O
N-hexadecyl-4-methylbenzamide, 15, AM9028. Synthesized following the procedure for 12,
(59 mg, 67%) white solid. mp 75-76 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.65 (d, J =
8.3 Hz, 2H), 7.23 (d, J = 8.3 Hz, 2H), 5.95 - 6.08 (br. s., 1H), 3.38 - 3.48 (m, 2H), 2.39 (s, 3H),
1.60 (quin, J = 7.3 Hz, 2H), 1.20 - 1.41 (m, 26H), 0.88 (t, J = 6.8 Hz, 3H).
NH
O
F
3-fluoro-N-hexadecylbenzamide, 16, AM9030. Synthesized following the procedure for 12,
(78 mg, 87%) white solid. mp 83-84 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.45 - 7.53
(m, 2H), 7.37 - 7.44 (m, 1H), 7.16 - 7.22 (m, 1H), 5.95 - 6.11 (br. s., 1H), 3.40 - 3.49 (m, 2H),
1.61 (quin, J = 7.3 Hz, 2H), 1.20 - 1.42 (m, 26H), 0.88 (t, J = 6.8 Hz, 3H).
O
HN
N-hexadecyl-2-(naphthalen-1-yl)acetamide, 17, AM9031. EDCI (148 mg, 0.77 mmol), DMAP
(15 mg, 0.12 mmol), and 1-naphthaleneacetic acid (46 μL, 0.25 mmol) were added to a solution
of hexadecylamine (60 mg, 0.25 mmol) in CH2Cl2 (5 mL) at 0 °C. The reaction stirred under
argon for 6 h. Upon completion the reaction was washed with water and brine. The organic
layer was separated, dried over MgSO4, and removed under reduced pressure. The resulting
residue was chromatographed on silica gel to yield 17 (31 mg, 31%) as a white solid. mp 96-97
![Page 207: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/207.jpg)
207
°C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.94 - 7.98 (m, 1H), 7.87 - 7.91 (m, 1H), 7.84 (d,
J = 8.3 Hz, 1H), 7.54 (ddd, J = 1.7, 5.7, 7.7 Hz, 2H), 7.44 - 7.48 (m, 1H), 7.39 - 7.42 (m, 1H),
5.23 (br. s., 1H), 4.03 (s, 2H), 3.07 - 3.15 (m, 2H), 1.20 - 1.33 (m, 28H), 0.88 (t, J = 7.01 Hz,
3H).
O
NH
O2N
N-hexadecyl-4-nitrobenzamide, 18, AM9033. Synthesized following the procedure for 12,
(300 mg, 82%) white solid. mp 100-101 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 8.29 (d,
J = 8.8 Hz, 2H), 7.92 (d, J = 8.8 Hz, 2H), 6.07 - 6.17 (br. s., 1H), 3.42 - 3.52 (m, 2H), 1.64 (quin,
J = 7.3 Hz, 2H), 1.21 - 1.43 (m, 26H), 0.88 (t, J = 6.8 Hz, 3H).
O
NH
H2N
4-amino-N-hexadecylbenzamide, 19, AM9034. 10% Pd/C (82 mg, 0.077 mmol) was added to a
suspension of 18 (250 mg, 0.64 mmol) in ethyl acetate (20 mL). The reaction was immediately
put under vacuum and flushed with hydrogen (3x). Upon completion the reaction mixture was
filtered and the solvent was removed under reduced pressure. The resulting residue was
chromatographed on silica gel to yield 19 (180 mg, 78%) as a white solid. mp 124-126 °C. 1H
NMR (500 MHz, CHLOROFORM-d) δ 7.59 (d, J = 8.3 Hz, 2H), 6.66 (d, J = 7.8 Hz, 2H), 5.85 -
5.99 (br. s., 1H), 3.93 (br. s., 2H), 3.38 - 3.45 (m, 2H), 1.56 - 1.63 (m, 2H), 1.20 - 1.43 (m, 26H),
0.88 (t, J = 6.8 Hz, 3H).
O
NH
SCN
![Page 208: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/208.jpg)
208
N-hexadecyl-4-isothiocyanatobenzamide, 20, AM9035. 1,1`-thiocarboncyldipyridin-2(1H)-one
(64 μL, 0.84 mmol) was added to a suspension of 19 (100 mg, 0.28 mmol) in anhydrous CH2Cl2
(10 mL) under an atmosphere of argon and stirred for 0.5h. Upon completion the reaction was
washed with water and the organic layer was separated and removed under reduced pressure.
The resulting residue was chromatographed on silica to yield 20 (96 mg, 85%) as a white solid.
mp 85-86 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.75 (d, J = 9.3 Hz, 2H), 7.27 (d, J =
8.8 Hz, 5H), 5.99 - 6.06 (br. s., 1H), 3.41 - 3.47 (m, 2H), 1.61 (quin, J = 7.3 Hz, 2H), 1.19 - 1.41
(m, 26H), 0.87 (t, J = 6.8 Hz, 3H).
O O
ONO2
hexadecyl 4-nitrophenyl carbonate, 25, AM9048. Triethylamine (143 μL, 1.03 mmol), DMAP
(126 mg, 1.03 mmol), and 4-nitrophenyl chloroformate (207 mg, 1.03 mmol) were added to a
solution of 1-hexadecanol (250 mg, 1.03 mmol) in THF (10 mL) stirred at rt. After 2 h the
reaction mixture was diluted with ether and washed with water, brine, and dried over MgSO4.
The solvent was evaporated off under reduced pressure and the resulting residue was
chromatographed on silica to yield 25 (410 mg, 98%) as a white solid. mp 51-52 °C. 1H NMR
(500 MHz, CHLOROFORM-d) δ 8.28 (d, J = 4.88 Hz, 2H), 7.39 (d, J = 4.88 Hz, 2H), 4.29 (t, J
= 6.59 Hz, 2H), 1.72 - 1.80 (m, 2H), 1.22 - 1.47 (m, 26H), 0.88 (t, J = 7.08 Hz, 3H).
O O
ONO2
4-nitrophenyl 8-phenyloctyl carbonate, 26, AM9057. Synthesized following the procedure for
25, (80 mg, 74%) white solid. mp 44-46 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 8.28 (d,
J = 4.9 Hz, 0H), 7.38 (d, J = 4.9 Hz, 0H), 7.27 - 7.30 (m, 2H), 7.14 - 7.21 (m, 3H), 4.28 (t, J =
![Page 209: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/209.jpg)
209
6.8 Hz, 2H), 2.61 (t, J = 7.3 Hz, 2H), 1.75 (quin, J = 6.8 Hz, 4H), 1.58 - 1.66 (m, 2H), 1.38 - 1.45
(m, 2H), 1.35 (m, 6H).
O O
ONO2
4-nitrophenyl 10-phenyldecyl carbonate, 27, AM9056. Synthesized following the procedure
for 25, (72 mg, 71%) white solid. mp 52-54 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 8.28
(d, J = 8.8 Hz, 2H), 7.38 (d, J = 9.3 Hz, 2H), 7.26 - 7.30 (m, 2H), 7.15 - 7.20 (m, 3H), 4.29 (t, J =
6.8 Hz, 2H), 2.60 (t, J = 6.8 Hz, 2H), 1.75 (quin, J = 7.1 Hz, 2H), 1.61 (quin, J = 7.3 Hz, 2H),
1.38 - 1.45 (m, 2H), 1.30 (m, 10H).
NH
O
OCN
4-cyanophenyl dodecylcarbamate, 33, AM9052. 20% Phosgene in toluene (170 μL, 0.34
mmol) was added to a suspension of triethylamine (47 μL, 0.34 mmol) and 4-
hydroxybenzonitrile (40 mg, 0.34 mmol) in anhydrous CH2Cl2 (10 mL) under an atmosphere of
argon at 0 °C. After 45m of stirring, the reaction was treated with dodecylamine (63 mg, 0.34
mmol) and allowed to warm to rt where the reaction stirred for an additional hour. The reaction
was washed with water, brine, and dried over MgSO4. The solvent was evaporated off and the
resulting residue was chromatographed on silica gel to yield 33 (88 mg, 79%) as a white solid.
mp 97-98 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.65 (d, J = 7.8 Hz, 2H), 7.27 (d, J =
7.8 Hz, 2H), 5.06 (br. s., 1H), 3.22 - 3.30 (m, 2H), 1.59 (quin, J = 6.3 Hz, 2H), 1.21 - 1.40 (m,
18H), 0.88 (t, J = 7.1 Hz, 3H).
NH
O
OCN
![Page 210: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/210.jpg)
210
4-cyanophenyl tetradecylcarbamate, 34, AM9051. Synthesized following the procedure for
33, (15 mg, 12%) white solid. mp 102-103 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.65
(d, J = 8.8 Hz, 2H), 7.26 (d, J = 8.8 Hz, 2H), 4.99 - 5.10 (br. s., 1H), 3.24 - 3.30 (m, 2H), 1.59
(quin, J = 6.8 Hz, 2H), 1.26 (s, 22H), 0.88 (t, J = 6.8 Hz, 3H).
NH
O
OCN
4-cyanophenyl pentadecylcarbamate, 35, AM9050. Synthesized following the procedure for
33, (66 mg, 52%) white solid. mp 93-94 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.65 (d,
J = 8.8 Hz, 2H), 7.26 (d, J = 8.8 Hz, 2H), 4.98 - 5.11 (m, 1H), 3.23 - 3.30 (m, 2H), 1.57 (quin, J
= 7.1 Hz, 2H), 1.19 - 1.41 (m, 24H), 0.88 (t, J = 6.8 Hz, 3H).
NH
O
OCN
4-cyanophenyl hexadecylcarbamate, 36, AM9049. Synthesized following the procedure for
33, (33 mg, 25%) white solid. mp 92-94 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.66 (d,
J = 8.8 Hz, 2H), 7.27 (d, J = 8.8 Hz, 2H), 5.00 - 5.09 (br. s., 1H), 3.25 (s, 2H), 1.57 (quin, J = 7.3
Hz, 2H), 1.20 - 1.41 (m, 26H), 0.88 (t, J = 6.8 Hz, 3H).
N3
(10-azidodecyl)benzene, 37. DBU (144 μL, 0.96 mmol) and DPPA (207 μL, 0.96 mmol) were
added to a solution of 10-phenyl-1-decanol (22, 150 mg, 0.64 mmol) in anhydrous DMF (4 mL)
at 120 °C. The reaction was allowed to stir for 4 h, where it was diluted with ether (10 mL) and
washed with water, brine, and dried over MgSO4. The ether was evaporated off under reduced
pressure and the resulting residue was chromatographed on silica gel to yield 37 (157 mg, 95%)
![Page 211: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/211.jpg)
211
as a pale yellow oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.26 - 7.30 (m, 2H), 7.12 - 7.20
(m, 3H), 3.25 (t, J = 6.8 Hz, 2H), 2.60 (t, J = 6.3 Hz, 2H), 1.55 - 1.65 (m, 4H), 1.21 - 1.40 (m,
12H).
NH
O
ONO2
4-nitrophenyl 10-phenyldecylcarbamate, 38, AM9058. 10% Pd/C (64 mg, 0.06 mmol) was
added to a suspension of 37 (156 mg, 0.60 mmol) in ethyl acetate (10 mL) at rt. The reaction
was placed under vacuum and flushed with hydrogen (3x). Upon completion the catalyst was
filtered off and the remaining solvent removed under reduced pressure. The resulting crude oil
was then diluted in CH2Cl2 (5 mL) and treated with 24 (121 mg, 0.60 mmol) and stirred for 30
m. The reaction mixture was washed with water, brine, and dried over MgSO4. The solvent was
removed and the crude oil was chromatographed on silica gel to yield 38 (32 mg, 13%) as a
white solid. mp 78-80 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 8.24 (d, J = 9.3 Hz, 2H),
7.32 (d, J = 9.3 Hz, 2H), 7.26 - 7.30 (m, 2H), 7.13 - 7.20 (m, 3H), 5.02 - 5.15 (br. s., 1H), 3.23 -
3.33 (m, 2H), 2.60 (t, J = 7.3 Hz, 2H), 1.56 - 1.66 (m, 4H), 1.24 – 1.35 (m, 12H).
NH
O
ONO2
4-nitrophenyl dodecylcarbamate, 40, AM9054. Triethylamine (53 μL, 0.38 mmol), DMAP (12
mg, 0.038 mmol), and 24 (77 mg, 0.38 mmol) were added to a solution of 28 (70 mg, 0.38
mmol) in anhydrous THF (10 mL) under an atmosphere of argon at rt. Upon completion the
reaction was diluted with ether (15 mL), washed with water, brine, and dried over MgSO4. The
solvent was removed under reduced pressure and the resulting residue was chromatographed on
silica gel to yield 40 (131 mg, 98%) as a white solid. mp 96-97 °C. 1H NMR (500 MHz,
![Page 212: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/212.jpg)
212
CHLOROFORM-d) δ 8.25 (d, J = 9.3 Hz, 2H), 7.32 (d, J = 9.3 Hz, 2H), 5.09 (br. s., 1H), 3.24 -
3.32 (m, 2H), 1.59 (quin, J = 7.1 Hz, 2H), 1.22 - 1.40 (m, 18H), 0.88 (t, J = 6.6 Hz, 3H).
NH
O
ONO2O
4-nitrophenyl 4-(benzyloxy)phenylcarbamate, 41, AM9072. Synthesized following the
procedure for 40, (37 mg, 32%) white solid. MP = 156-159 °C. 1H NMR (500 MHz,
CHLOROFORM-d) δ 8.28 (d, J = 8.8 Hz, 2H), 7.29 - 7.46 (m, 9H), 6.98 (d, J = 9.3 Hz, 2H),
6.89 - 6.94 (m, 1H), 5.06 (s, 2H).
NH
O
O
Naphthalen-2-yl 10-phenyldecylcarbamate, 49, AM9061. DMAP (5mg, 0.04 mmol) and 22
(15 mg, 0.64 mmol) were added to a solution of 2-naphthyl chloroformate (21 mg, 0.1 mmol) in
CH2Cl2 (3 mL) at 0 °C. The reaction was allowed to warm to room temperature and stir for 16h.
Upon completion the reaction mixture was filtered through an Isolute® SCX-2 column. The
collected solvent was removed under reduced pressure. The resulting residue was
chromatographed on silica gel to yield 49 (26mg, 100%) as a colorless oil. 1H NMR (500 MHz,
CHLOROFORM-d) δ 7.91 - 7.98 (m, 1H), 7.82 - 7.88 (m, 1H), 7.71 (d, J = 8.3 Hz, 1H), 7.38 -
7.52 (m, 4H), 7.25 - 7.33 (m, 2H), 7.18 (m, Hz, 3H), 5.22 (br. s., 1H), 3.24 - 3.38 (m, 2H), 2.60
(t, J = 7.8 Hz, 2H), 1.61 (quin, J = 7.3 Hz, 4H), 1.27 - 1.41 (m, 12H).
NH
O
OF
![Page 213: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/213.jpg)
213
4-fluorophenyl 10-phenyldecylcarbamate, 50, AM9062. Synthesized following the procedure
for 49, (24mg, 100%) white solid. mp = 65-66 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ
7.24 - 7.30 (m, 3H), 7.16 - 7.19 (m, 2H), 7.05 - 7.10 (m, 2H), 6.99 - 7.05 (m, 2H), 4.94 - 5.02 (br.
s., 1H), 3.22 - 3.28 (m, 2H), 2.60 (t, J = 6.8 Hz, 2H), 1.53 - 1.65 (m, 4H), 1.25 - 1.35 (m, 12H).
NH
O
OCl
2-chlorophenyl 10-phenyldecylcarbamate, 51, AM9063. Synthesized following the procedure
for 49, (14 mg, 56%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.39 - 7.47 (m,
2H), 7.22 - 7.30 (m, 3H), 7.12 - 7.21 (m, 4H), 5.11 (br. s., 1H), 3.22 - 3.32 (m, 2H), 2.60 (t, J =
7.3 Hz, 2H), 1.56 - 1.66 (m, 4H), 1.19 - 1.44 (m, 12H).
NH
O
O
CF3
3-(trifluoromethyl)phenyl 10-phenyldecylcarbamate, 52, AM9064. Synthesized following the
procedure for 49, (10 mg, 37%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.43 -
7.49 (m, 2H), 7.41 (s, 1H), 7.30 - 7.35 (m, 1H), 7.26 - 7.30 (m, 2H), 7.15 - 7.19 (m, 3H), 5.05
(br. s., 1H), 3.22 - 3.30 (m, 2H), 2.60 (t, J = 7.3 Hz, 2H), 1.56 - 1.66 (m, 4H), 1.22 - 1.41 (m,
12H).
NH
O
O
NO2
2-nitrophenyl 10-phenyldecylcarbamate, 53, AM9065. Synthesized following the procedure
for 49, (12 mg, 46%) white solid. mp = 33-36 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ
8.04 (dd, J = 1.5, 8.3 Hz, 1H), 7.62 (dt, J = 1.5, 7.8 Hz, 1H), 7.33 - 7.39 (m, 2H), 7.24 - 7.32 (m,
![Page 214: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/214.jpg)
214
3H), 7.12 - 7.21 (m, 2H), 5.19 (br. s., 1H), 3.22 - 3.31 (m, 2H), 2.60 (t, J = 7.8 Hz, 2H), 1.51 -
1.66 (m, 4H), 1.21 - 1.43 (m, 12H).
NH
O
OOMe
4-methoxyphenyl 10-phenyldecylcarbamate, 54, AM9066. Synthesized following the
procedure for 49, (13 mg, 52%) white solid. mp = 68-69 °C. 1H NMR (500 MHz,
CHLOROFORM-d) δ 7.23 - 7.30 (m, 2H), 7.14 - 7.20 (m, 3H), 7.00 - 7.06 (m, 2H), 6.86 (d, J =
9.3 Hz, 2H), 4.95 (br. s., 1H), 3.79 (s, 3H), 3.18 - 3.29 (m, 2H), 2.60 (t, J = 7.3 Hz, 2H), 1.50 -
1.64 (m, 4H), 1.22 - 1.38 (m, 12H).
NH
O
OBr
4-bromophenyl 10-phenyldecylcarbamate, 55, AM9067. Synthesized following the procedure
for 49, (7 mg, 25%) white solid. mp = 73-74 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.41
- 7.48 (m, 2H), 7.26 - 7.30 (m, 2H), 7.12 - 7.21 (m, 3H), 6.97 - 7.05 (m, 2H), 4.99 (br. s., 1H),
3.21 - 3.28 (m, 2H), 2.60 (t, J = 7.8 Hz, 2H), 1.48 - 1.66 (m, 4H), 1.22 - 1.40 (m, 12H).
O
NH
OH
Palmitoylethanolamide, 57: EDCI (673 mg, 3.51 mmol), DMAP (44 mg, 0.35 mmol), and
ethanolamine (0.141 mL, 2.34 mmol) were added to a solution palmitic acid 56 (300 mg, 1.17
mmol) was stirred in 10 mL of anhydrous CH2Cl2 at 0 oC. The reaction was allowed to stir under
argon for 4 hours while warming to room temperature. Upon completion the reaction mixture
was diluted with CH2Cl2, washed with water and brine. The organic layer was collected and
concentrated. The resulting residue was chromatographed on silica to yield 57 (312 mg, 72%) as
![Page 215: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/215.jpg)
215
a white solid. mp is in agreement with literature values.37 1H NMR (500 MHz,
CHLOROFORM-d) δ 3.70 - 3.76 (m, 2H), 3.43 (q, J = 5.3 Hz, 2H), 2.17 - 2.24 (m, 2H), 1.64
(quin, J = 7.5 Hz, 2H), 1.52 (d, J = 1.0 Hz, 1H), 1.19 - 1.35 (m, 26H).
O
NH
N3
N-(2-azidoethyl)palmitamide, 58: Synthesized following the procedure for 37, (36 mg, 66%)
off-white solid. mp 68-69 °C. 1H NMR (500 MHz, CHLOROFORM-d) δ 3.35 - 3.49 (m, 4H),
2.19 (t, J = 7.3 Hz, 2H), 1.63 (quin, J = 7.5 Hz, 2H), 1.19 - 1.37 (m, 24H), 0.88 (t, J = 6.8 Hz,
3H).
O
NH
NCS
N-(2-isothiocyanatoethyl)palmitamide, 59, AM9019: PPh3 (36 mg, 0.14 mmol) and CS2 (10
μL, 0.16 mmol) were added to a solution of 58 (35 mg, 0.11 mmol) in anhydrous THF (5 mL)
under an atmosphere of argon. The reaction was allowed to stir for 48 h. The reaction mixture
was concentrated and the resulting residue was chromatographed on silica gel to yield 59 (25 mg,
68%) as a white solid. mp 72-74 °C.1H NMR (500 MHz, CHLOROFORM-d) δ 5.79 - 5.99 (m,
1H), 3.68 (t, J = 5.4 Hz, 2H), 3.51 (q, J = 5.9 Hz, 2H), 2.22 (t, J = 7.6 Hz, 2H), 1.64 (td, J = 7.5,
14.4 Hz, 2H), 1.22 - 1.39 (m, 24H), 0.88 (t, J = 7.1 Hz, 3H). IR (neat) cm-1 3288, 2917, 2849,
2182, 2094, 1645. HRMS for C19H36N2OS (MH+) 341.2623. Calcd. 341.2627.
NCS
1-isothiocyanatopentadecane, 66, AM9023: Synthesized following the procedure for 20, (55
mg, 94%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 3.51 (t, J = 6.8 Hz, 2H), 1.69
![Page 216: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/216.jpg)
216
(td, J = 6.8, 15.1 Hz, 2H), 1.36 - 1.44 (m, 2H), 1.21 - 1.34 (m, 22H), 0.88 (t, J = 6.8 Hz, 3H). IR
(neat) cm-1 2924, 2854, 2185, 2090. HRMS for C16H30NS (M-H+) 268.2111. Calcd. 268.2099.
NCS
1-isothiocyanatotetradecane, 67, AM9046: Synthesized following the procedure for 20, (72
mg, 98%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 3.51 (t, J = 6.6 Hz, 2H), 1.69
(td, J = 6.8, 15.1 Hz, 2H), 1.36 - 1.45 (m, 2H), 1.22 - 1.35 (m, 20H), 0.88 (t, J = 6.8 Hz, 3H). IR
(neat) cm-1 2922, 2853, 2181, 2086. HRMS for C15H28NS (M-H+) 254.1932. Calcd. 254.1942.
NCS
1-isothiocyanatododecane, 68, AM9045: Synthesized following the procedure for 20, (71 mg,
97%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 3.51 (t, J = 6.6 Hz, 2H), 1.69 (td,
J = 6.8, 15.1 Hz, 2H), 1.37 - 1.44 (m, 2H), 1.22 - 1.35 (m, 16H), 0.88 (t, J = 7.1 Hz, 3H). IR
(neat) cm-1 2923, 2854, 2184, 2086. HRMS for C13H24NS (M-H+) 226.1621. Calcd. 226.1629.
NCS
1-isothiocyanatodecane, 69, AM9042: Synthesized following the procedure for 20, (62 mg,
98%) yellow oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 3.51 (t, J = 6.6 Hz, 2H), 1.69 (tt, J =
6.4, 7.6 Hz, 2H), 1.36 - 1.45 (m, 2H), 1.19 - 1.35 (m, 12H), 0.88 (t, J = 7.0 Hz, 3H). IR (neat)
cm-1 2923, 2854, 2182, 2083. HRMS for C11H20NS (M-H+) 198.1320. Calcd. 198.1316.
NCS
2-isothiocyanatoundecane, 70, AM9043: The procedure for 10a was used to synthesize 10e (56
mg, 90%) as an yellow oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 3.76 (dqd, J = 5.3, 6.6,
8.2 Hz, 1H), 1.59 - 1.68 (m, 1H), 1.51 - 1.59 (m, 1H), 1.35 (d, J = 6.4 Hz, 3H), 1.23 - 1.33 (m,
14H), 0.89 (t, J = 6.7 Hz, 3H). IR (neat) cm-1 2924, 2854, 2184, 2082. HRMS for C12H23NS (M+)
213.1562. Calcd. 213.1551.
![Page 217: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/217.jpg)
217
SO
NCS
DL-sulforane, 71, AM9044: Purchased from Sigma Aldrich.
N3
(4-azidobutyl)benzene, 75: Synthesized following the procedure for 37, (42 mg, 53%) pale
yellow oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.27 - 7.32 (m, 2H), 7.13 - 7.23 (m, 3H),
3.29 (t, J = 6.8 Hz, 2H), 2.65 (t, J = 7.6 Hz, 2H), 1.68 - 1.76 (m, 2H), 1.60 - 1.67 (m, 2H).
N3
(5-azidopentyl)benzene, 76: Synthesized following the procedure for 37, (109 mg, 92%) pale
yellow oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.26 - 7.31 (m, 2H), 7.14 - 7.22 (m, 3H),
3.26 (t, J = 6.8 Hz, 2H), 2.62 (t, J = 7.6 Hz, 2H), 1.57 - 1.70 (m, 4H), 1.37 - 1.46 (m, 2H).
N3
(6-azidohexyl)benzene, 77: Synthesized following the procedure for 37, (99 mg, 91%) pale
yellow oil. 1H NMR (500 MHz, CHLOROFORM-d) d 7.26 - 7.31 (m, 2H), 7.14 - 7.22 (m, 3H),
3.25 (t, J = 6.8 Hz, 2H), 2.61 (t, J = 7.6 Hz, 2H), 1.56 - 1.68 (m, 4H), 1.32 - 1.45 (m, 4H).
N3
(8-azidooctyl)benzene, 78: Synthesized following the procedure for 37, (136 mg, 81%) pale
yellow oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.24 - 7.31 (m, 2H), 7.13 - 7.21 (m, 3H),
3.25 (t, J = 7.1 Hz, 2H), 2.55 - 2.64 (m, 2H), 1.55 - 1.67 (m, 4H), 1.26 - 1.41 (m, 8H).
NCS
![Page 218: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/218.jpg)
218
(4-isothiocyanatobutyl)benzene, 79, AM9038: Synthesized following the procedure for 59, (41
mg, 90%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.27 - 7.32 (m, 2H), 7.14 -
7.23 (m, 3H), 3.52 (t, J = 6.4 Hz, 2H), 2.66 (t, J = 7.1 Hz, 2H), 1.67 - 1.81 (m, 4H). IR (neat) cm-
1 3026, 2926, 2859, 2183, 2089. HRMS for C11H13NS (M+) 191.0760. Calcd. 191.0769.
NCS
(5-isothiocyanatopentyl)benzene, 80, AM9037: Synthesized following the procedure for 59,
(116 mg, 90%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.25 - 7.29 (m, 2H),
7.15 - 7.22 (m, 3H), 3.50 (t, J = 6.6 Hz, 2H), 2.63 (t, J = 7.3 Hz, 2H), 1.72 (td, J = 6.8, 15.1 Hz,
2H), 1.66 (td, J = 7.6, 15.5 Hz, 2H), 1.42 - 1.50 (m, 2H). IR (neat) cm-1 3026, 2935, 2857, 2183,
2086. HRMS for C12H15NS (M+) 205.0938. Calcd. 205.0925.
NCS
(6-isothiocyanatohexyl)benzene, 81, AM9036: Synthesized following the procedure for 59, (72
mg, 69%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.26 - 7.29 (m, 2H), 7.14 -
7.21 (m, 3H), 3.50 (t, J = 6.6 Hz, 2H), 2.62 (t, J = 7.8 Hz, 2H), 1.60 - 1.73 (m, 4H), 1.40 - 1.48
(m, 2H), 1.32 - 1.40 (m, 2H). IR (neat) cm-1 3026, 2931, 2856, 2183, 2092. HRMS for C13H17NS
(M+) 219.1073. Calcd. 219.1082.
NCS
(8-isothiocyanatooctyl)benzene, 82, AM9047: Synthesized following the procedure for 59, (46
mg, 95%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.26 - 7.30 (m, 2H), 7.13 -
7.21 (m, 3H), 3.50 (t, J = 6.8 Hz, 2H), 2.60 (t, J = 6.8 Hz, 2H), 1.58 - 1.72 (m, 4H), 1.37 - 1.44
![Page 219: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/219.jpg)
219
(m, 2H), 1.28 - 1.37 (m, 6H). IR (neat) cm-1 3026, 2927, 2955, 2179, 2090. HRMS for C15H21NS
(M+) 247.1387. Calcd. 247.1395.
NCS
(10-isothiocyanatodecyl)benzene, 83, AM9053: Synthesized following the procedure for 59,
(74 mg, 73%) colorless oil. 1H NMR (500 MHz, CHLOROFORM-d) δ 7.24 - 7.31 (m, 2H), 7.14
- 7.21 (m, 3H), 3.50 (t, J = 6.6 Hz, 2H), 2.60 (t, J = 7.3 Hz, 2H), 1.65 - 1.72 (m, 2H), 1.61 (quin,
J = 7.5 Hz, 2H), 1.36 - 1.44 (m, 2H), 1.24 - 1.35 (m, 10H). IR (neat) cm-1 3026, 2924, 2854,
2178, 2088. HRMS for C17H25NS (M+) 275.1715. Calcd. 275.1708.
O
O
Methyl 7-(naphthalen-2-yl)hept-6-ynoate, 85: A mixture of 2-bromonaphthalene 84 (400 mg,
1.93 mmol), methyl 6-heptynoate (0.282 mL, 1.93 mmol), triethylamine (0.080 mL, 0.57 mmol),
CuI (43 mg, 0.23 mmol), and bis(triphenylphosphine)palladium(II)dichloride (84 mg, 0.12
mmol) in anhydrous DMF (3 mL) were irradiated in a microwave for 20 min at 100 °C. Upon
completion the reaction was diluted with ether and washed with water, brine and dried over
MgSO4. The organic layer was evaporated off under reduced pressure and the resulting residue
was chromatographed on silica to yield 85, (172 mg, 32%) as a colorless oil. 1H NMR (500
MHz, CHLOROFORM-d) δ 7.90 (s, 1H), 7.72 - 7.83 (m, 3H), 7.42 - 7.51 (m, 3H), 3.69 (s, 3H),
2.49 (t, J = 6.8 Hz, 2H), 2.40 (t, J = 7.3 Hz, 2H), 1.85 (quin, J = 7.8 Hz, 2H), 1.69 (quin, J = 7.3
Hz, 2H).
![Page 220: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/220.jpg)
220
O
O
Methyl 7-(naphthalene-2-yl)heptanoate, 86: Pd/C (16 mg, 0.015 mmol) was added to a
solution of 85 (172 mg, 0.60 mmol) in ethyl acetate (10 mL). The solution was placed under
vacuum and flushed with H2 (3x). Upon completion (monitored by TLC) the reaction was
filtered through celite, and the solvent was evaporated off under reduced pressure. The resulting
residue was chromatographed on silica gel to yield 86 (168 mg, 98%) as a colorless oil. 1H NMR
(400 MHz, CHLOROFORM-d) δ 7.73 - 7.83 (m, 3H), 7.60 (s, 1H), 7.37 - 7.48 (m, 2H), 7.32
(dd, J = 1.8, 8.4 Hz, 1H), 3.66 (s, 3H), 2.76 (t, J = 7.3 Hz, 2H), 2.30 (t, J = 7.7 Hz, 2H), 1.67 -
1.75 (m, 2H), 1.58 - 1.66 (m, 2H), 1.31 - 1.43 (m, 4H).
OH
7-(naphthalene-2-yl)heptan-1-ol, 87: A 1.0M solution of LiAlH4 in THF (1.24 mL, 1.24 mmol)
was added a solution of 86 (168 mg, 0.62 mmol) in anhydrous THF (5 mL) at 0 oC. The reaction
mixture was stirred under argon and slowly warmed to room temperature where it stirred for an
additional hour. Once the reaction was complete a 1.0M HCl solution was added drop wise until
the reaction mixture was slightly acidic. The lipophilic products were extracted with Et2O, and
the aqueous layer was washed with Et2O three additional times. The combined layers were dried
with MgSO4 and concentrated to give 87 (130 mg, 87%) as a yellowish wax. 1H NMR (400
MHz, CHLOROFORM-d) δ 7.73 - 7.83 (m, 3H), 7.61 (s, 1H), 7.37 - 7.48 (m, 2H), 7.29 - 7.35
(m, 1H), 3.59 - 3.68 (m, 2H), 2.77 (t, J = 7.3 Hz, 2H), 1.66 - 1.76 (m, 2H), 1.52 - 1.61 (m, 2H),
1.31 - 1.42 (m, 6H).
N3
![Page 221: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/221.jpg)
221
2-(7-azidoheptyl)naphthalene, 88: Synthesized following the procedure for 37, (118 mg, 82%)
pale yellow oil. 1H NMR (400 MHz, CHLOROFORM-d) δ 7.73 - 7.84 (m, 3H), 7.61 (s, 1H),
7.38 - 7.49 (m, 2H), 7.33 (d, J = 8.1 Hz, 1H), 3.25 (t, J = 7.0 Hz, 2H), 2.77 (t, J = 7.7 Hz, 2H),
1.66 - 1.77 (m, 2H), 1.57 - 1.64 (m, 2H), 1.37 (br. s., 6H).
NCS
2-(7isothiocyanatoheptyl)naphthalene, 89, AM9060: Synthesized following the procedure for
59, (41 mg, 77%) yellow oil.1H NMR (500 MHz, CHLOROFORM-d) δ 7.72 - 7.82 (m, 4H),
7.60 (s, 1H), 7.37 - 7.48 (m, 3H), 7.32 (dd, J = 1.5, 8.3 Hz, 1H), 3.47 (t, J = 6.8 Hz, 2H), 2.77 (t,
J = 7.6 Hz, 2H), 1.62 - 1.75 (m, 4H), 1.31 - 1.43 (m, 6H). IR (neat) cm-1 3053, 2929, 2856, 2093.
HRMS for C18H21NS (MH+) 284.1478. Calcd. 284.1473.
O
NH
OH
N-(2-hydroxyethyl)-7-(naphthalen-2-yl)heptanamide, 91: EDCI (357 mg, 1.86 mmol), DMAP
(15 mg, 0.12 mmol), and ethanolamine (53 μL, 0.87 mmol) were added to a solution 7-
(naphthalen-2-yl)heptanoic acid 90 (159 mg, 0.62 mmol) stirred in anhydrous CH2Cl2 (10 mL)
at 0 oC. The reaction was allowed to stir under argon for 4 hours while warming to room
temperature. Upon completion the reaction mixture was diluted with CH2Cl2, washed with water
and brine. The organic layer was collected and concentrated. The resulting oil was
chromatographed on silica gel to yield 91 (93 mg, 50%) as a white solid. 1H NMR (500 MHz,
CHLOROFORM-d) δ 7.73 - 7.82 (m, 3H), 7.60 (s, 1H), 7.38 - 7.48 (m, 2H), 7.32 (dd, J = 1.5,
8.3 Hz, 1H), 5.88 (br. s., 1H), 3.70 (t, J = 5.4 Hz, 2H), 3.40 (q, J = 5.4 Hz, 2H), 2.77 (t, J = 7.8
Hz, 2H), 2.15 - 2.21 (m, 2H), 1.68 - 1.75 (m, 2H), 1.60 - 1.68 (m, 1H), 1.32 - 1.43 (m, 4H).
![Page 222: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/222.jpg)
222
O
HN
NCS
N-(2-isothiocyanatoethyl)-7-(naphthalene-2-yl)heptanamide, 93, AM9071: Synthesized
following the procedures for 58 and 59, (22 mg, 34%) white solid. mp 67-70 °C. 1H NMR (500
MHz, CHLOROFORM-d) δ 7.89 - 7.92 (m, 1H), 7.71 - 7.82 (m, 4H), 7.41 - 7.50 (m, 2H), 3.68
(t, J = 5.4 Hz, 2H), 3.52 (q, J = 5.9 Hz, 2H), 2.51 (t, J = 6.8 Hz, 2H), 2.32 (t, J = 7.8 Hz, 2H),
1.88 (quin, J = 7.8 Hz, 3H), 1.67 - 1.77 (m, 4H), 1.48 - 1.55 (m, 2H). IR (neat) cm-1 3303, 3058,
2930, 2856, 2198, 2110, 1652. HRMS for C20H24N2OS (M+) 340.1584. Calcd. 340.1609.
NNCS
4-(4-isothiocyanatobenzyl)pyridine, 102, AM10318: Synthesized following the procedure for
20, (31 mg, 86%) orange solid. MP = 53-54 °C. 1H NMR (399 MHz, CHLOROFORM-d) δ 8.50
- 8.53 (m, 2H), 7.13 - 7.20 (m, 4H), 7.05 - 7.09 (m, 2H), 3.96 (s, 2H). IR (neat) cm-1 3067, 3027,
2932, 2174, 2088, 1597. HRMS for C13H10N2S (MH+) 227.0637. Calcd. 227.0643.
NCSN
N
1-isothiocyanato-2-(4-benzylpiperazino)ethane, 103, AM10323: Synthesized following the
procedure for 20, (32 mg, 90%) yellow oil. 1H NMR (399 MHz, CHLOROFORM-d) δ 7.28 -
7.37 (m, 4H), 7.21 - 7.28 (m, 1H), 3.58 (t, J = 6.2 Hz, 2H), 3.51 (s, 2H), 2.67 (t, J = 6.6 Hz, 2H),
2.45 - 2.57 (m, 8H). IR (neat) cm-1 3027, 2939, 2810, 2190, 2097. HRMS for C14H19N3S (MH+)
262.1371. Calcd. 262.1378.
NCS
ON
![Page 223: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/223.jpg)
223
4-(4-(isothiocyanatomethyl)phenyl)morpholine, 104, AM10324: Synthesized following the
procedure for 20, (5.4 mg, 90%) colorless oil. 1H NMR (399 MHz, CHLOROFORM-d) δ 7.19 -
7.28 (m, 2H), 6.88 - 6.96 (m, 2H), 4.62 (s, 2H), 3.83 - 3.90 (m, 4H), 3.13 - 3.24 (m, 4H). IR
(neat) cm-1 3031, 2957, 2856, 2172, 2090, 1724. HRMS for C12H14N2OS (MH+) 235.0902.
Calcd. 235.0905.
NCSN
4-benzyl-1-(2-isothiocyanatoethyl)piperidine, 105, AM10325: Synthesized following the
procedure for 20, (5.2 mg, 87%) colorless oil. 1H NMR (399 MHz, CHLOROFORM-d) δ 7.24 -
7.32 (m, 2H), 7.16 - 7.22 (m, 1H), 7.14 (d, J = 7.3 Hz, 2H), 3.57 (t, J = 6.2 Hz, 2H), 2.85 (d, J =
11.7 Hz, 2H), 2.64 (t, J = 6.6 Hz, 2H), 2.53 (d, J = 6.6 Hz, 2H), 2.03 (dt, J = 2.6, 11.5 Hz, 2H),
1.59 - 1.71 (m, 2H), 1.47 - 1.56 (m, 1H), 1.23 - 1.37 (m, 2H). IR (neat) cm-1 3026, 2928, 2804,
2190, 2101. HRMS for C15H20N2S (MH+) 261.1414. Calcd. 261.1425.
NCSON
4-(morpholinomethyl)benzylisothiocyanate, 106, AM10326: Synthesized following the
procedure for 20, (5.7 mg, 95%) colorless oil. 1H NMR (399 MHz, CHLOROFORM-d) δ 7.37
(s, 2H), 7.23 - 7.29 (m, 2H), 4.70 (s, 2H), 3.67 - 3.76 (m, 4H), 3.50 (s, 2H), 2.45 (d, J = 4.4 Hz,
4H). IR (neat) cm-1 3030, 2961, 2854, 2162, 2084, 1612. HRMS for C13H16N2OS (MH+)
249.1052. Calcd. 249.1062.
N
O
ONCS
Benzyl 4-(isothiocyanatomethyl)tetrahydro-1(2H)-pyridinecarboxylate, 107, AM10327:
Synthesized following the procedure for 20, (5.0 mg, 86%) colorless oil. 1H NMR (500 MHz,
![Page 224: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/224.jpg)
224
CHLOROFORM-d) δ 7.30 - 7.39 (m, 5H), 5.13 (s, 2H), 4.14 - 4.41 (m, 2H), 3.42 (d, J = 6.4 Hz,
2H), 2.79 (br. s., 2H), 1.80 - 1.92 (m, 1H), 1.76 (d, J = 13.2 Hz, 2H), 1.16 - 1.33 (m, 2H). IR
(neat) cm-1 3027, 2934, 2855, 2187, 2097, 1697. HRMS for C15H18N2O2S (MH+) 291.1175.
Calcd. 291.1167.
NCS
ON
N
2-(4-(isothiocyanatomethyl)phenoxy)-6-methylpyrazine, 108, AM10328: Synthesized
following the procedure for 20, (5.3 mg, 90%) colorless oil. 1H NMR (399 MHz,
CHLOROFORM-d) δ 8.18 (s, 2H), 7.36 (d, J = 8.8 Hz, 2H), 7.12 - 7.23 (m, 2H), 4.74 (s, 2H),
2.43 (s, 4H). IR (neat) cm-1 3048, 2926, 2852, 2172, 2090. HRMS for C13H11N3OS (MH+)
258.0697. Calcd. 258.0701.
NCSO
1-(isothiocyanatomethyl)-4-(phenoxymethyl)benzene, 19, AM10329: Synthesized following
the procedure for 20, (5.0 mg, 86%) colorless oil. 1H NMR (399 MHz, CHLOROFORM-d) δ
8.18 (s, 2H), 7.36 (d, J = 8.8 Hz, 2H), 7.12 - 7.23 (m, 2H), 4.74 (s, 2H), 2.43 (s, 4H). IR (neat)
cm-1 3058, 3032, 2925, 2856, 2172, 2091, 1723, 1598. HRMS for C15H13NOS (MH+) 255.0728.
Calcd. 255.0718.
MALDI-TOF MS analysis of hNAAA inhibition by AM9053
Ligand-assisted protein structure (LAPS) type analysis was used to determine if AM9053
covalently modified NAAA.38 This approach consists of incubating the purified enzyme alone
and with AM9053, evaluating extent of inactivation, performing a tryptic digest, comparing the
![Page 225: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/225.jpg)
225
peptide profile fingerprints using MALDI-TOF MS, and then assigning the site and nature of any
covalent modification by MS/MS analysis.
Fluorometric assay to determine hNAAA inhibition using N-(4-methyl
coumarin)palmitamide (PAMCA) substrate. We previously described the fluorogenic
substrate N-(4-methyl coumarin)palmitamide (PAMCA), which is hydrolyzed by NAAA to the
fluorescent compound 7-amino-4-methyl coumarin (AMC) and palmitic acid.39 For hNAAA
inhibition we conducted three point concentration assays with compounds to determine their
potencies and ranges of enzyme inhibition. Purified activated NAAA (final concentration of 0.25
µg/mL) was incubated in assay buffer39 made up to a total volume of 180 µL, followed by
addition of the compound dissolved in 10 µL DMSO (along with DMSO neat for the control
sample) with the final concentrations for each compound of 1, 10, and 100 µM, in triplicate on a
96 well plate. These samples were allowed to incubate for 15 min at room temperature and then
10 µL of a PAMCA stock solution in DMSO (final PAMCA concentration 10 µM) was added.
After 5 minutes of agitation on a shaking plate, the reaction was allowed to proceed at 37 °C for
30 minutes and enzyme activity was monitored and calculated as previously described.39
For compounds that inhibited hNAAA in the range of IC50 < 1 µM full inhibition curves
using eight different concentrations of inhibitor (8 point assay) were generated. To set up 8 point
fluorescent assay for each point, the compound in 45 µL DMSO and purified activated NAAA
(final enzyme concentration of 0.25 µg/mL) in 810 µL of NAAA assay buffer were incubated for
3 hours in order for the covalent compounds to reach full inhibition. For the fluorescent assay,
190 µL of each of the above samples (in triplicate) were transferred to a 96 well plate, followed
by addition of 10 µL of a PAMCA stock solution in DMSO for a final PAMCA concentration of
10 µM. After 5 minutes of agitation on a shaking plate, the reaction was allowed to proceed at
![Page 226: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/226.jpg)
226
37 °C for 30 minutes and enzyme activity was monitored and calculated as previously
described.39
Trypsin digestion of hNAAA treated with inhibitors. To 10 µg (0.2 nmol) of purified and
activated NAAA in 18 µL of 100 mM citrate-sodium phosphate buffer (pH 4.5) 2 µL of a
DMSO solution containing 2 nmol of the compound of interest were added or 2 µL DMSO. The
inhibitor and DMSO treated enzyme solutions were incubated at 37 °C for 2 hours and then
desalted prior to digestion. These were desalted by re-concentrating 3 times to original volume
after 25 fold dilution with 50 mM ammonium bicarbonate buffer, pH 8.0, using 10 kDa
membrane Ultra-0.5 Centrifugal Filters (Millipore). The NAAA samples were incubated
overnight at 37 °C with MS-grade trypsin (“Trypsin Gold”, Promega) at a NAAA:trypsin mass
to mass ratio of 100:1. The tryptic digested NAAA was analyzed immediately or frozen at -80
°C for future analysis.
MALDI-TOF-MS Analysis. 0.5 µL of the trypsin digested NAAA was mixed with 0.5 µL α-
cyano-4-hydroxycinnaminic acid matrix solution (5 mg/mL dissolved in 50% acetonitrile, 50%
water, and 0.1% trifluoroacetic acid) and spotted onto an Opti-TOF 384-well plate insert.
MALDI-TOF MS spectra were acquired on a 4800 MALDI TOF/TOF mass spectrometer
(Applied Biosystems, Foster City, CA) fitted with a 200-Hz solid state UV laser (wavelength 355
nm). The spectra of the peptides were acquired in reflectron mode. The conditions used for the
MS experiments and instrument calibration were performed as described by Zvonok et. al.40
![Page 227: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/227.jpg)
227
5.6 References
1. Coulon, D.; Faure, L.; Salmon, M.; Wattelet, V.; Bessoule, J.-J. N-Acylethanolamines and related compounds: Aspects of metabolism and functions. Plant Science 2012, 184, 129-140. 2. Kobilka, B. K. G protein coupled receptor structure and activation. Biochimica et Biophysica Acta (BBA) - Biomembranes 2007, 1768, 794-807. 3. Smita, K.; Kumar, V. S.; Premendran, J. S. Anandamide: an update. Fundamental & clinical Pharmacology 2007, 1-8. 4. Lo Verme, J.; Fu, J.; Astarita, G.; La Rana, G.; Russo, R.; Calignano, A.; Piomelli, D. The Nuclear Receptor Peroxisome Proliferator-Activated Receptor-α Mediates the Anti-Inflammatory Actions of Palmitoylethanolamide. Molecular Pharmacology 2005, 67, 15-19. 5. Dhake, K. P.; Qureshi, Z. S.; Singhal, R. S.; Bhanage, B. M. Candida antarctica lipase B-catalyzed synthesis of acetamides using [BMIm(PF6)] as a reaction medium. Tetrahedron Letters 2009, 50, 2811-2814. 6. Han, C.; Lee, J. P.; Lobkovsky, E.; Porco, J. A. Catalytic Ester−Amide Exchange Using Group (IV) Metal Alkoxide−Activator Complexes. Journal of the American Chemical Society 2005, 127, 10039-10044. 7. Godlewski, G.; Offertáler, L.; Wagner, J. A.; Kunos, G. Receptors for acylethanolamides—GPR55 and GPR119. Prostaglandins & Other Lipid Mediators 2009, 89, 105-111. 8. LoVerme, J.; La Rana, G.; Russo, R.; Calignano, A.; Piomelli, D. The search for the palmitoylethanolamide receptor. Life Sciences 2005, 77, 1685-98. 9. Lambert, D. M.; Vandevoorde, S.; Jonsson, K.-O.; Fowler, C. J. The Palmitoylethanolamide Family: A New Class of Anti-Inflammatory Agents? Current Medicinal Chemistry 2002, 9, 663-674. 10. Clement, A. B.; Hawkins, E. G.; Lichtman, A. H.; Cravatt, B. F. Increased seizure susceptibility and proconvulsant activity of anandamide in mice lacking fatty acid amide hydrolase. J Neurosci 2003, 23, 3916-23. 11. Cravatt, B. F.; Demarest, K.; Patricelli, M. P.; Bracey, M. H.; Giang, D. K.; Martin, B. R.; Lichtman, A. H. Supersensitivity to anandamide and enhanced endogenous cannabinoid signaling in mice lacking fatty acid amide hydrolase. Proceedings of the National Academy of Sciences of the United States of America 2001, 98, 9371-9376. 12. Lichtman, A. H.; Hawkins, E. G.; Griffin, G.; Cravatt, B. F. Pharmacological activity of fatty acid amides is regulated, but not mediated, by fatty acid amide hydrolase in vivo. J Pharmacol Exp Ther 2002, 302, 73-9. 13. Lichtman, A. H.; Leung, D.; Shelton, C. C.; Saghatelian, A.; Hardouin, C.; Boger, D. L.; Cravatt, B. F. Reversible inhibitors of fatty acid amide hydrolase that promote analgesia: evidence for an unprecedented combination of potency and selectivity. J Pharmacol Exp Ther 2004, 311, 441-8. 14. Fegley, D.; Gaetani, S.; Duranti, A.; Tontini, A.; Mor, M.; Tarzia, G.; Piomelli, D. Characterization of the fatty acid amide hydrolase inhibitor cyclohexyl carbamic acid 3'-carbamoyl-biphenyl-3-yl ester (URB597): effects on anandamide and oleoylethanolamide deactivation. J Pharmacol Exp Ther 2005, 313, 352-8. 15. Sun, Y. X.; Tsuboi, K.; Zhao, L. Y.; Okamoto, Y.; Lambert, D. M.; Ueda, N. Involvement of N-acylethanolamine-hydrolyzing acid amidase in the degradation of anandamide
![Page 228: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/228.jpg)
228
and other N-acylethanolamines in macrophages. Biochimica Et Biophysica Acta 2005, 1736, 211-20. 16. Tsuboi, K.; Sun, Y. X.; Okamoto, Y.; Araki, N.; Tonai, T.; Ueda, N. Molecular characterization of N-acylethanolamine-hydrolyzing acid amidase, a novel member of the choloylglycine hydrolase family with structural and functional similarity to acid ceramidase. Journal of Biological Chemistry 2005, 280, 11082-11092. 17. Ueda, N.; Yamanaka, K.; Yamamoto, S. Purification and characterization of an acid amidase selective for N-palmitoylethanolamine, a putative endogenous anti-inflammatory substance. J. Biol. Chem. 2001, 276, 35552-35557. 18. Wang, J.; Zhao, L. Y.; Uyama, T.; Tsuboi, K.; Wu, X. X.; Kakehi, Y.; Ueda, N. Expression and secretion of N-acylethanolamine-hydrolysing acid amidase in human prostate cancer cells. J Biochem 2008, 144, 685-90. 19. Ueda, N.; Yamanaka, K.; Yamamoto, S. Purification and Characterization of an Acid Amidase Selective for N-Palmitoylethanolamine, a Putative Endogenous Anti-inflammatory Substance. Journal of Biological Chemistry 2001, 276, 35552-35557. 20. Tai, T.; Tsuboi, K.; Uyama, T.; Masuda, K.; Cravatt, B. F.; Houchi, H.; Ueda, N. Endogenous Molecules Stimulating N-Acylethanolamine-Hydrolyzing Acid Amidase (NAAA). ACS Chem Neurosci 2012, 3, 379-85. 21. Tsuboi, K.; Sun, Y.-X.; Okamoto, Y.; Araki, N.; Tonai, T.; Ueda, N. Molecular Characterization of N-Acylethanolamine-hydrolyzing Acid Amidase, a Novel Member of the Choloylglycine Hydrolase Family with Structural and Functional Similarity to Acid Ceramidase. Journal of Biological Chemistry 2005, 280, 11082-11092. 22. Zhao, L.-Y.; Tsuboi, K.; Okamoto, Y.; Nagahata, S.; Ueda, N. Proteolytic activation and glycosylation of N-acylethanolamine-hydrolyzing acid amidase, a lysosomal enzyme involved in the endocannabinoid metabolism. Biochimica et Biophysica Acta (BBA) - Molecular and Cell Biology of Lipids 2007, 1771, 1397-1405. 23. Ueda, N.; Tsuboi, K.; Uyama, T. N-acylethanolamine metabolism with special reference to N-acylethanolamine-hydrolyzing acid amidase (NAAA). Progress in Lipid Research 2010, 49, 299-315. 24. Wei, B. Q. Q.; Mikkelsen, T. S.; McKinney, M. K.; Lander, E. S.; Cravatt, B. F. A second fatty acid amide hydrolase with variable distribution among placental mammals. Journal of Biological Chemistry 2006, 281, 36569-36578. 25. Vandevoorde, S.; Tsuboi, K.; Ueda, N.; Jonsson, K.-O.; Fowler, C. J.; Lambert, D. M. Esters, Retroesters, and a Retroamide of Palmitic Acid: Pool for the First Selective Inhibitors of N-Palmitoylethanolamine-Selective Acid Amidase. Journal of Medicinal Chemistry 2003, 46, 4373-4376. 26. Saturnino, C.; Petrosino, S.; Ligresti, A.; Palladino, C.; Martino, G. D.; Bisogno, T.; Marzo, V. D. Synthesis and biological evaluation of new potential inhibitors of N-acylethanolamine hydrolyzing acid amidase. Bioorganic & Medicinal Chemistry Letters 2010, 20, 1210-1213. 27. Solorzano, C.; Zhu, C.; Battista, N.; Astarita, G.; Lodola, A.; Rivara, S.; Mor, M.; Russo, R.; Maccarrone, M.; Antonietti, F.; Duranti, A.; Tontini, A.; Cuzzocrea, S.; Tarzia, G.; Piomelli, D. Selective N-acylethanolamine-hydrolyzing acid amidase inhibition reveals a key role for endogenous palmitoylethanolamide in inflammation. Proceedings of the National Academy of Sciences 2009, 106, 20966-20971.
![Page 229: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/229.jpg)
229
28. Solorzano, C.; Antonietti, F.; Duranti, A.; Tontini, A.; Rivara, S.; Lodola, A.; Vacondio, F.; Tarzia, G.; Piomelli, D.; Mor, M. Synthesis and Structure−Activity Relationships of N-(2-Oxo-3-oxetanyl)amides as N-Acylethanolamine-hydrolyzing Acid Amidase Inhibitors. Journal of Medicinal Chemistry 2010, 53, 5770-5781. 29. Svíženská, I.; Dubový, P.; Šulcová, A. Cannabinoid receptors 1 and 2 (CB1 and CB2), their distribution, ligands and functional involvement in nervous system structures — A short review. Pharmacology Biochemistry and Behavior 2008, 90, 501-511. 30. Lin, S.; Khanolkar, A. D.; Fen, P.; Goutopoulos, A.; Qin, C.; Papahadjis, D.; Makriyannis, A. Novel Analogues of Arachidonylethanolamide (Anandamide): Affinities for the CB1 and CB2 Cannabinoid Receptors and Metabolic Stability. Journal of Medicinal Chemistry 1998, 41, 5353-5361. 31. Guo, Y.; Abadji, V.; Morse, K. L.; Fournier, D. J.; Li, X.; Makriyannis, A. (-)-1 l-Hydroxy-7’-isothiocyanato-l1’’-,dimethylheptyl-A8-THC:A Novel,High-Affinity Irreversible Probe for the Cannabinoid Receptor in the Brain. Journal of Medicinal Chemistry 1994, 37, 3867-3870. 32. Li, C.; Xu, W.; Vadivel, S. K.; Fan, P.; Makriyannis, A. High Affinity Electrophilic and Photoactivatable Covalent Endocannabinoid Probes for the CB1 receptor. Journal of Medicinal Chemistry 2005, 48, 6423-6429. 33. Picone, R. P.; Khanolkar, A. D.; Xu, W.; Ayotte, L. A.; Thakur, G. A.; Hurst, D. P.; Abood, M. E.; Reggio, P. H.; Fournier, D. J.; Makriyannis, A. (-)-7′-Isothiocyanato-11-hydroxy-1′,1′-dimethylheptylhexahydrocannabinol (AM841), a High-Affinity Electrophilic Ligand, Interacts Covalently with a Cysteine in Helix Six and Activates the CB1 Cannabinoid Receptor. Molecular Pharmacology 2005, 68, 1623-1635. 34. West, J. M.; Zvonok, N.; Whitten, K. M.; Wood, J. T.; Makriyannis, A. Mass Spectrometric Characterization of Human N-Acylethanolamine-hydrolyzing Acid Amidase. Journal of Proteome Research 2011, 11, 972-981. 35. West, J. M.; Zvonok, N.; Whitten, K. M.; Vadivel, S. K.; Bowman, A. L.; Makriyannis, A. Biochemical and Mass Spectrometric Characterization of Human N-Acylethanolamine-Hydrolyzing Acid Amidase Inhibition. PLoS One 2012, 7, e43877. 36. Morse, K. L.; Fournier, D. J.; Li, X.; Grzybowska, J.; Makriyannis, A. A novel electrophilic high affinity irreversible probe for the cannabinoid receptor. Life Sciences 1995, 56, 1957-1962. 37. Long, J. Z.; Nomura, D. K.; Vann, R. E.; Walentiny, D. M.; Booker, L.; Jin, X.; Burston, J. J.; Sim-Selley, L. J.; Lichtman, A. H.; Wiley, J. L.; Cravatt, B. F. Dual blockade of FAAH and MAGL identifies behavioral processes regulated by endocannabinoid crosstalk in vivo. Proceedings of the National Academy of Sciences 2009, 106, 20270–20275. 38. Yang, X.; Birman, V. B. In 1,2,4-Triazolide anion: An active nucleophilic catalyst for ester aminolysis, 2009; American Chemical Society: 2009; pp ORGN-187. 39. West, J. M.; Zvonok, N.; Whitten, K. M.; Wood, J. T.; Makriyannis, A. Mass Spectrometric Characterization of Human N-Acylethanolamine-hydrolyzing Acid Amidase. Journal of Proteome Research 2011, 11, 972-981. 40. Zvonok, N.; Williams, J.; Johnston, M.; Pandarinathan, L.; Janero, D. R.; Li, J.; Krishnan, S. C.; Makriyannis, A. Full Mass Spectrometric Characterization of Human Monoacylglycerol Lipase Generated by Large-Scale Expression and Single-Step Purification. Journal of Proteome Research 2008, 7, 2158-2164.
![Page 230: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/230.jpg)
230
CHAPTER 6
FUTURE DIRECTIONS
![Page 231: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/231.jpg)
231
6.1 Novel Endocannabinoid Probes
In Chapter 2, AM9017 was identified as one of the first anandamide based probes with
acceptable hCB2 affinity to conduct LAPS studies. So far, covalent assays of AM9017 have only
been performed on the WT and mutant (C6.47S) on the hCB2. To confirm that C6.47 is the only
amino acid residue of the receptor interacting with AM9017, covalent studies need to be
conducted on mutants of the other cysteine residues. If AM9017 only interacts at TMH6, the
assays should exhibit no loss in covalent binding on all other hCB2 cysteine to serine mutant cell
lines.
While AM9017 was the best covalent probe utilizing the isothiocyanate moiety, we have
also identified AM9069 as a metabolically stable anandamide based probe which also exhibited a
high affinity for the hCB2 receptor. This ligand is a very interesting for covalent studies as it is
one of the best azide based probes and is metabolically resistant to hydrolysis from FAAH. To
expand on these metabolically stable compounds, analogs of AM9069 with an overall length of
19 and 18 carbons could be synthesized (AM9069 has 20 carbons). This may further increase
the covalent binding properties of this type of compound.
Other future research regarding these probes could utilize the terminal alkyne at the head
position for “click” chemistry.1,2 Once the ligand has covalently attached to the receptor an
attempt can be made to fish out the ligand-receptor complex through click chemistry to some
type of linker that is attached to a support. This could aid in the purification and isolation of the
cannabinoid receptors towards an ultimate goal of crystallization.
It would also be interesting to observe the prolonged effect associated with administering
covalent ligands in vivo. Specifically noting the duration of action of a covalent probe compared
to other metabolically stable anandamide analogs.
![Page 232: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/232.jpg)
232
6.2 Chemoenzymatic Methods
While the use of enzymes for chemical transformations is not new, much research can be
applied to chemoenzymatic methods in organic media. Future experiments could focus on
efficient oxidation of the terminal olefin of arachidonic acid or arachidonic acid methyl ester.
This oxidation followed by cleavage could produce a homoallylic triene alcohol that is a
common precursor for tail modified analogs synthesized through the Wittig reaction.3 This
would allow use of arachidonic acid as a starting material, as opposed to synthesizing the
polyolefin from alkyne precursors.
6.3 2-AG Analogs
AM10336 has been identified as a 2-AG analog that is stable in the presence of MGL as
seen in Chapter 4. Future investigation should be focused on finding suitable analogs for the
arachinoate portion of the compound while keeping the dimethylglycerol headgroup. AM10336
so far has been shown to be chemically and metabolically stable. Pharmacological studies on
this ligand should continue, including finding an appropriate model of the effect exhibited by
endogenous 2-AG to compare analogs with.
6.4 NAAA Inhibitors
Investigation of NAAA and identifying classes of inhibitors is still in the early stages.
We have identified AM9053, a stable isothiocyanate inhibitor, as a selective, competitive, and
reversible inhibitor toward NAAA. However, much can be improved on this scaffold, most
notably, reducing the ClogP. As it stands, these compounds are extremely lipophilic with a
ClogP >7. Too improve the drug-ability of these compounds some additional heteroatoms will
need to be included. Possibilities include the introduction of a heterocyclic moiety, such as
imidazole or pyridine, and including an ether linkage in the 10-carbon chain of AM9053. These
![Page 233: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/233.jpg)
233
adjustments can lower the ClogP to the 3-4 range (based on ChemDraw calculations).
Additional scaffolds should be explored; carbamates could be improved to where there is an
acceptable selectivity over FAAH, while increasing the inhibition of NAAA. Concurrently,
AM9053 should be submitted for a pharmacological profile in animal models, and submitted for
studies regarding its influence on inflammation.
6.5 References 1. Kolb, H. C.; Finn, M. G.; Sharpless, K. B. Click Chemistry: Diverse Chemical Function from a Few Good Reactions. Angewandte Chemie. International Ed. In English 2001, 40, 2004-2021. 2. Huisgen, R. Proceedings of the Chemical Society. October 1961. Proceedings of the Chemical Society 1961, 357-396. 3. Yao, F.; Li, C.; Vadivel, S. K.; Bowman, A. L.; Makriyannis, A. Development of novel tail-modified anandamide analogs. Bioorganic & Medicinal Chemistry Letters 2008, 18, 5912-5915.
![Page 234: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/234.jpg)
234
APPENDIX I
PUBLICATIONS
![Page 235: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/235.jpg)
Chemoenzymatic synthesis of 2-arachidonoylglycerol, an endogenous ligand forcannabinoid receptors
Subramanian K. Vadivel ⇑, Kyle M. Whitten, A. MakriyannisCenter for Drug Discovery, 116 Mugar Hall, 360 Huntington Avenue, Northeastern University, Boston, MA 02115, USA
a r t i c l e i n f o
Article history:Received 2 December 2010Revised 30 December 2010Accepted 10 January 2011Available online 18 January 2011
Keywords:CannabinoidEndogenous ligand2-ArachidonoylglycerolBiocatalysis
a b s t r a c t
A simple and efficient synthesis of 2-arachidonoyl glycerol, an endogenous agonist for cannabinoid recep-tors was achieved using Novozym 435, immobilized lipase from Candida antarctica.
� 2011 Elsevier Ltd. All rights reserved.
2-Arachidonoylglycerol (2-AG) is an endogenous cannabinergicligand that interacts with both CB1 and CB2 receptors. Although 2-AG synthesis involves several candidate enzymes,1 2-AG is inacti-vated principally by monoacylglycerol lipase2(MGL), although fattyacid amide hydrolase (FAAH) may contribute to its degradation.3 2-AG was shown to possess various biological activities, such asbinding to CB1 and CB2 cannabinoid receptors, inhibition of aden-ylyl cyclase in mouse spleen cells, and inducing hypothermia,reducing spontaneous activity, analgesia, and immobility in mice.4
2-AG acts as a full cannabinergic agonist, and the structure of 2-AGis strictly recognized by the cannabinoid receptors (CB1 and CB2).Thus, 2-AG rather than anandamide may represent the true naturalligand for cannabinoid receptors.5–7
The major problem in the synthesis of pure 2-AG is the rapidmigration of the arachidonoyl group from the secondary to the pri-mary hydroxyl group, resulting in the formation of more stable 1-arachidonoyl glycerol. This migration is catalyzed by water, acid,base, or heat.8 Earlier synthetic methods utilized coupling of 1,3-si-lyl9 or benzylidine10 protected glycerol with arachidonic acid andfollowed by deprotection and separation of the isomeric arachido-noyl glycerols. All these methods suffer from extended reactiontime, acidic conditions required for the removal of the protectinggroups as well as extensive work up and purification. Anotherinteresting method also appeared in the literature, which utilizesregioselective transformation of glycidyl arachidonate into 2-
arachidonoyl-1,3-bis(trifluoroacetyl)glycerol followed by thecleavage of trifluroacetyl group with pyridine.11
Searching for an alternative, green, and efficient methodologythat would circumvent these problems during 2-arachidonoylglycerol synthesis, we have developed an enzyme catalyzed effi-cient and highly regioselective synthesis. The advantage of bioca-talysis is that the reactions are carried out at ambienttemperature, nearly neutral pH and the reactions are often highlyregio- and stereoselective.12,13 Enzymes derived from microbialcells can be immobilized and reused for many cycles. It was knownthat enzymes can show selectivity during glycerolysis of fatty acidsas well as transesterification of symmetrical triglycerides.14–18
Herein, we report an improved, practical application of the abovemethodology in the synthesis of 2-arachidonoyl glycerol utilizingunsymmetrical triglyceride.
The synthesis is based on a two-step enzymatic process(Scheme 1). The first involves the synthesis of 1,3-diacyl glycerolusing the method reported by Halldorsson et al.19 Enzymatic acyl-ation of glycerol was carried out in anhydrous dichloromethaneusing vinylbutyrate as an acyl transfer agent. The reaction pro-ceeded smoothly at 0 �C to provide exclusively 1,3-butyroyl glyc-erol (1) with greater than 90% yield.20 The 1,3-diacylglycerol wascoupled with arachidonic acid using 4-dimethylaminopyridine(DMAP) and 1-(3-dimethyl-aminopropyl)-3-ethylcarbodiimidehydrochloride (EDCI) in dichloromethane at room temperaturefor 12 h providing the required triglyceride (2) in 84% yield.21 Tri-glyeride (2) was subjected to immobilized Candida antarctica (Nov-ozym 435) known for its high 1,3-regioselective glycerolysis oftriglycerides. The reaction was facile and afforded the required 2-arachidonoyl glycerol (3) exclusively (67%) and the by-product
0040-4039/$ - see front matter � 2011 Elsevier Ltd. All rights reserved.doi:10.1016/j.tetlet.2011.01.047
⇑ Corresponding author. Address: Center for Drug Discovery, NortheasternUniversity, 360 Huntington Avenue, 116 Mugar LifeSciences Building, Boston, MA02115, USA. Tel.: +1 617 373 7620; fax: +1 617 373 7493.
E-mail address: [email protected] (S.K. Vadivel).
Tetrahedron Letters 52 (2011) 1149–1150
Contents lists available at ScienceDirect
Tetrahedron Letters
journal homepage: www.elsevier .com/ locate/ tet le t
![Page 236: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/236.jpg)
butylacetate was easily removed under vacuum. We also noted theformation of ethyl arachidonate (27%) as a side product. It is note-worthy that there was no formation of 1-arachidonoylglycerol ob-served in the reaction. The crude product was purified by a smallfilter column of boric acid impregnated silica.22
In summary, the improved and practical synthesis of 2-AG wassuccessfully carried out without any isomerization of the more sta-ble 1-arachidonoyl glycerol. The mild neutral conditions, easy sca-lability, and removal of the volatile byproduct provide addedadvantages to the current method for the synthesis of 2-monoacylglycerides.
Acknowledgment
One of the authors (S.K.V.) acknowledges the financial supportfor this research from NIDA (R03 DA029184-01).
References and notes
1. Di Marzo, V.; Petrosino, S. Curr. Opin. Lipidol. 2007, 18, 129.2. Lambert, D. M.; Fowler, C. J. J. Med. Chem. 2005, 48, 5059.3. Goparaju, S. K.; Ueda, N.; Yamaguchi, H.; Yamamoto, S. FEBS Lett. 1998, 422, 69.4. Mechoulam, R.; Ben-Shabat, S.; Hanus, L.; Ligumsky, M.; Kaminski, N. E.;
Schatz, A. R.; Gopher, A.; Almog, S.; Martin, B. R.; Compton, D. R., et al Biochem.Pharmacol. 1995, 50, 83.
5. Sugiura, T.; Kishimoto, S.; Oka, S.; Gokoh, M. Prog. Lipid. Res. 2006, 45, 405.6. Sugiura, T.; Kodaka, T.; Nakane, S.; Miyashita, T.; Kondo, S.; Suhara, Y.;
Takayama, H.; Waku, K.; Seki, C.; Baba, N.; Ishima, Y. J. Biol. Chem. 1999, 274,2794.
7. Sugiura, T.; Kondo, S.; Kishimoto, S.; Miyashita, T.; Nakane, S.; Kodaka, T.;Suhara, Y.; Takayama, H.; Waku, K. J. Biol. Chem. 2000, 275, 605.
8. Martin, J. B. J. Am. Chem. Soc. 1953, 75, 5483.9. Han, L. N.; Razdan, R. K. Tetrahedron Lett. 1999, 40, 1631.
10. Seltzman, H. H.; Fleming, D. N.; Hawkins, G. D.; Carroll, F. I. Tetrahedron Lett.2000, 41, 3589.
11. Stamatov, S. D.; Stawinski, J. Tetrahedron Lett. 2002, 43, 1759.12. Nakamura, K.; Yamanaka, R.; Matsuda, T.; Harada, T. Tetrahedron: Asymmetry
2003, 14, 2659.13. Matsuda, T.; Yamanaka, R.; Nakamura, K. Tetrahedron: Asymmetry 2009, 20,
513.
14. Monteiro, J. B.; Nascimento, M. G.; Ninow, J. L. Biotechnol. Lett. 2003, 25, 641.15. Pfeffer, J.; Freund, A.; Bel-Rhlid, R.; Hansen, C. E.; Reuss, M.; Schmid, R. D.;
Maurer, S. C. Lipids 2007, 42, 947.16. Damstrup, M. L.; Jensen, T.; Sparso, F. V.; Kiil, S. Z.; Jensen, A. D.; Xu, X. J. Am. Oil
Chem. Soc. 2005, 82, 559.17. Damstrup, M. L.; Jensen, T.; Sparso, F. V.; Kiil, S. Z.; Jensen, A. D.; Xu, X. J. Am. Oil
Chem. Soc. 2006, 83, 27.18. Irimescu, R.; Iwasaki, Y.; Hou, C. T. J. Am. Oil Chem. Soc. 2002, 79, 879.19. Halldorsson, A.; Magnusson, C. D.; Haraldsson, G. G. Tetrahedron 2003, 59,
9101. NMR data for compound 1: 1H NMR (CDCl3, 500 MHz) d 4.12–4.27 (m,4H), 4.03–4.12 (m, 1H), 2.20–2.41 (t, J = 7.4 Hz, 4H), 1.67 (sxt, J = 7.42 Hz, 4H),0.96 (t, J = 7.32 Hz, 6H).
20. Magnusson, C. D.; Haraldsson, C. G. Tetrahedron 2010, 66, 2728.21. Preparation of 2: To a solution of 1,3-dibutanoylglyerol (1) (0.500 g,
2.45 mmol) and arachidonic acid (0.74 g, 2.45 mmol) in anhydrousdichloromethane (10 mL) was added DMAP (2.4 g, 19.6 mmol) and EDCI(1.88 g, 9.8 mmol). The resulting solution was stirred for 24 h. Cold water wasadded to the reaction mixture and washed with 5% HCl. The aqueous layer wasextracted with dichloromethane and the combined organic extracts werewashed with water, brine, and dried over sodium sulfate. The reaction mixturewas subjected to flash chromatography (hexanes/acetone; 7:3) to afford puretriglyceride as colorless oil (1.06 g, 88%). IR (neat) 3012, 2931, 1741, 1167,1094 cm�1; 1H NMR (CDCl3, 500 MHz) d 5.30–5.45 (m, 8H), 5.23–5.30 (m, 1H),4.10–4.37 (m, 4H), 2.76–2.91 (m, 6H), 2.34 (t, J = 7.57 Hz, 2H), 2.30 (t,J = 7.57 Hz, 4H), 2.12 (q, J = 7.16 Hz, 2H), 2.06 (q, J = 7.32 Hz, 2H), 1.68–1.75(m, 2H), 1.60–1.68 (m, 4H), 1.23–1.42 (m, 6H), 0.91–0.99 (m, 6H), 0.84–0.91(m, 3H); 13C NMR (CDCl3, 100 MHz) d 173.3, 172.8 (2C), 130.7, 129.2, 128.9,128.8, 128.5, 128.3, 128.0, 127.7, 69.2, 62.3 (2C), 36.1 (2C), 33.8, 31.7, 29.5,27.4, 26.7, 25.8 (3C), 24.9, 22.8, 18.5 (2C), 14.3, 13.8 (2C).
22. Preparation of 2-arachidonoyl glycerol (3): Triglyceride 2 (0.050 g,0.102 mmol) and anhydrous ethanol (0.7 mL) were stirred at roomtemperature and the reaction was started by the addition of Novozym 435(75 mg) and the reaction mixture was stirred for 1 h and the starting materialwas completely consumed. An additional 50 mg was added and the reactionmixture was stirred for another 1 h. After completion of the reaction theenzyme was filtered off and washed with ether and the solvent was evaporatedand the crude product was purified by plug of boric acid impregnated silica gel(hexanes/acetone; 9:1–3:2) to afford analytically pure 2-AG (0.026 g, 67%) as acolorless oil. IR (neat) 3420, 3012, 2927, 1736, 1456, 1378, 1277, 1152 cm�1;1H NMR (500 MHz, CDCl3) d 5.37–5.49 (m, 8H), 4.93 (p, 5.0 Hz, 1H), 3.84 (t,J = 5.0 Hz, 4H), 2.79–2.88 (m, 6H), 2.39 (t, J = 7.5 Hz, 2H), 2.13 (q, J = 7.0 Hz, 2H),2.06 (q, J = 7.0 Hz, 2H), 2.00 (br t, J = 5.5 Hz, 2H), 1.72 (p, J = 7.2 Hz, 2H), 1.30–1.40 (m, 6H), 0.92 (t, J = 7.2 Hz, 3H); 13C NMR (CDCl3, 100 MHz) d 174.1, 130.7,129.3, 128.9, 128.8, 128.5, 128.3, 128.1, 127.8, 75.2, 62.5 (2C), 33.8, 31.7, 29.6,27.4, 26.7, 25.8, 25.8, 25.8, 24.9, 22.8, 14.3.
HOOH
OHHO
OCO(CH2)2CH3
OCO(CH2)2CH3
ImmobilizedCandida antarctica(Novozym 435)
O
O
EDCI, DMAP
ImmobilizedCandida antarctica (Novozyme 435),Ethanol
O
OOH
OH
OHO
O
OOCO(CH2)2CH3
OCO(CH2)2CH3
2-Arachidonoylglycerol
12
3
90%
84%
67%
Scheme 1.
1150 S. K. Vadivel et al. / Tetrahedron Letters 52 (2011) 1149–1150
![Page 237: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/237.jpg)
Application of chemoenzymatic hydrolysis in the synthesisof 2-monoacylglycerols
Kyle M. Whitten, Alexandros Makriyannis, Subramanian K. Vadivel *
Center for Drug Discovery, 116 Mugar Hall, 360 Huntington Avenue, Northeastern University, Boston, MA 02115, Unites States
a r t i c l e i n f o
Article history:Received 13 March 2012Received in revised form 24 April 2012Accepted 25 April 2012Available online 5 May 2012
Keywords:CannabinoidReceptorEndogenous ligand2-MonoacylglycerolBiocatalysis
a b s t r a c t
The selective biocatalyzed synthesis of 2-monoacylglycerols (2-MAGs) through the use of commerciallyavailable immobilized Candida antarctica (Novozym435) and Rhizomucor miehei is explored. Reactions atroom temperature result in the formation of a 2-MAG and a corresponding ethyl ester of the fatty acidwith immobilized C. antarctica within 2 h with yields ranging from 36% to 83%. Similar reaction condi-tions with immobilized R. miehei yielded exclusively the 2-MAG after 24 h with yields ranging from 37%to 88%. Yields vary on the acyl group at the sn-2 position and choice of enzyme involved.
� 2012 Elsevier Ltd. All rights reserved.
1. Introduction
2-Monoacylglycerols (2-MAGs) exhibit beneficial emulsifyingproperties that are utilized in the food industry,1,2 and in the ad-ministration of pharmaceuticals.3 The polyunsaturated fatty acid(PUFA) occupying the sn-2 position is important in the influence ofstructured triglycerides absorption and digestion.4 The biologicaleffects of fatty acids released from the metabolism of glycerols andamides, or through ingestion, have also been studied.5e7 One of themore intensively studied 2-MAGs, 2-arachidonoylglycerol (2-AG,10b), is a physiologically important lipid signaling molecule actingas a receptor ligand in the endocannabinoid system. Pharmaco-logical properties of 2-AG include hypotension, neuroprotection,and appetite stimulation.8
2-AG and other 2-MAGs in biological systems are usually inac-tivated/catabolized by the hydrolyzing enzyme monoacylglycerollipase (MAGL) to produce a fatty acid and glycerol.9
The synthesis and study of 2-MAGs is made difficult due to acylmigration from the sn-2 to the sn-1 or -3 position (Scheme 1).10,11
This migration is facile and occurs in the presence of acid, base,heat, and protic solvents.12,13 In the case of 2-AG, acyl migrationrenders 1-AG, which is incapable of binding to the endocannabinoidreceptors.14 Many reported syntheses of 2-MAGs involve multiple
laborious steps with unfavorable reaction conditions and work upsthat may promote the unwanted acyl migration. An earlier 2-MAGsynthesis began with the coupling of the fatty acid to a 1,3-triisopropylsilyl (TIPS) glycerol. The removal of the silyl protectinggroups required 24 h with the addition of acetic acid and tetrabu-tylammonium fluoride.15 Another procedure involved coupling offatty acid with 1,3-benzylideneglycerol and removal of the benzyli-denewith phenylboronic acid. The reaction resulted in the formationof the mixture of the 1,3- and 1,2-phenylboronate esters, which wasseparated and cleaved withmethanol and water.16 A third techniqueutilizes the ring opening of a glycidal ester with trifluoroacetic acidto produce a triacylglycerol. The 2-MAG was then formed aftertreatment of the triacylglycerol methanol and pyridine.17
Application of lipase in the syntheses of 1,3-diacylglycerol and1(3)-rac-monoacyl glycerol has been extensively studied andreviewed.18e26 The selectivity and yield are determined by variousfactors, which include amount of enzyme, solvent, temperature,and the type of lipase used.27,28 Even though, the preparation ofselective 1,3-diacylglycerols has been achieved successfully, it hasbeen a challenging task for the synthesis of 2-acylglycerols mainlydue to over hydrolysis and the acyl migration from sn-2 to sn-1 or
Scheme 1.
* Corresponding author. Tel.: þ1 617 373 7620; fax: þ1 617 373 7493; e-mailaddresses: [email protected], [email protected], [email protected](S.K. Vadivel).
Contents lists available at SciVerse ScienceDirect
Tetrahedron
journal homepage: www.elsevier .com/locate/ tet
0040-4020/$ e see front matter � 2012 Elsevier Ltd. All rights reserved.doi:10.1016/j.tet.2012.04.101
Tetrahedron 68 (2012) 5422e5428
![Page 238: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/238.jpg)
sn-3 position. Lipase-mediated selective hydrolysis of triglycerideusing 1,3-regiospecific lipases, esterification of fatty acids ortransesterification of fatty esters with glycerol, and the glycerolysisof triglycerides have been documented in the literature.29,30 Iri-mescu et al. reported a successful synthesis of various 2-acylglycerols of fatty acids using regiospecific ethanolysis of sym-metrical triglycerides with immobilized Candida antarctica lipase(Novozym 435).22,31 Even though C. antarctica is not considered asa 1,3-regiospecific enzyme, it has been consistently used for thepreparation of 1,3-acylglycerols and ethanolysis of tri-glycerides.31,32 All existing methods utilize symmetrical (‘AAA’type) triglycerides resulting in the formation of corresponding esteras the byproduct that requires exhaustive purification (Fig. 1).
Encouraged by this literature, we recently reported amethod forthe synthesis 2-AG, which utilizes a structured glyceride, 1,3-dibutyryl-2-arachidonate (‘ABA’ type), as a substrate, for we rea-soned that the anticipated byproduct, ethyl butyrate, can be easilyremoved.33 Benefits of this procedure include reactions at ambienttemperature, neutral pH, and conservative reaction time. Themethod is simple and green, as the lipase can be recycled. Never-theless, a significant amount of ethyl arachidonate formed due toover hydrolysis. Since the reaction is selective and proceededquickly, it has become a valuable tool for the radiolabelled synthesisof 2-AG.34 The following work extends our method to the synthesisof 2-acylglycerols starting from saturated and unsaturated fattyacids, and alkyl and aryl carboxylic acids.
2. Results and discussion
To test the general practicality of our method (Scheme 2), wehave synthesized 2-MAGs from various commercially availablelong-chain carboxylic acids, including those of biological impor-tance. The synthesis began with the enzymatic 1,3-diacyl pro-tection of glycerol by the addition of immobilized C. antarctica(Novozym 435) to glycerol and vinyl butyrate in anhydrous CH2Cl2at 0 �C, resulting in the protected glycerol in quantitative yield.32,35
The 1,3-diacylglycerol was then coupled to various medium andlong-chain acids through 1-(3-dimethyl-aminopropyl)-3-ethylcarbodiimide hydrochloride (EDCI) coupling in a 1:1 mixture
of anhydrous THF/CH2Cl2 along with a catalytic amount of 4-dimethylaminopyridine (DMAP) at 0 �C for 4 h. This generatedthe structured triglyceride (‘ABA’ type) in 67e99% yield.
For the hydrolysis step, Novozym 435 was added to the tri-glyceride in a minimal amount of anhydrous ethanol at roomtemperature. By TLC analysis, it was observed that within 1 h thetriglyceride had been completely consumed, and a mixture of 2-MAG, mono-protected 2-MAG, and ethyl butyrate was generated.There is no formation of ethyl ester of fatty acid observed duringthis period. At this point, additional lipase was added to the mix-ture, which was allowed to stir until all the mono-protected 2-MAGwas consumed (1 h), affording the 2-MAG. Some significantamount of ethyl ester was observed during this period, and theformation of ethyl ester largely depended on the type of carboxylicacid used. Aryl and unsaturated carboxylic acids showed more re-sistant toward over hydrolysis compared to saturated fatty acids.
The separation of 1-MAG and 2-MAG is generally performed onboric acid impregnated TLC plates and silica gel columns.36 Non-impregnated silica TLC plates do not resolve 1- and 2-MAG. Thisseparation is a necessary step for most 2-MAG syntheses due to theunfavorable synthetic conditions used, which result in formation ofconsiderable 1-MAG as well. In contrast, the highly regiospecificand neutral reaction conditions when using the lipase result inminimal or no 1-MAG formation. Although silica gel purificationhas been reported to be an inevitable cause of acyl migration in 2-MAG to 1-MAG,37 we did not observe any migration during columnchromatography with untreated silica gel. The only required stepprior to purification was equilibration of silica gel with hexanes.During chromatography, the highly non-polar ethyl ester byprod-uct eluted with ethyl butyrate, and the 2-MAG was collectedwithout any acyl migration. It was observed that the lipase-catalyzed hydrolysis reactions involving saturated triglycerideshad isolated yields <50%, with the ethyl ester byproduct being themajor product, whereas the unsaturated triglycerides had yields inthe range of 55e75%, and triglycerides containing phenylalkylgroups had yields >80% (Table 1). It should also be noted that therewas no observable difference in rate of reaction or isolated yieldfrom the hydrolysis of a 1,3-diacetylglycerol-protected compoundas compared to the 1,3-dibutrylglycerol-protected compound.
We also screened other 1,3-specific lipases to investigatewhether the transformation can be performed in better yield andselectivity toward the range of substrates and found that lipasefrom Rhizomucor miehei showed excellent selectivity toward hy-drolyzing ‘ABA’ type triglycerides. The reaction proceeded ina similar fashion where the triglyceride was consumed quickly, buthydrolysis of diglycerides took 24e48 h. Even though the reactionproceeded very slowly compared to C. antarctica lipase, the R.miehei lipase offered a remarkable improvement in selectivity,
Fig. 1. Types of triglycerides.
Scheme 2.
K.M. Whitten et al. / Tetrahedron 68 (2012) 5422e5428 5423
![Page 239: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/239.jpg)
providing exclusively 2-acylglycerols in excellent yields withoutformation of ethyl ester byproduct. The saturated and unsaturatedfatty acid triglycerides were hydrolyzed in good yields (75e88%)after 24 h. However, in most of the reactions, some unreacted di-glyceride intermediate remained. Allowing the reaction to proceedfor an additional 24 h or adding more enzyme did not improve theyield. When unreacted diglyceride that was separated from the 2-MAG after 24 h was subjected to an additional treatment of R.miehei lipase the maximal yield once again reached 80% 2-MAGformation. Surprisingly, in contrast to C. antarctica lipase, R. mie-hei lipase showed less reactivity toward aryl esters (13 and 14).
3. Conclusion
Synthesis of 2-MAGs is complicated by the propensity of the acylgroup to shift from the sn-2 to the more stable sn-1 or -3 positions,the acyl migration being promoted by heretofore standard reactionconditions. We demonstrate herein that chemoenzymatic hydro-lysis of structured triglycerides is a mild and efficient means tosynthesize 2-MAGs. The ambient temperature, neutral pH, and lackof caustic work up are conditions, whichmarkedly limit 2-MAG acylmigration. The ability to synthesize 2-MAGs from ‘ABA’ type tri-glycerides is an important aspect of this current methodology in
Table 1Structures and yields of lipase-catalyzed 2-MAGs
Compound no. Triglyceride (a) 2-MAG (b) C. antarcticaa yield (%) R. mieheib yield (%)
2 47 84
3 49 82
4 36 80
5 75 83
6 44 78
7 72 83
8 63 77
9 55 79
10 67 75
11 63 76
12 40 88
13 83 40
14 83 37
a Remaining yield consisted of the ethyl ester of sn-2 acyl group.b Remaining yield consisted of intermediate diglyceride.
K.M. Whitten et al. / Tetrahedron 68 (2012) 5422e54285424
![Page 240: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/240.jpg)
comparison to utilizing ‘AAA’ type triglycerides. An excess of fattyacid is not required for this method, which is important when thepreparation of the modified fatty acid involves laborious multistep-synthesis.38e40 This will further enhance the study of structur-eeactivity relationships of these biologically important lipid sig-naling molecules.
4. Experimental
4.1. General methods
Lipase acrylic resin from C. antarctica and Lipozyme�, immobi-lized from R. miehei were purchased from Sigma Aldrich (USA). Allother reagents were used without prior purification. All reactionswere performed under an atmosphere of argon.
All byproducts, ethyl arachidonate, ethyl butyrate, and all di-glycerides were removed during column chromatography. Allglycerols were purified on a Biotage Isolera One using Luknovaprepackaged 12 g columns equilibrated with hexanes.
Compounds 3ae14a were synthesized following the proceduredescribed for 2a; while compounds 3be14b were synthesized fol-lowing the C. antarctica and R. miehei procedures described for 2b.
4.2. 2-Hydroxypropane-1,3-diyl dibutyrate (1)
Immobilized C. antarctica (750 mg) was added to a solution ofglycerol (2.0 g, 21.6 mmol) and vinyl butyrate (6.2 g, 54.0 mmol) inanhydrous CH2Cl2 (10 mL) at 0 �C. The resulting mixturewas stirredfor 3 h under argon atmosphere. Then, additional lipase (400 mg)was added to the reaction mixture, which was stirred for an addi-tional 2 h at 0 �C. The lipase was filtered off, the solvent wasevaporated off under reduced pressure, and the residue was chro-matographed on silica to yield 1 (5.0 g, 99%) as a colorless oil.Rf¼0.55 (40% ethyl acetate/hexanes). 1H NMR (500 MHz, chloro-form-d) d¼4.20 (dd, J¼11.72, 4.39 Hz, 2H), 4.14 (dd, J¼11.72, 5.86 Hz,2H), 4.04e4.12 (m, 1H), 2.41e2.58 (m, 1H), 2.33 (t, J¼7.32 Hz, 4H),1.67 (sxt, J¼7.32 Hz, 4H), 0.96 (t, J¼7.57 Hz, 4H). The 13C NMRspectral data (100 MHz, CDCl3) are in agreement with literaturevalues.32
4.3. 2-(Dodecanoyloxy)propane-1,3-diyl dibutyrate (2a)
EDCI (383 mg, 2.0 mmol), DMAP (19 mg, 0.16 mmol), and 1(204 mg, 0.88 mmol) were added to a solution of lauric acid(160 mg, 0.80 mmol) in a 1:1 mixture of anhydrous THF/CH2Cl2(10 mL) at 0 �C. The reactionmixturewas allowed to stir for 4 h. Thereaction mixture was then diluted with CH2Cl2 (15 mL) and H2O(15 mL). The organic layer was separated, dried over MgSO4, andthe solvent was removed under reduced pressure. The residue waschromatographed on silica gel (0e15% ethyl acetate/hexanes) toyield 2a (221 mg, 67%) as a colorless oil. Rf¼0.50 (15% ethyl acetate/hexanes). 1H NMR (400 MHz, chloroform-d) d¼5.24e5.31 (m, 1H),4.30 (dd, J¼12.09, 4.03 Hz, 2H), 4.16 (dd, J¼12.46, 5.86 Hz, 2H),2.27e2.35 (m, 6H),1.57e1.70 (m, 6H),1.21e1.36 (m,16H), 0.92e0.98(m, 6H), 0.88 (t, J¼6.60 Hz, 3H). 13C NMR (100 MHz, chloroform-d)d¼173.4 (2C), 173.2, 77.4, 69.1, 62.3 (2C), 36.1 (2C), 34.4, 32.1, 29.8,29.7, 29.6, 29.5, 29.3, 25.1, 22.9, 18.6 (2C), 14.4, 13.9 (2C). IR (neat,cm�1) 2926, 2855, 1742, 1460. HRMS for C23H42O6Na (MNaþ)437.2881. Calcd 437.2879.
4.4. 1,3-Dihydroxypropan-2-yl dodecanoate (2b, utilizingC. antarctica)
Immobilized C. antarctica (Novozym 435, 100 mg) was added toa solution of 2a (100 mg, 0.24 mmol), stirred in anhydrous EtOH(1 mL). After the full consumption of 2a (1 h, TLC monitoring),
additional lipase (100 mg) was added until reaction completionwas observed (1 h). The reaction mixture was diluted with CH2Cl2(3 mL), and the lipase was filtered off. The solvent was removedunder reduced pressure, and the resulting residue was chromato-graphed on silica gel (10e50% acetone/hexanes) to yield 2b (31 mg,47%) as a white solid. Rf¼0.26 (30% acetone/hexanes).Mp¼56e57 �C. 1H NMR (400 MHz, chloroform-d) d¼4.93 (quin,J¼4.76 Hz,1H), 3.84 (br s, 4H), 2.38 (t, J¼7.69 Hz, 2H), 2.08 (br s, 2H),1.58e1.69 (m, 2H), 1.20e1.37 (m, 16H), 0.88 (t, J¼6.60 Hz, 3H). 13CNMR (100 MHz, chloroform-d) d¼174.3, 75.3, 62.8 (2C), 34.6, 32.1,29.8, 29.7, 29.6, 29.5, 29.3, 25.2 (2C), 22.9,14.4. IR (neat, cm�1) 3352,2922, 2856, 1730, 1464. HRMS for C15H30O4Na (MNaþ) 297.2041.Calcd 297.2042.
4.5. 1,3-Dihydroxypropan-2-yl dodecanoate (2b, utilizingR. miehei)
Lipozyme�, immobilized from R. miehei (100 mg) was added toa solution of 2a (100 mg, 0.24 mmol) stirred in anhydrous EtOH(1 mL). The reaction mixture was stirred for 24 h, diluted withCH2Cl2 (3 mL), and the lipase was filtered off. The solvent was re-moved under reduced pressure, and the resulting residue waschromatographed on silica gel (10e50% acetone/hexanes) to yield2b (55 mg, 84%) as an oil. All spectral data was consistent with thatobtained using the procedure with C. antarctica.
4.6. 2-(Tetradecanoyloxy)propane-1,3-diyl dibutyrate (3a)
Yield 347 mg, 99%; colorless oil. Rf¼0.47 (15% ethyl acetate/hexanes). 1H NMR (399 MHz, chloroform-d) d¼5.32e5.22 (m, 1H),4.29 (dd, J¼4.4, 11.7 Hz, 2H), 4.15 (dd, J¼5.9, 11.7 Hz, 2H), 2.35e2.25(m, 6H), 1.70e1.56 (m, 6H), 1.36e1.19 (m, 20H), 0.94 (t, J¼7.3 Hz,6H), 0.87 (t, J¼6.6 Hz, 3H). 13C NMR (100 MHz, chloroform-d)d¼173.4 (2C), 173.2, 69.1, 62.3 (2C), 36.1 (2C), 34.4, 32.2, 29.91, 29.89(2C), 29.86, 29.7, 29.6, 29.5, 29.3, 25.1, 22.9, 18.6 (2C), 14.4, 13.9 (2C).IR (neat, cm�1) 2925, 2854, 1741, 1460. HRMS for C25H46O6Na(MNaþ) 465.3195. Calcd 465.3192.
4.7. 1,3-Dihydroxypropan-2-yl tetradecanoate (3b)
C. antarctica: 34 mg, 49%; R. miehei: 57 mg, 82%; white solid.Rf¼0.22 (30% acetone/hexanes). Mp¼57e58 �C. 1H NMR (399 MHz,chloroform-d) d¼4.93 (quin, J¼4.8 Hz, 1H), 3.89e3.78 (m, 3H), 2.38(t, J¼7.3 Hz, 2H), 2.17e2.10 (m, 2H),1.70e1.58 (m, 2H), 1.38e1.19 (m,20H), 0.88 (t, J¼7.3 Hz, 3H). 13C NMR (100 MHz, chloroform-d)d¼174.3, 75.2, 62.8 (2C), 34.6, 32.2, 29.91, 29.87 (2C), 29.8, 29.7,29.6, 29.5, 29.3, 25.2, 22.9, 14.4. IR (neat, cm�1) 3418, 2926, 2855,1729, 1466. HRMS for C17H34O4Na (MNaþ) 325.2354. Calcd325.2355.
4.8. 2-(Palmitoyloxy)propane-1,3-diyl dibutyrate (4a)
Yield 309 mg, 84%; colorless oil. Rf¼0.39 (15% ethyl acetate/hexanes). 1H NMR (500 MHz, chloroform-d) d¼5.30e5.25 (m, 1H),4.30 (dd, J¼4.2, 12.0 Hz, 2H), 4.16 (dd, J¼5.9, 11.7 Hz, 2H), 2.35e2.27(m, 6H), 1.70e1.58 (m, 6H), 1.34e1.21 (m, 24H), 0.98e0.92 (m, 6H),0.88 (t, J¼6.8 Hz, 3H). 13C NMR (100 MHz, chloroform-d) d¼173.4,173.2 (2C), 69.1, 62.3 (2C), 36.1, 34.4, 32.2, 29.9 (6C), 29.7, 29.6, 29.5,29.3, 25.1 (2C), 18.6 (3C), 14.4, 13.9 (2C). IR (neat, cm�1) 2924, 1742,1460. HRMS for C27H50O6Na (MNaþ) 493.3503. Calcd 493.3505.
4.9. 1,3-Dihydroxypropan-2-yl palmitate (4b)
C. antarctica: 25 mg, 36%; R. miehei: 56 mg, 80%; white solid.Rf¼0.27 (30% acetone/hexanes). Mp¼64e65 �C. 1H NMR (500 MHz,chloroform-d) d¼4.93 (quin, J¼4.8 Hz, 1H), 3.84 (t, J¼4.9 Hz, 4H),
K.M. Whitten et al. / Tetrahedron 68 (2012) 5422e5428 5425
![Page 241: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/241.jpg)
2.38 (t, J¼7.6 Hz, 2H), 2.13e2.05 (m, 2H), 1.69e1.59 (m, 2H),1.38e1.20 (m, 24H), 0.88 (t, J¼7.3 Hz, 3H). 13C NMR (100 MHz,chloroform-d) d¼174.3, 75.2, 62.8 (2C), 34.6, 32.2, 29.93, 29.92,29.89, 29.84, 29.7, 29.6, 29.5, 29.3, 25.2 (2C), 23.3, 22.9, 14.4. IR(neat, cm�1) 3320, 2917, 2850, 1730, 1471. HRMS for C19H38O4Na(MNaþ) 353.2668. Calcd 353.2668.
4.10. (Z)-2-(hexadec-9-enoyloxy)propane-1,3-diyl dibutyrate(5a)
Yield 291 mg, 79%; colorless oil. Rf¼0.50 (15% ethyl acetate/hexanes). 1H NMR (399 MHz, chloroform-d) d¼5.38e5.32 (m, 2H),5.31e5.24 (m, 1H), 4.30 (dd, J¼4.4, 11.7 Hz, 2H), 4.16 (dd, J¼5.9,12.5 Hz, 2H), 2.38e2.26 (m, 6H), 2.01 (q, J¼6.6 Hz, 4H), 1.72e1.56(m, 6H), 1.39e1.20 (m, 16H), 0.95 (t, J¼7.3 Hz, 6H), 0.88 (t, J¼7.0 Hz,3H). 13C NMR (100 MHz, chloroform-d) d¼173.3 (2C), 173.1, 130.2,129.9, 69.1, 62.3 (2C), 36.1 (2C), 34.4, 32.0, 30.0, 29.9, 29.4, 29.3,29.25, 29.21, 27.5, 27.4, 25.1, 22.9, 18.6 (2C), 14.3, 13.8 (2C). IR (neat,cm�1) 3007, 2928, 2856, 1742, 1459. HRMS for C27H48O6Na (MNaþ)491.3347. Calcd 491.3349.
4.11. (Z)-1,3-Dihydroxypropan-2-yl hexadec-9-enoate (5b)
C. antarctica: 46 mg, 66%; R. miehei: 58 mg, 83%; colorless oil.Rf¼0.25 (30% acetone/hexanes). 1H NMR (399 MHz, chloroform-d)d¼5.40e5.31 (m, 2H), 4.92 (quin, J¼4.8 Hz, 1H), 3.86e3.79 (m, 4H),2.37 (t, J¼7.7 Hz, 2H), 2.33 (br s, 2H), 2.05e1.97 (m, 4H), 1.63 (quin,J¼7.3 Hz, 2H), 1.39e1.23 (m, 16H), 0.88 (t, J¼6.6 Hz, 3H). 13C NMR(100 MHz, chloroform-d) d¼174.3, 130.3, 129.9, 75.2, 62.6 (2C), 34.6,32.0, 30.0, 29.9, 29.4, 29.32, 29.30, 29.2, 27.4, 27.4, 25.2, 22.9,14.3. IR(neat, cm�1) 3405, 3008, 2924, 2855, 1736, 1462. HRMS forC19H36O4Na (MNaþ) 351.2512. Calcd 351.2511.
4.12. 2-(Stearoyloxy)propane-1,3-diyl dibutyrate (6a)
Yield 300 mg, 85%; colorless oil. Rf¼0.34 (15% ethyl acetate/hexanes). 1H NMR (500 MHz, chloroform-d) d¼5.30e5.24 (m, 1H),4.30 (dd, J¼4.4, 11.7 Hz, 2H), 4.16 (dd, J¼6.1, 12.0 Hz, 2H), 2.34e2.27(m, 6H), 1.70e1.59 (m, 6H), 1.35e1.20 (m, 28H), 0.98e0.93 (m, 6H),0.88 (t, J¼6.6 Hz, 3H). 13C NMR (100 MHz, chloroform-d) d¼173.4(2C),173.2, 69.1, 62.3 (2C), 36.2 (2C), 34.4, 32.2, 29.9 (4C), 29.89 (3C),29.86, 29.7, 29.6, 29.5, 29.3, 25.1, 22.9, 18.6 (2C), 14.4, 13.9 (2C). IR(neat, cm�1) 2924, 1742, 1460. HRMS for C29H54O6Na (MNaþ)521.3813. Calcd 521.3818.
4.13. 1,3-Dihydroxypropan-2-yl stearate (6b)
C. antarctica: 32 mg, 44%; R. miehei: 56 mg, 78%; white solid.Rf¼0.23 (30% acetone/hexanes). Mp¼68e69 �C. 1H NMR (399 MHz,chloroform-d) d¼4.93 (quin, J¼4.6 Hz, 1H), 3.88e3.82 (m, 4H), 2.38(t, J¼7.7 Hz, 2H), 2.04 (t, J¼5.9 Hz, 2H), 1.65 (quin, J¼7.3 Hz, 2H),1.38e1.19 (m, 28H), 0.88 (t, J¼6.6 Hz, 3H). 13C NMR (100 MHz,chloroform-d) d¼174.3, 75.3, 62.8 (2C), 34.6, 32.2, 29.95 (5C), 29.91(2C), 29.8, 29.7, 29.6, 29.5, 29.3, 25.2, 23.0, 13.8. IR (neat, cm�1)3313, 2916, 2849, 1730, 1472. HRMS for C21H42O4Na (MNaþ)381.2982. Calcd 381.2981.
4.14. (Z)-2-(Oleoyloxy)propane-1,3-diyl dibutyrate (7a)
Yield 290 mg, 82%; colorless oil. Rf¼0.43 (15% ethyl acetate/hexanes). 1H NMR (500 MHz, chloroform-d) d¼5.39e5.30 (m, 2H),5.30e5.24 (m, 1H), 4.30 (dd, J¼4.4, 11.7 Hz, 2H), 4.15 (dd, J¼6.1,12.0 Hz, 2H), 2.36e2.25 (m, 6H), 2.01 (q, J¼6.2 Hz, 4H), 1.71e1.55(m, 6H), 1.38e1.19 (m, 20H), 0.95 (t, J¼7.3 Hz, 3H), 0.88 (t, J¼6.8 Hz,3H). 13C NMR (100 MHz, chloroform-d) d¼173.4 (2C), 173.1, 130.3,129.9, 69.1, 62.3, 36.1 (2C), 34.4, 32.1, 30.0, 29.9, 29.8, 29.6 (2C), 29.4,
29.3, 29.2, 27.5, 27.4, 25.1, 22.9, 18.6 (3C), 14.4, 13.9 (2C). IR (neat,cm�1) 3007, 2925, 1742, 1460. HRMS for C29H52O6Na (MNaþ)519.3658. Calcd 519.3662.
4.15. 1,3-Dihydroxypropan-2-yl oleate (7b)
C. antarctica: 48 mg, 67%; R. miehei: 60 mg, 83%; colorless oil.Rf¼0.30 (30% acetone/hexanes). 1H NMR (399 MHz, chloroform-d)d¼5.41e5.31 (m, 2H), 4.92 (quin, J¼4.8 Hz, 1H), 3.88e3.77 (m, 4H),2.49 (br s, 2H), 2.37 (t, J¼7.7 Hz, 2H), 2.01 (q, J¼6.4 Hz, 4H), 1.63(quin, J¼7.3 Hz, 2H), 1.40e1.19 (m, 20H), 0.88 (t, J¼6.6 Hz, 3H). 13CNMR (100 MHz, chloroform-d) d¼174.4, 130.3, 129.9, 75.1, 62.5 (2C),34.6, 32.1, 30.0, 29.9, 29.8, 29.6, 29.4, 29.33, 29.31, 27.45, 27.38, 25.2(2C), 22.9, 14.4. IR (neat, cm�1) 3415, 3008, 2923, 2854, 1735, 1464.HRMS for C21H40O4Na (MNaþ) 379.2827. Calcd 379.2824.
4.16. 2-((9Z,12Z)-Octadeca-9,12-dienoyloxy)propane-1,3-diyldibutyrate (8a)
Yield 344 mg, 98%; colorless oil. Rf¼0.38 (15% ethyl acetate/hexanes). 1H NMR (399 MHz, chloroform-d) d¼5.43e5.30 (m, 4H),5.29e5.24 (m, 1H), 4.30 (dd, J¼4.4, 11.7 Hz, 2H), 4.15 (dd, J¼5.9,11.7 Hz, 2H), 2.77 (t, J¼6.6 Hz, 2H), 2.36e2.26 (m, 6H), 2.05 (q,J¼6.6 Hz, 4H), 1.72e1.56 (m, 6H), 1.41e1.22 (m, 14H), 0.95 (t,J¼7.7 Hz, 6H), 0.89 (t, J¼7.0 Hz, 3H). 13C NMR (100 MHz, chloro-form-d) d¼173.3 (2C), 173.1, 130.5, 130.2, 128.3, 128.1, 69.1, 62.3 (2C),36.1 (2C), 34.4, 31.8, 29.8, 29.6, 29.4 (2C), 29.3, 29.2, 27.4, 25.8, 25.1,22.8, 18.6 (2C), 14.3, 13.9 (2C). IR (neat, cm�1) 3008, 2929, 2856,1741, 1459. HRMS for C29H50O6Na (MNaþ) 517.3506. Calcd 517.3505.
4.17. (9Z,12Z)-1,3-Dihydroxypropan-2-yl octadeca-9,12-dienoate (8b)
C. antarctica: 45 mg, 63%; R. miehei: 55 mg, 77%; colorless oil.Rf¼0.37 (30% acetone/hexanes). 1H NMR (399 MHz, chloroform-d)d¼5.44e5.30 (m, 4H), 4.93 (quin, J¼4.8 Hz, 1H), 3.89e3.76 (m, 4H),2.77 (t, J¼6.6 Hz, 2H), 2.38 (t, J¼7.3 Hz, 2H), 2.13 (t, J¼6.2 Hz, 2H),2.05 (q, J¼6.8 Hz, 4H), 1.69e1.59 (m, 2H), 1.41e1.23 (m,14H), 0.89 (t,J¼6.6 Hz, 3H). 13C NMR (100 MHz, chloroform-d) d¼174.3, 130.5,130.2, 128.3, 128.1, 75.2, 62.8 (2C), 34.6, 31.8, 29.8, 29.6, 29.4, 29.33,29.30, 27.4, 25.9, 25.2 (2C), 22.8, 14.3. IR (neat, cm�1) 3397, 010,2926, 2855, 1736, 1459. HRMS for C21H38O4Na (MNaþ) 377.2667.Calcd 377.2668.
4.18. (Z)-2-(Icos-11-enoyloxy)propane-1,3-diyl dibutyrate (9a)
Yield 328 mg, 88%; colorless oil. Rf¼0.42 (15% ethyl acetate/hexanes). 1H NMR (399 MHz, chloroform-d) d¼5.38e5.32 (m, 2H),5.30e5.24 (m, 1H), 4.30 (dd, J¼4.4, 11.7 Hz, 2H), 4.16 (dd, J¼5.9,12.5 Hz, 2H), 2.36e2.26 (m, 6H), 2.05e1.97 (m, 4H), 1.71e1.57 (m,6H), 1.27 (br s, 24H), 0.95 (t, J¼7.3 Hz, 6H), 0.88 (t, J¼6.6 Hz, 3H). 13CNMR (100 MHz, chloroform-d) d¼173.3 (2C), 173.1, 130.2, 130.0,69.0, 62.3 (2C), 36.1 (2C), 34.4, 32.1, 30.0 (2C), 29.8, 29.7, 29.55 (2C),29.52, 29.51, 29.3, 27.4 (2C), 25.1 (2C), 22.9, 18.6 (2C), 14.4, 13.9(2C).IR (neat, cm�1) 3008, 2925, 2855, 1742, 1459. HRMS forC31H56O6Na (MNaþ) 547.3978. Calcd 547.3975.
4.19. (Z)-1,3-Dihydroxypropan-2-yl icos-11-enoate (9b)
C. antarctica: 40 mg, 55%; R. miehei, 58 mg, 79%; white solid.Rf¼0.24 (30% acetone/hexanes). Mp¼32e33 �C. 1H NMR (399 MHz,chloroform-d) d¼5.38e5.32 (m, 2H), 4.93 (quin, J¼4.8 Hz, 1H),3.89e3.78 (m, 4H), 2.38 (t, J¼7.3 Hz, 2H), 2.20e2.12 (m, 2H), 2.01 (q,J¼6.6 Hz, 4H), 1.71e1.57 (m, 2H), 1.40e1.18 (m, 24H), 0.88 (t,J¼6.6 Hz, 3H). 13C NMR (100 MHz, chloroform-d) d¼174.3, 130.2,130.0, 75.2, 62.8 (2C), 34.6, 32.1, 30.0 (2C), 29.8, 29.7, 29.7, 29.6 (2C),
K.M. Whitten et al. / Tetrahedron 68 (2012) 5422e54285426
![Page 242: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/242.jpg)
29.56, 29.51, 29.3, 27.4, 25.2 (2C), 23.0, 14.4. IR (neat, cm�1) 3405,3008, 2923, 2854, 1737, 1465. HRMS for C23H44O4Na (MNaþ)407.3142. Calcd 407.3137.
4.20. 2-((5Z,8Z,11Z,14Z)-Icosa-5,8,11,14-tetraenoyloxy)-propane-1,3-diyl dibutyrate (10a)
Yield 168 mg, 98%; colorless oil. Rf¼0.36 (30% ethyl acetate/hexanes). The 1H and 13C spectral data (500 and 100 MHz, CDCl3)are in agreement with literature values.33 IR (neat, cm�1) 3012,2931, 1741, 1456. HRMS for C31H50O6Na (MNaþ) 541.3502. Calcd541.3505.
4.21. (5Z,8Z,11Z,14Z)-1,3-Dihydroxypropan-2-yl icosa-5,8,11,14-tetraenoate (10b)
C. antarctica: 48 mg, 67%; R. miehei: 54 mg, 75%; colorless oil.Rf¼0.30 (30% acetone/hexanes). The 1H and 13C spectral data (500and 100 MHz, CDCl3) are in agreement with literature values.33 IR(neat, cm�1) 3420, 2013, 2927, 1736, 1456. HRMS for C23H38O4Na(MNaþ) 401.2677. Calcd 401.2668.
4.22. 2-((4Z,7Z,10Z,13Z,16Z,19Z)-Docosa-4,7,10,13,16,19-hexaenoyloxy)propane-1,3-diyl diacetate (11a)
EDCI (111 mg, 0.58 mmol), DMAP (6 mg, 0.06 mmol), and diac-etin (44 mg, 0.25 mmol) were added to a solution of docosahex-aenoic acid (75 mg, 0.23 mmol) in anhydrous CH2Cl2 (5 mL) at 0 �C.The reaction mixture was allowed to stir for 4 h. Upon completion,the reaction mixture was diluted with CH2Cl2 and H2O. The organiclayer was separated, dried over MgSO4, and removed under re-duced pressure. The resulting residue was chromatographed onsilica gel (0e30% ethyl acetate/hexanes) to yield to 11a (111 mg,99%) as a colorless oil. Rf¼0.55 (30% ethyl acetate/hexanes). 1H NMR(500 MHz, chloroform-d) d¼5.47e5.32 (m,12H), 5.30e5.21 (m,1H),4.29 (dd, J¼4.4, 11.7 Hz, 2H), 4.16 (dd, J¼5.9, 12.2 Hz, 2H), 2.93e2.77(m,10H), 2.40 (d, J¼2.9 Hz, 4H), 2.14e2.02 (m, 6H), 0.98 (t, J¼7.6 Hz,3H). The 13C spectral data (100 MHz, CDCl3) and IR data are inagreement with literature values.32 HRMS for C29H42O6Na (MNaþ)509.2880. Calcd 509.2879.
4.23. (4Z,7Z,10Z,13Z,16Z,19Z)-1,3-Dihydroxypropan-2-yl-docosa-4,7,10,13,16,19-hexaenoate (11b)
C. antarctica: 45 mg, 63%; R. miehei: 63 mg, 76%; colorless oil.Rf¼0.29 (30% acetone/hexanes). 1H NMR (399 MHz, chloroform-d)d¼5.52e5.22 (m, 12H), 4.92 (quin, J¼4.6 Hz, 1H), 3.82 (t, J¼5.1 Hz,4H), 2.91e2.77 (m, 10H), 2.49e2.37 (m, 4H), 2.22 (t, J¼6.2 Hz, 2H),2.07 (quin, J¼7.5 Hz, 2H), 0.97 (t, J¼7.3 Hz, 3H). 13C NMR (100 MHz,chloroform-d) d¼173.5, 132.3 (2C), 129.8 (2C), 128.8, 128.6, 128.5(2C), 128.3 (2C), 128.1, 127.9, 75.4, 62.6 (2C), 34.4, 25.8 (5C), 23.0(2C), 20.8. IR (neat, cm�1) 3401, 3013, 2663, 1736, 1390. HRMS forC25H38O4Na (MNaþ) 425.2666. Calcd 425.2668.
4.24. 2-(Docosanoyloxy)propane-1,3-diyl dibutyrate (12a)
Yield 201 mg, 56%; colorless oil. Rf¼0.48 (15% ethyl acetate/hexanes). Mp¼27e28 �C. 1H NMR (399 MHz, chloroform-d)d¼5.32e5.23 (m, 1H), 4.30 (dd, J¼4.4, 11.7 Hz, 2H), 4.16 (dd, J¼5.9,11.7 Hz, 2H), 2.36e2.26 (m, 6H), 1.71e1.57 (m, 6H), 1.25 (s, 36H),0.95 (t, J¼7.3 Hz, 6H), 0.88 (t, J¼6.6 Hz, 3H). 13C NMR (100 MHz,chloroform-d) d¼173.4 (2C), 173.2, 69.1, 62.3 (2C), 36.0 (2C), 34.4,32.2, 29.95 (9C), 29.91 (2C), 29.88, 29.7, 29.6, 29.5, 29.3, 25.1, 22.9,18.6 (2C), 14.4, 13.9 (2C). IR (neat, cm�1) 2923. 2853, 1742, 1462.HRMS for C33H62O6Na (MNaþ) 577.4446. Calcd 577.4444.
4.25. 1,3-Dihydroxypropan-2-yl docosanoate (12b)
C. antarctica: 32 mg, 40%; R. miehei: 70 mg, 88%; white solid.Rf¼0.27 (30% acetone/hexanes). Mp¼79e80 �C. 1H NMR (399 MHz,chloroform-d) d¼4.93 (quin, J¼4.6 Hz, 1H), 3.88e3.81 (m, 4H), 2.38(t, J¼7.7 Hz, 2H), 2.08 (s, 2H), 1.69e1.59 (m, 2H), 1.38e1.19 (m, 36H),0.88 (t, J¼6.2 Hz, 3H). 13C NMR (100 MHz, chloroform-d) d¼174.3,75.2, 62.8 (2C), 34.6, 32.2, 31.8, 29.94 (7C), 29.90 (2C), 29.8, 29.7,29.6, 29.5, 29.3, 25.2, 22.94, 22.89, 14.4. IR (neat, cm�1) 3313, 297,2850, 1730, 1472. HRMS for C25H50O4Na (MNaþ) 437.3610. Calcd437.3607.
4.26. 2-(3-Phenylpropanoyloxy)propane-1,3-diyl dibutyrate(13a)
Yield 280 mg, 98%; colorless oil. Rf¼0.48 (35% ethyl acetate/hexanes). 1H NMR (399 MHz, chloroform-d) d¼7.33e7.25 (m, 2H),7.24e7.15 (m, 3H), 5.31e5.23 (m, 1H), 4.28 (dd, J¼4.4, 11.7 Hz, 2H),4.13 (dd, J¼5.9, 11.7 Hz, 2H), 2.96 (t, J¼7.7 Hz, 2H), 2.66 (t, J¼8.1 Hz,2H), 2.34e2.24 (m, 6H), 1.64 (sxt, J¼7.3 Hz, 4H), 0.94 (t, J¼7.3 Hz,6H). 13C NMR (100 MHz, chloroform-d) d¼173.3 (2), 172.2, 140.4,128.7 (2), 128.5 (2), 126.6, 69.4, 62.2 (2), 36.1 (2), 35.9, 31.0, 18.6 (2),13.9 (2C). IR (neat, cm�1) 3027, 2966, 2877, 1737, 1455. HRMS forC20H28O6Na (MNaþ) 387.1787. Calcd 387.1784.
4.27. 1,3-Dihydroxypropan-2-yl 3-phenylpropanoate (13b)
C. antarctica: 38 mg, 83%; R. miehei: 8 mg, 40%; white foam.Rf¼0.18 (40% acetone/hexanes). 1H NMR (399 MHz, chloroform-d)d¼7.36e7.28 (m, 2H), 7.26e7.18 (m, 3H), 4.89 (td, J¼4.5, 9.3 Hz, 1H),3.79e3.71 (m, 4H), 3.02e2.96 (m, 2H), 2.77e2.70 (m, 2H), 1.91e1.83(m, 2H). 13C NMR (100 MHz, chloroform-d) d¼175.2, 140.4, 128.8(2), 128.5 (2), 126.7, 75.5, 62.6 (2), 36.1, 31.8. IR (neat, cm�1) 3412,3029, 2935, 2881, 1731, 1454. HRMS for C12H16O4Na (MNaþ)247.0945. Calcd 247.0946.
4.28. 2-(5-Phenylpentanoyloxy)propane-1,3-diyl dibutyrate(14a)
Yield 298 mg, 99%; colorless oil. Rf¼0.63 (35% ethyl acetate/hexanes). 1H NMR (500 MHz, chloroform-d) d¼7.31e7.24 (m, 2H),7.21e7.14 (m, 3H), 5.31e5.23 (m, 1H), 4.30 (dd, J¼4.4, 11.7 Hz, 2H),4.14 (dd, J¼5.9, 11.7 Hz, 2H), 2.63 (t, J¼7.1 Hz, 2H), 2.35 (t, J¼6.8 Hz,2H), 2.29 (t, J¼6.8 Hz, 4H), 1.71e1.58 (m, 8H), 0.94 (t, J¼7.3 Hz, 6H).13C NMR (100 MHz, chloroform-d) d¼173.4 (2C), 172.9, 142.2, 128.6(2C), 128.6 (2C), 126.0, 69.2, 62.3 (2C), 36.1 (2C), 35.8, 34.2, 31.0,24.7, 18.6 (2C), 13.8 (2C). IR (neat, cm�1) 3028, 2965, 2876, 1738,1454. HRMS for C22H32O6Na (MNaþ) 415.2094. Calcd 415.2097.
4.29. 1,3-Dihydroxypropan-2-yl 5-phenylpentanoate (14b)
C. antarctica: 50 mg, 83%; R. miehei: 24 mg, 37%; white foam.Rf¼0.26 (40% acetone/hexanes). 1H NMR (399 MHz, chloroform-d)d¼7.31e7.25 (m, 2H), 7.22e7.13 (m, 3H), 4.92 (td, J¼4.8, 9.5 Hz, 1H),3.86e3.76 (m, 4H), 2.64 (t, J¼7.0 Hz, 2H), 2.41 (t, J¼7.0 Hz, 2H),2.17e2.11 (m, 2H), 1.74e1.60 (m, 4H). 13C NMR (100 MHz, chloro-form-d) d¼174.0, 142.2, 128.6 (4C), 126.1, 75.2, 62.7 (2C), 35.8, 34.4,31.0, 24.7. IR (neat, cm�1) 3414, 3027, 2936, 2882, 1731, 1454. HRMSfor C14H20O4Na (MNaþ) 275.1257. Calcd 275.1259.
Acknowledgements
We thank Dr. David Janero for helpful discussions. We thank Dr.Furong Sun at the School of Chemical Sciences, University of Illinoisat Urbana-Champaign, Urbana, IL for supplying HRMS data. We
K.M. Whitten et al. / Tetrahedron 68 (2012) 5422e5428 5427
![Page 243: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/243.jpg)
would like to acknowledge the financial support for this researchfrom NIDA (R03 DA029184-02).
Supplementary data
1H and 13C NMR spectra for all new compounds reported. Sup-plementary data associated with this article can be found in theonline version, at doi:10.1016/j.tet.2012.04.101.
References and notes
1. Lauridsen, J. J. Am. Oil Chem. Soc. 1976, 53, 400.2. Van Haften, J. J. Am. Oil Chem. Soc. 1979, 56, 831A.3. Pouton, C. W. Eur. J. Pharm. Sci. 2000, 11, S93.4. Christensen, M.; Hoy, C.; Becker, C.; Redgrave, T. Am. J. Clin. Nutr. 1995, 61, 56.5. Aberoumand, A. World J. Fish Marine Sci. 2010, 2, 226.6. Czernichow, S.; Thomas, C.; Bruckert, E. Br. J. Nutr. 2010, 104, 788.7. Legrand, P.; Rioux, V. Lipids 2010, 45, 941.8. Lambert, D. M.; Fowler, C. J. J. Med. Chem. 2005, 48, 5059.9. Ortega-Guti�errez, S.; Viso, A.; Cisneros, J. A. Curr. Top. Med. Chem. 2008, 8, 231.
10. Boswinkel, G.; Derksen, J.; van’t Riet, K.; Cuperus, F. J. Am. Oil Chem. Soc. 1996,73, 707.
11. Lyubachevskaya, G.; Boyle-Roden, E. Lipids 2000, 35, 1353.12. Martin, J. B. J. Am. Chem. Soc. 1953, 75, 5483.13. Kingsley, P. J.; Marnett, L. J. Anal. Biochem. 2003, 314, 8.14. Stelt, M. v. d.; Kuik, J. A. v.; Bari, M.; Zadelhoff, G. v.; Leeflang, B. R.; Veldink, G.
A.; Finazzi-Agro`, A.; Vliegenthart, J. F. G.; Maccarrone, M. J. Med. Chem. 2002,45, 3709.
15. Han, L.; Razdan, R. K. Tetrahedron Lett. 1999, 40, 1631.16. Seltzman, H. H.; Fleming, D. N.; Hawkins, G. D.; Carroll, F. I. Tetrahedron Lett.
2000, 41, 3589.17. Stamatov, S. D.; Stawinski, J. Tetrahedron 2005, 61, 3659.
18. Uwe, T. B. Enzyme Microb. Technol. 1995, 17, 578.19. Berger, M.; Laumen, K.; Schneider, M. J. Am. Oil Chem. Soc. 1992, 69, 955.20. Berger, M.; Schnelder, M. J. Am. Oil Chem. Soc. 1992, 69, 961.21. Piyatheerawong, W.; Yamane, T.; Nakano, H.; Iwasaki, Y. J. Am. Oil Chem. Soc.
2006, 83, 603.22. Irimescu, R.; Yasui, M.; Iwasaki, Y.; Shimidzu, N.; Yamane, T. J. Am. Oil Chem. Soc.
2000, 77, 501.23. Rosu, R.; Yasui, M.; Iwasaki, Y.; Yamane, T. J. Am. Oil Chem. Soc. 1999, 76, 839.24. Schmid, U.; Bornscheuer, U. T.; Soumanou, M. M.; McNeill, G. P.; Schmid, R. D.
Biotechnol. Bioeng. 1999, 64, 678.25. Byun, H.-G.; Eom, T.-K.; Jung, W.-K.; Kim, S.-K. Biotechnol. Bioprocess Eng. 2007,
12, 491.26. Waldinger, C.; Schneider, M. J. Am. Oil Chem. Soc. 1996, 73, 1513.27. Schmid, U.; Bornscheuer, U.; Soumanou, M.; McNeill, G.; Schmid, R. J. Am. Oil
Chem. Soc. 1998, 75, 1527.28. Soumanou, M. M.; Bornscheuer, U. T.; Schmid, U.; Schmid, R. D. Biocatal. Bio-
transfor. 1999, 16, 443.29. Soumanou, M.; Bornscheuer, U.; Schmid, R. J. Am. Oil Chem. Soc. 1998, 75, 703.30. Wongsakul, S.; Prasertsan, P.; Bornscheuer, U. T.; H-Kittikun, A. Eur. J. Lipid Sci.
Technol. 2003, 105, 68.31. Irimescu, R.; Iwasaki, Y.; Hou, C. J. Am. Oil Chem. Soc. 2002, 79, 879.32. Magnusson, C. D.; Haraldsson, G. G. Tetrahedron 2010, 66, 2728.33. Vadivel, S. K.; Whitten, K. M.; Makriyannis, A. Tetrahedron Lett. 2011, 52, 1149.34. Duclos, R. I.; Johnston, M.; Vadivel, S. K.; Makriyannis, A.; Glaser, S. T.; Gatley, S.
J. J. Org. Chem. 2011, 76, 2049.35. Halldorsson, A.; Magnusson, C. D.; Haraldsson, G. G. Tetrahedron 2003, 59, 9101.36. Takagi, T.; Ando, Y. Lipids 1991, 26, 542.37. Irimescu, R.; Furihata, K.; Hata, K.; Iwasaki, Y.; Yamane, T. J. Am. Oil Chem. Soc.
2001, 78, 743.38. Li, C.; Xu, W.; Vadivel, S. K.; Fan, P.; Makriyannis, A. J. Med. Chem. 2005, 48,
6423.39. Papahatjis, D. P.; Nahmias, V. R.; Nikas, S. P.; Schimpgen, M.; Makriyannis, A.
Chem.dEur. J. 2010, 16, 4091.40. Yao, F.; Li, C.; Vadivel, S. K.; Bowman, A. L.; Makriyannis, A. Bioorg. Med. Chem.
Lett. 2008, 18, 5912.
K.M. Whitten et al. / Tetrahedron 68 (2012) 5422e54285428
![Page 244: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/244.jpg)
Enzymatic synthesis of N-acylethanolamines: direct method for theaminolysis of esters
Kyle M. Whitten, Alexandros Makriyannis, Subramanian K. Vadivel ⇑Center for Drug Discovery, Department of Chemistry and Chemical Biology, 116 Mugar Hall, 360 Huntington Avenue, Northeastern University, Boston, MA 02115, USA
a r t i c l e i n f o
Article history:Received 16 July 2012Revised 7 August 2012Accepted 9 August 2012Available online 19 August 2012
Keywords:N-AcylethanolaminesCandida antarcticaEndogenous ligandAmidationBiocatalysis
a b s t r a c t
Immobilized Candida antarctica (Novozyme 435) catalyzed synthesis of N-acylethanolamines isdescribed. Treatment of methyl esters with lipase and amines yielded the desired amides within 2–24 h with yields ranging from 41% to 98%.
� 2012 Elsevier Ltd. All rights reserved.
N-Acylethanolamines (NAEs), ethanolamides of various long-chain fatty acids, constitute a class of bioactive lipid moleculesformed from glycerophospholipids through the phosphodiester-ase-transacylation pathway consisting of Ca2+-dependent N-acyltransferase and N-acylphosphatidylethanolamine-hydrolyzingphospholipase D.1,2 Among the NAEs, N-arachidonoylethanol-amine, known as anandamide (Fig. 1), is a physiologically impor-tant lipid signaling molecule acting as a receptor ligand in theendocannabinoid system and has been studied extensively.2
Recently, other NAEs such as palmitoylethanolamine and N-oleoylethanolamine (Fig. 1) also gained much attention due totheir anti-inflammatory and analgesic activities and anorexicactivity, respectively.3
NAEs including anandamide are not stored in the cell but ratherproduced on demand, and their endogenous levels are regulateddirectly by enzymes responsible for their formation and degrada-tion. Anandamide has a relatively rapid onset of action, but is rap-idly hydrolyzed by fatty acid amide hydrolase (FAAH) whichaccounts for its short duration of action. Early studies on struc-ture–activity relationships (SAR) focused on the preparationof various amides of arachidonic acid and established thatamides from chloroethylamine, cyclopropylamine, and R-(2)-aminopropanol showed excellent improvement in their respectiveaffinities to the cannabinoid CB1 receptor while exhibiting en-hanced metabolic stability toward FAAH.4–8 Recently, SAR studieson the modification of the hydrophobic chain have gained more
attention and various analogs with fully saturated fatty acid chainsor alternatively encompassed alkyne moieties were synthesized.Furthermore, our laboratory designed and synthesized high affinitycovalent anandamide probes for the CB1 receptor by introducingeither electrophilic isothiocyanato or a photoactivatable azidogroups at the terminal carbon of the arachidonic acid moiety.9 Wehave also studied the effect of aryl substitutions with variablemethylene linker at the distal end of arachidonic acid.10
All the synthetic schemes use the esters of the substituted fattyacids as a starting point and convert them to the needed amidesusing base mediated conventional hydrolysis of an ester to carbox-ylic acid followed by activation of carboxylic acid with either EDCIor CDI and treatment with various amines to provide the respective
O
NH
OH
O
NH
O
NH
H3C(H2C)14OH
OH
arachidonoylethanolamine(anandamide)
N-palmitoylethanolamine
N-oleoylethanolamine
Figure 1. Structures of N-acylethanolamines.
0040-4039/$ - see front matter � 2012 Elsevier Ltd. All rights reserved.http://dx.doi.org/10.1016/j.tetlet.2012.08.042
⇑ Corresponding author. Tel.: +1 617 373 7620; fax: +1 617 373 7493.E-mail address: [email protected] (S.K. Vadivel).
Tetrahedron Letters 53 (2012) 5753–5755
Contents lists available at SciVerse ScienceDirect
Tetrahedron Letters
journal homepage: www.elsevier .com/ locate/ tet le t
![Page 245: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/245.jpg)
amides. In few cases, a protected form of ethanolamine is also usedwhich, however, requires an additional deprotection step.
Several methods have been reported for the direct conversionof esters to amides including Mg(OCH3)2 and CaCl2,11 sodiumcyanide,12metal catalysts,13–15 and Alcalase.16 However, most of
these suffer from incomplete conversion, longer reaction times,and possible functional group instability of the final products un-der the conditions used. Here, we report a highly selective lipasemediated mild conversion of esters to biologically importantamides.
O
O
ImmobilizedCandida antarctica
H2NOH
O
NH
OH
hexanes/diisopropylether
Scheme 1. Amidation of esters with immobilized Candida antarctica.
Table 1Amidation of esters with immobilized Candida antarctica in 1:1 hexanes–diisopropylethera
Entry Ester Amine Amide
Isolated yield (%) Time (h)
1
O
O H2N 85 3
2
O
OH2N
OH 98 24
3
O
O H2NOH
89 2
4
OH
O
O H2NOH 85 24
5
N3
O
O H2N 60 24
6
O
OH2N
41 24
7
O
O H2N 85 3
8O
OH3C(H2C)14
H2N 84 3
9
O
O H2N95 24
10
O
O H2NOH 90 24
11
CO2Me
H2N 91 24
a Candida antarctica (Novozyme 435, 100 mg) and amine (0.24 mmol, 1.2 equiv) were added to a stirred solution of ester (0.20 mmol, 1 equiv) in a 1:1 mixture of hexanesand isopropyl ether (1 mL). The reaction was heated to 45 �C and stirred until completion (TLC monitoring). The reaction was diluted with diethyl ether, filtered, andconcentrated. The resulting residue was chromatographed on silica gel to yield the amide.
5754 K. M. Whitten et al. / Tetrahedron Letters 53 (2012) 5753–5755
![Page 246: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/246.jpg)
Lipases have found wide use as biocatalysts for many chemicaltransformations. Many lipases have been studied for their use inamide formation,17,18 such as, amidation of benzyl esters,19 synthe-sis of acetamides in the presence of ionic liquids,20 and acylation ofamines with acids.21 Most of these methods utilize either carbox-ylic acids or vinyl esters of carboxylic acids as reactants and thereactions require relatively high temperatures. In the kinetic reso-lution of amines, Nechab et al. reported that the reaction condi-tions required 80 �C and 3–10 h to acylate chiral amines withCandida antarctica (CAL) and ethyl acetate.22 The aminolysis oflinoleyl ethyl ester with ethanolamine, catalyzed by CAL, in a sol-vent free system produced the linoleylethanolamide only in 24%yield in 20 h including the presence of the unwanted o-acylationproduct.23 While these examples show the use of lipases for theamidation of esters, there is limited reported work on the use oflipases as a direct method for the synthesis of biologically activeNAEs with regard to functional group sensitivity common in thesynthesis of modified fatty acid moieties. We have thus focusedour efforts on the synthesis of biologically active NAEs with immo-bilized CAL from methyl esters and various amines. Developmentin this area will ameliorate the synthesis of multistep tail-modifiedN-acylethanolamines as well as other biologically important fattyacid amide analogs.
To optimize reaction conditions, we chose methyl arachidonateand cyclopropylamine as reactants and hexane as a solvent. Whencarried out at room temperature in the presence of immobilizedCAL, the reaction proceeded smoothly, but very slow as it required24 h for completion. When heated to 45 �C, reaction completionwas observed in a much improved 3 h. For amines not sufficientlysoluble in n-hexane, the reaction proceeded equally well in a 1:1hexanes–diisopropyl ether mixture (Scheme 1). The results areoutlined in Table 1.
Esters and amines were chosen based on their biologicalimportance. Thus methyl arachidonate was treated withcyclopropyl amine, ethanolamine, and (R)-2-aminopropanol to pro-vide arachidonoylcyclopropylamide (ACPA), anandamide, and R-methanandamide, respectively, in excellent yields. Unprotectedethanolamine was directly used in the preparation of variousethanolamides (2, 3, 4, and 10). When performed with a substitutedfatty acid carrying a terminal hydroxyl group (4) the reactionproceeded smoothly to provide the desired amide. There was noobservable transesterification product in any reactions wherehydroxyl groups were present either in the amine or the fatty acidmoieties. To investigate general applicability of the method, wechose various esters and amines and showed that reactions pro-ceeded within 24 h in good yield. Variation in yield was mainlydependent on the amine used. Primary amines, including benzylicamines, underwent amidation smoothly and in excellent yields after24 h. Conversely, cyclohexylamine exhibited slower reactivity withdecreased yield under the present conditions. Longer reaction timesand increased temperature did not improve the yield significantly.Esters of non-fatty acids (9, 10, and 11) underwent amidation withamines in excellent yields and in all the cases the reaction time ap-peared to be more dependent on the amine used.
In summary, we have demonstrated that CAL can be useful forachieving direct formation of amides from various amines andesters containing skipped polyenes, allyl alcohol, allyl azide,alkyne, and aryl moieties. The method described in this report, issimple, efficient, and environmentally friendly and does not re-quire any protection of other susceptible functional groups. Thistransacylation reaction provides excellent yields and is selective.It may find general utility in the synthesis of amides from the cor-responding esters without requiring prior hydrolysis of the esters,as it can be difficult to synthesize amides directly from esters un-der mild conditions. The method should prove to be useful in thesynthesis of drug intermediates and biologically important naturalproducts.
Acknowledgment
One of the authors (S.K.V.) acknowledges the financial supportfor this research from NIDA (R03 DA029184-02).
References and notes
1. Coulon, D.; Faure, L.; Salmon, M.; Wattelet, V.; Bessoule, J.-J. Plant Sci. 2012, 184,129–140.
2. Ezzili, C.; Otrubova, K.; Boger, D. L. Bioorg. Med. Chem. Lett. 2010, 20, 5959–5968.
3. Ueda, N.; Tsuboi, K.; Uyama, T. BBA—Mol. Cell Biol. L. 1801, 2010, 1274–1285.4. Abadji, V.; Lin, S.; Taha, G.; Griffin, G.; Stevenson, L. A.; Pertwee, R. G.;
Makriyannis, A. J. Med. Chem. 1994, 37, 1889–1893.5. Goutopoulos, A.; Fan, P.; Khanolkar, A. D.; Xie, X.-Q.; Lin, S.; Makriyannis, A.
Bioorg. Med. Chem. 2001, 9, 1673–1684.6. Bezuglov, V.; Bobrov, M.; Gretskaya, N.; Gonchar, A.; Zinchenko, G.; Melck, D.;
Bisogno, T.; Di Marzo, V.; Kuklev, D.; Rossi, J.-C.; Vidal, J.-P.; Durand, T. Bioorg.Med. Chem. Lett. 2001, 11, 447–449.
7. El Fangour, S.; Balas, L.; Rossi, J.-C.; Fedenyuk, A.; Gretskaya, N.; Bobrov, M.;Bezuglov, V.; Hillard, C. J.; Durand, T. Bioorg. Med. Chem. Lett. 2003, 13, 1977–1980.
8. Urbani, P.; Cavallo, P.; Cascio, M. G.; Buonerba, M.; De Martino, G.; Di Marzo, V.;Saturnino, C. Bioorg. Med. Chem. Lett. 2006, 16, 138–141.
9. Li, C.; Xu, W.; Vadivel, S. K.; Fan, P.; Makriyannis, A. J. Med. Chem. 2005, 48,6423–6429.
10. Yao, F.; Li, C.; Vadivel, S. K.; Bowman, A. L.; Makriyannis, A. Bioorg. Med. Chem.Lett. 2008, 18, 5912–5915.
11. Bundesmann, M. W.; Coffey, S. B.; Wright, S. W. Tetrahedron Lett. 2010, 51,3879–3882.
12. Hoegberg, T.; Stroem, P.; Ebner, M.; Raemsby, S. J. Org. Chem. 1987, 52, 2033–2036.
13. Gnanaprakasam, B.; Milstein, D. J. Am. Chem. Soc. 2011, 133, 1682–1685.14. Han, C.; Lee, J. P.; Lobkovsky, E.; Porco, J. A. J. Am. Chem. Soc. 2005, 127, 10039–
10044.15. Ishihara, K.; Kuroki, Y.; Hanaki, N.; Ohara, S.; Yamamoto, H. J. Am. Chem. Soc.
1996, 118, 1569–1570.16. Nuijens, T.; Cusan, C.; Kruijtzer, J. A. W.; Rijkers, D. T. S.; Liskamp, R. M. J.;
Quaedflieg, P. J. L. M. J. Org. Chem. 2009, 74, 5145–5150.17. Gotor, V. Bioorg. Med. Chem. 1999, 7, 2189–2197.18. Bistline, R.; Bilyk, A.; Feairheller, S. J. Am. Oil Chem. Soc. 1991, 68, 95–98.19. Adamczyk, M.; Grote, J. Tetrahedron Lett. 1996, 37, 7913–7916.20. Dhake, K. P.; Qureshi, Z. S.; Singhal, R. S.; Bhanage, B. M. Tetrahedron Lett. 2009,
50, 2811–2814.21. Tufvesson, P.; Annerling, A.; Hatti-Kaul, R.; Adlercreutz, D. Biotechnol. Bioeng.
2007, 97, 447–453.22. Nechab, M.; Azzi, N.; Vanthuyne, N.; Bertrand, M.; Gastaldi, S.; Gil, G. J. Org.
Chem. 2007, 72, 6918–6923.23. Couturier, L.; Taupin, D.; Yvergnaux, F. J. Mol. Catal. B: Enzym. 2009, 56, 29–
33.
K. M. Whitten et al. / Tetrahedron Letters 53 (2012) 5753–5755 5755
![Page 247: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/247.jpg)
Published: October 31, 2011
r 2011 American Chemical Society 972 dx.doi.org/10.1021/pr200735a | J. Proteome Res. 2012, 11, 972–981
ARTICLE
pubs.acs.org/jpr
Mass Spectrometric Characterization of HumanN-Acylethanolamine-hydrolyzing Acid AmidaseJay M. West, Nikolai Zvonok, Kyle M. Whitten, JodiAnne T. Wood, and Alexandros Makriyannis*
Center for Drug Discovery, Northeastern University, Boston, Massachusetts 02115, United States
’ INTRODUCTION
Interest in the recently cloned lysosomal enzyme NAAA hasincreased of late,1�3 driven in part by studies showing that PEAhas significant anti-inflammatory, analgesic, and neuroprotectiveproperties.4�6 These effects have been traced at least partially toits potent endogenous agonism of the peroxisome proliferator-activated receptor-α (PPAR-α).7,8
The potential of blocking N-acylethanolamines (NAEs) likePEA or N-arachidonlyethanolamine (anandamide) from enzy-matic degradation via inhibition as a strategy for pain treatmenthas received considerable interest of late.3 For example, anotherenzyme known to hydrolyze PEA, fatty acid amide hydrolase(FAAH), primarily hydrolyzes the endocannabinoid ananda-mide, and inhibitors of this enzyme have been the subjects ofclinical trials.9
Although functionally very similar to FAAH in its ability tohydrolyze the biologically significant NAEs anandamide andPEA, NAAA has no homology with it and is most similar inprimary amino acid sequence with acid ceramidase (30% homo-logy and 70% similarity), also a lysosomal enzyme, which hydro-lyzes ceramide to fatty acid and sphingosine.3 Possibly due to thelethal consequences of a rare congenital condition where acidceramidase is nonfunctioning (Farber disease), and the identifi-cation of acid ceramidase several decades ago, acid ceramidase is
better characterized than NAAA at present and appears to bebiochemically very similar.10,11 Both acid ceramidase and NAAAare glycoproteins that undergo removal of an N-terminal signalpeptide after biosynthesis, are believed to be transported by themannose-6-phosphate pathway to the acidic late endosomesand/or lysosomes, and are proteolytically activated by an auto-catalytic step under acidic conditions where the polypeptideis cleaved into two chains;10�12 the shorter chain forms theα-subunit (adopting the nomenclature used for acid ceramidasefor NAAA), and the longer chain forming the β-subunit contain-ing the catalytic nucleophile and N-terminal residue cysteine.The other two residues for both enzymes that make up thecatalytic triad, along with cysteine, are aspartate and arginine.
Like acid ceramidase, NAAA suffers from a complete lack ofthree-dimensional structural information, as no crystal or NMRderived structures with significant homology to either enzymeare available. Although homology models have been published inan attempt to map the active site residues for these enzymes,2,11
they may lack reliability as good structural models because ofsuch low homology (<20% amino acid identity) with the
Received: August 3, 2011
ABSTRACT: N-Acylethanolamine-hydrolyzing acid amidase(NAAA) is a lysosomal enzyme that primarily degrades palmi-toylethanolamine (PEA), a lipid amide that inhibits inflam-matory responses. We developed a HEK293 cell line stablyexpressing the NAAA pro-enzyme (zymogen) and a singlestep chromatographic purification of the protein from the me-dia. Matrix-assisted laser desorption/ionization time-of-flightmass spectrometry MALDI-TOF MS analysis of the zymo-gen (47.7 kDa) treated with peptide-N-glycosidase F (PNGaseF) identified 4 glycosylation sites, and acid cleavage of thezymogen into α- and β-subunits (14.6 and 33.3 kDa) activatedthe enzyme. Size exclusion chromatography estimated the massof the active enzyme as 45( 3 kDa, suggesting formation of anα/β heterodimer. MALDI-TOF MS fingerprinting covered morethan 80% of the amino acid sequence, including the N-terminalpeptides, and evidence for the lack of a disulfide bond between subunits. The significance of the cysteine residues was established by theirselective alkylation resulting in almost complete loss of activity. The purified enzyme was kinetically characterized with PEA and a novelfluorogenic substrate, N-(4-methyl coumarin) palmitamide (PAMCA). The production of sufficient quantities of NAAA and a highthroughput assay could be useful in discovering novel inhibitors and determining the structure and function of this enzyme.
KEYWORDS: endocannabinoid, glycosylation, lysosomal enzyme, mannose-6-phosphate, N-acylethanolamine, N-acylethanolamine-hydrolyzing acid amidase (NAAA), N-terminal nucleophile hydrolase, palmitoylethanolamine (PEA)
![Page 248: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/248.jpg)
973 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
structures available for other members of the choloylglycinehydrolase family, which is part of the N-terminal nucleophilehydrolase superfamily. One major obstacle in the pursuit of athree-dimensional structure for either of these enzymes is thedifficulty in producing sufficient quantities of highly pure protein.
To produce NAAA in sufficient quantity for an initial proteomic-based study, we used mammalian cells and modified expression andpurification protocols previously developed for acid ceramidase10
and for NAAA transiently expressed in HEK293T cells.12,13 Wehave established a HEK293 mammalian system stably expressingNAAA as a gateway for initial proteomic based enzyme character-ization and for assay development. This robust NAAA expressionsystem can be further used to obtain more detail on the post-translational protein modifications, identification of enzyme inhibi-tors, determination of the mechanisms of their action, and forstructural studies.
’EXPERIMENTAL SECTION
MaterialsStandard laboratory chemicals, buffers, culturemedia andmedia
components were purchased from Sigma-Aldrich (St. Louis, MO)and Fisher Chemical (Pittsburgh, PA). Restriction enzymes, DNAligase, and other molecular biology chemicals were obtained fromNew England Biolabs (Beverly, MA).
Vector ConstructionA full-length cDNA of human NAAA inserted into pcDNA
3.1(+) was kindly provided by Dr. Natsuo Ueda of the Departmentof Biochemistry, Kagawa University School of Medicine, Kagawa,Japan. The forward primer 50-TTAAGCTTGAGCCCGAGCC-30
and the reverse primer 50-TCCTCGAGGATCCTTTCTACTC-GGGTTTCT-30 containing incorporatedHindIII and XhoI restric-tion sites (underlined respectively) necessary for cloning, were usedfor PCRamplification of hNAAAcDNAusingPfuDNApolymerase(Stratagene, La Jolla, CA). The fragment was cleaved with therestriction enzymes HindIII and XhoI and inserted by ligation intothe pcDNA 3.1/myc-His C vector treated with the same enzymes.The ligated construct was transformed into One Shot Top10competent E. coli cells, colonies were screened by PCR for thecorrect insert size and DNA sequence was confirmed.
Stable TransfectionHEK293 wild-type cells (American Type Culture Collec-
tion, Manassas, VA) were cultured at 37 �C in a humidifiedincubator (5% CO2) using Dulbecco’s modified Eagle’s med-ium (DMEM) containing 10% fetal bovine serum (FBS), and1% penicillin-streptomycin (P/S). The day before transfectionapproximately 1� 106 HEK293 cells were split into two 75 cm2
culture plates. The purified plasmid pcDNA 3.1/myc-His Cconstruct containing NAAA (48 μg) was linearized with PvuIand added to 120 μL Lipofectamine 2000, then transferredinto the two culture plates of HEK293 cells according to themanufacturers protocol (Invitrogen). Transfected cells wereselected with 600 μg/mL G418 according to a previouslydetermined sensitivity of non transfected HEK293 cells to thisconcentration of antibiotic,14 and after approximately 14 daysindividual colonies were harvested, passed to new culture flasks,and tested for NAAA activity. These colonies with relativelyhigh enzymatic activity were eventually cryopreserved underliquid nitrogen and used for stable expression of NAAA asdetailed below.
Overexpression and PurificationHEK293 cells stably expressing NAAA (with C-terminal hexa-
histidine tag) were cultured at 37 �C in a humidified incubator(5% CO2) on 500 cm
2 plates in DMEMwith 10% FBS, P/S, and0.6 mg/mL Geneticin to approximately 90% confluency. Thenthe culture medium was exchanged for serum-free DMEM withP/S, 0.6 mg/mL Geneticin, and 10 mM NH4Cl and allowed toincubate for 48 h before harvest of the medium. The harvestedmedium was centrifuged at 1000� g for 10 min to removecontaminating cells and ammonium sulfate was added to 60%saturation in four aliquots at 4 �C over a period of one hour. Theculture medium was then centrifuged at 15000� g for 15 min at4 �C and the pellet resuspended in 2% original volume 40 mMphosphate buffer (pH 6.5), 500 mM NaCl (buffer A), anddialyzed into buffer A with two changes at 4 �C. The dialyzedsolution was centrifuged at 15000� g for 15 min at 4 �C, andincubated with approximately 1mL of Talon affinity resin per mgtotal protein for one hour at 4 �C. Thismixture was centrifuged at300� g for 5 min at 4 �C, and the resin washed twice for 15 minwith ten times the resin volume of buffer A containing 25 mMimidazole. The resin pellet was then transferred to a column andNAAA eluted with buffer A containing 150 mM imidazole. Theeluted fraction was dialyzed using 40 mM phosphate buffer(pH 6.5), 150 mM NaCl and 1 mM EDTA (buffer B) with twochanges at 4 �C. The purified protein concentration was deter-mined by the Bradford dye-binding microassay (Bio-Rad), andwas concentrated with Amicon Ultra-0.5 Centrifugal Filters,10 kDa membrane (Millipore), to approximately 2.5 mg/mL(∼50 μM) and stored at 4 �C.
Buffer Exchange ProcedureThe buffer containingNAAA protein was exchanged to another
buffer by reconcentrating 3 times to original volume after 25 folddilution with exchange buffer using 10 kDa membrane AmiconUltra-0.5 Centrifugal Filters (Millipore).
Converting Zymogen to Active Mature NAAA Enzyme byAcid Treatment
Citrate-phosphate buffer (100 mM), pH 4.5, was added topurifiedNAAA at a 4:1 v/v ratio of buffer to protein solution, andincubated for 2 h at 37 �C. For enzymatic assays the acidifiedNAAA was used directly.
Size Exclusion ChromatographyTo evaluate the molecular weight of the active enzyme, we
performed size exclusion chromatography using a Sephacryl-100column (25 � 1 cm). One-hundred micrograms of purifiedhuman NAAA was acidified, dialyzed into buffer B containing2 mM DTT and concentrated to a volume of 50 μL as describedin the previous sections. The concentrated enzyme was manuallyloaded onto the column, and buffer B with 2 mM DTT was runthrough the column at a flow rate of 0.1 mL/min. The molecularweight was determined under similar conditions according toAndrews,15 using the Bio-Rad Gel Filtration Standards: thyro-globulin (670 kDa), γ-globulin (158 kDa), bovine serum albumin(66 kDa, added to standards), ovalbumin (44 kDa), myoglobin(17 kDa), and Vitamin B12 (1750 Da).
SDS-PAGEProtein samples were denatured at 95 �C for 5 min in
Laemmli buffer, and were resolved in SDS-PAGE using AnykD (Bio-Rad) gels. After staining, a FluorChem ImagingSystem (Alpha Innotech Corp., San Leandro, CA) was usedto photograph the gels.
![Page 249: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/249.jpg)
974 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
N-(4-Methyl Coumarin)palmitamide (PAMCA) SynthesisPalmitic acid (50 mg, 0.195 mmol) was dissolved in a 1:1
mixture of anhydrous DMF/THF (5 mL) at 0 �C. This solutionwas treated with 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide(45mg, 0.26mmol), 4-dimethylaminopyridine (48mg, 0.39mmol),and 7-amino-4-methyl-coumarin (45 mg, 0.26 mmol). The solutionwas allowed to stir under argon for 24 h. The reaction mixture wasthen diluted with ether (10 mL), washed with water (5 mL), brine(5mL); and dried overMgSO4. The organic layer was concentratedunder reduced pressure and the resulting residue was chromato-graphed on silica gel (13:7 acetone:hexanes) to yield N-(4-methylcoumarin)palmitamide (49.5 mg, 61%) as a white solid. Mp =184�186 �C. 1H NMR (500 MHz, CHLOROFORM-d) δ ppm7.59 (dd, J = 2.0, 8.8 Hz, 1 H) 7.54 (d, J = 8.79 Hz, 1 H) 7.51(d, J = 1.46 Hz, 1 H) 7.29 (br. s., 1 H) 6.21 (s, 1 H) 2.42 (s, 3 H)2.36 (t, J = 7.57Hz, 1 H) 1.70 - 1.78 (m, 2H) 1.24 - 1.33 (m, 24H)0.88 (t, J = 6.8 Hz, 3 H).
NAAA AssayTo have an assay method more conducive to high-throughput
screening than those published for measuring the NAE hydro-lyzing activity of NAAA,2,16,17 we developed the fluorogenic PEAanalog PAMCA, which is hydrolyzed to fluorescent 7-amino-4-methyl coumarin (AMC) and palmitic acid. The assay procedureis similar to that used in the fluorescence-based assays for FAAHand MGL with each point done in triplicate; to each well of a 96well plate 180 μL of 100 mM citrate-phosphate buffer (pH 4.5)containing 3 mMDTT, 0.1% Triton X-100, 0.05% BSA, 150 mMNaCl (assay buffer used by Tsuboi et al.) with 100 ng of purified,acid treated enzyme was added, followed by 20 μL of a dimethylsulfoxide (DMSO) solution containing PAMCA (final concen-tration ranging from 0.5 to 80 μM for the saturation curveexperiment), and then 10 min incubation on a shaking platform.To analyze the activity of the enzyme fractions after the gelfiltration chromatography 10 μL aliquots were added in the samemanner as above with PAMCA at a final concentration of 5 μM.After shaking, the reaction was allowed to proceed at 37 �C for30 min, with fluorescence readings taken every 10 min at a wave-length of 460 nm (using an excitation wavelength of 360 nm) ona Synergy HT Plate Reader using Gen5 software from Bio-Tek.The enzyme activity was calculated by converting the relativefluorescence units to AMC formed, using a standard curve ofAMC dissolved in 10%DMSO-assay buffer. In order to determineenzymatic activity with the native substrate PEA, the purifiedNAAA was first activated by acid treatment as previously de-scribed. The acid treated NAAA (20 ng) was incubated withvarious concentrations of PEA (ranging from 2.5 to 120 μM) in100 μL 10% DMSO-assay buffer for 30 min at 37 �C; eachconcentration was run in duplicate. Blanks, containing assay bufferwithout enzyme, for each PEA concentration were run simulta-neously in duplicate. The reaction was terminated and extractedwith previously published methods.18�20 In short, a mixture ofacetone and ethanol (2:1, v/v) containing deuterated PEA as theinternal standardwas added to each sample,mixed and centrifugedat 4 �C for 5 min at 16000� g. The supernatants were collectedand evaporated under nitrogen stream. Phosphate buffered saline(pH 7.4), methanol and chloroform (100:100:200 μL) wereadded to each sample followed by vigorous vortexing and cen-trifugation. The bottom chloroform fraction was collected anddried under nitrogen stream. Samples were reconstituted in500 μL ethanol and analyzed using LC�MS/MS according to ourpreviously publishedmethods,18�20 using a TSQQuantumUltra
triple quadrupole mass spectrometer (Thermo Electron, SanJose, CA) with an Agilent 1100 HPLC on the front end (AgilentTechnologies, Wilmington, DE). Separation was achieved usingan Agilent Zorbax SB-CN column (2.1 � 50 mm, 5 μm) withgradient elution using 10 mM ammonium acetate (solvent A,pH 7.3) and 100%methanol (solvent B). Eluted peaks were ionizedvia atmospheric pressure chemical ionization (APCI) and de-tected by their respective selected reaction monitoring (SRM)transitions. Enzyme activity was calculated from the decrease inPEA concentration, comparing the blank samples to the enzymesamples. Michaelis�Menten constants were calculated using proFit software (Quantum Soft, Uetikon am See, Switzerland) and aLevenberg�Marquardt algorithm.
MALDI-TOF MS AnalysisBeforeMS analysis or tryptic digestion of activematureNAAA
the acid buffer was exchanged to 50 mM ammonium bicarbonatebuffer as described earlier. For analysis of the intact proteinmasses, 0.5 μL (1.25 μg) of the protein was mixed with 0.5 μLsinapinic acid matrix solution (5 mg/mL dissolved in 50%acetonitrile, 50% water, and 0.1% trifluoroacetic acid) andspotted onto an Opti-TOF 384-well plate insert. For the trypsindigested protein samples, 0.5 μL (1.25 μg) of the digest wasmixed with 0.5 μL α-cyano-4-hydroxycinnaminic acid matrixsolution (5 mg/mL dissolved in 50% acetonitrile, 50% water, and0.1% trifluoroacetic acid) and spotted onto an Opti-TOF 384-well plate insert. MALDI-TOF MS spectra were acquired on a4800 MALDI TOF/TOF mass spectrometer (Applied Biosys-tems, Foster City, CA) fitted with a 200-Hz solid state UV laser(wavelength 355 nm). Spectra of the intact proteins wereacquired in linear mode, and spectra of the peptides wereacquired in reflectron mode. The conditions used for the MSexperiments and instrument calibration were performed asdescribed by Zvonok et al.21
Deglycosylation of Zymogen and Active Mature NAAAProtein for MALDI TOF MS Analysis
To obtain samples of deglycosylated NAAA compatible withMALDI TOF MS analysis, the purified zymogen (10 μg) wasmixed with 1500 units of PNGase F (New England Biolabs,Ipswich, MA) in 50 mM phosphate buffer, pH 7.5, and incubatedfor 48 h at 37 �C.DeglycosylatedNAAA samples were exchangedto 50mM ammonium bicarbonate buffer as described earlier, andspectra were obtained in linear mode using MALDI TOF MSaverage mass measurement. For trypsin digestion the matureNAAA protein was deglycosylated using PNGase F according tothe manufacturer’s protocol as follows: 10 μg of purified, acidtreated enzyme was exchanged into 50mMphosphate buffer, pH7.5, concentrated to 10 μL, denatured by heating for 10 min at90 �C, followed by addition of nonionic detergent NP-40 (finalconcentration 1%) and 500 units of PNGase F and incubation fortwo hours at 37 �C. After deglycosylation the proteins wereresolved by SDS-PAGE, coomassie stained, and the bands wereexcised for trypsin in-gel digestion as described below.
Tryptic DigestionTen micrograms of purified, acid treated NAAA was ex-
changed to 50 mM ammonium bicarbonate buffer, concentratedto 10 μL, and incubated overnight at 37 �C with MS-gradetrypsin (“Trypsin Gold”, Promega) at a NAAA/trypsin mass tomass ratio of 100:1. For the PNGase treated samples, in-geltrypsin digestion was performed. Protein bands were excisedfrom comassie stained SDS-PAGE gels (10 μg protein loaded
![Page 250: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/250.jpg)
975 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
into the lane), washed five times with 1 mL ammonium bicar-bonate buffer with shaking for 10min at 37 �C, washed twice with100% acetonitrile for 5 min at room temperature, followed byremoval of the acetonitrile, and then drying the gel pieces for onehour at room temperature. The gel pieces were rehydrated with20 μL 50 mM ammonium bicarbonate buffer containing anappropriate amount of trypsin and incubated overnight at 37 �C.To test the oxidation state of the cysteines, 20 μg of purified, acidtreated enzyme was exchanged to 50 mM ammonium bicarbo-nate buffer and concentrated to 20 μL. NAAA was split into twosamples and in one an aliquot of N-ethylmaleimide (NEM) wasadded to a final concentration of 10 mM, or nothing, andincubated for one hour at room temperature. To the NEMtreated sample dithiothreitol (DTT) was added to a finalconcentration of 25 mM and incubated at 55 �C for one hour.Then an aliquot of iodoacetamide (IAM) was added to theNEM/DTT treated sample to a final concentration of 50 mMand incubated for one hour at room temperature. The NEM/DTT/IAM treated sample along with the untreated controlsample were digested overnight at 37 �C with trypsin at a 100:1NAAA/trypsin ratio.
’RESULTS AND DISCUSSION
Overexpression, Purification, and Kinetic Characterizationof Recombinant Human NAAA
Our initial attempts to overexpress and purify a sufficient amountof NAAA protein for a mass spectrometric characterization andassay development by transient transfection of HEK293T cells werenot very efficient.However, stable transfection ofHEK293 cellswithNAAA cDNA cloned into the pcDNA 3.1 myc-His vector yieldedsignificantly greater quantities of enzyme. The purification of thezymogen from lysed cells and from the culture media afterammonium chloride treatment stimulated secretion of the lyso-somal proteins from the HEK293 cells, similar to the methodpreviously reported,12,13 were simultaneously pursued. The latter
method13 was optimized and found to provide a greater quantityand quality of the lysosomal NAAA, compared to cell lysate thatcontained along with zymogen all cellular components. Virtuallyall zymogen (95%) was precipitated by addition of ammoniumsulfate to 60% saturation following secretion into media,providing partially enriched samples of NAAA. Because theisoelectric point of the pro-enzyme with a hexa-histidine tagwas estimated to be almost neutral (pI 7.3), mildly acidicconditions (pH 6.5) were chosen to avoid protein precipitationand decrease nonspecific binding of other proteins to the IMACresin. This was deemed important as we found albumin(abundant in the media) nonspecifically binding to the Talon
Figure 2. (A) Linear mode MALDI-TOF mass spectra of purifiedhuman NAAA containing the α-subunit, β-subunit, and pro-enzyme(α+β). (B)Majority of the pro-enzyme was converted into theα- and β-subunits after 2 h acid treatment at 37 �C. (C) Purified enzyme after 48 htreatment with PNGase F at 37 �C under native conditions; intense peakat 34810 m/z is that of PNGase F.
Figure 1. SDS-PAGE analysis of human NAAA purification overex-pressed by HEK293 cells. Ten micrograms total protein was loaded intoeach lane. Lane 1, molecular weight markers; lane 2, proteins from themedia precipitated with 60% ammonium sulfate; lane 3, 25 mMimidazole IMACwash fraction; lane 4, 150mM imidazole IMAC elutionfraction; lane 5, 2 h acid treatment of purified NAAA at 37 �C.
![Page 251: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/251.jpg)
976 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
resin (identified by excising the 65 kDa band from SDS-PAGEand performing in-gel tryptic digestion and analysis by MALDI-TOF-MS, data not shown). Extensive washing of the resin withphosphate buffer containing a relatively high concentration ofimidazole (25 mM) removed the rest of albumin, and afterelution with phosphate buffer containing 150 mM imidazole wecalculated an overall 75% yield of the enzyme from the NAAAprotein secreted into the media.
As demonstrated by SDS-PAGE and the MALDI-MS spectrashown in Figure 1 and 2A, the protein obtained was nearly pureandmainly in the proenzyme form, although a significant amountof the α- and β-subunits were present. This is similar to previousresults reported for NAAA and acid ceramidase purified fromthe culture media,10,13 and the ratio of proenzyme to α- andβ-subunits in the purified protein varied somewhat from batch tobatch. Taking into account that conversion of the zymogen intoheterodimer, consisting of α- and β-subunits, was ultimatelynecessary to obtain active enzyme for biochemical studies, we didnot pursue to control or prevent a cleavage of some of thezymogen during purification.
Kinetic characterization of the purified active maturehNAAA enzyme was performed by using an LC-MS methodol-ogy previously reported by our laboratory,18�20 where wemeasured enzymatic activity by determining the decrease inPEA concentration. The purified enzyme displayedMichaelis�Menten kinetics, as shown in Figure 3A, with a Km for PEA of21( 3 μM and a Vmax of 5.4( 0.6 nmol/μg/min, similar to thepreviously reported values of a Km of 35 μM and Vmax of1.8 nmol/μg/min for the NAAA enzyme purified from ratlung.22 The maximal velocity of the enzymatic reaction appears
to be somewhat limited by the relatively low solubility of PEA in10%DMSO aqueous assay buffer, as the specific activity did notincrease above a concentration of approximately 40 μM. Weobserved this sharp leveling off of the activity at higher PEAconcentrations every time we repeated the saturation curveexperiment. To simplify and accelerate NAAA activity de-termination in enzyme assays, particularly the screening ofinhibitors, the novel fluorogenic compound PAMCA wassynthesized and tested as a substrate for enzyme. The enzymedisplayed Michaelis�Menten kinetics for PAMCA hydrolysis,with an observed of Km of 6.2( 0.7 μM, as shown in Figure 3B,indicative that the binding affinity of NAAA for this compound issimilar to or slightly greater than that for PEA. The maximalvelocity was 2 orders of magnitude lower, similar to the slowerrate of hydrolysis observed for FAAH andMGL with fluorogenicsubstrates as compared to the natural substrates.21,23 However,the sensitivity, precision, minimal sample handling, and highthroughput capacity of the fluorescent assay more than make upfor the relatively low rate of catalysis with the fluorogenicsubstrate.
Figure 3. Kinetic studies of purified mature human NAAA enzyme (A)with the native substrate palmitoylethanolamine, performed by usingLC�MS/MS assay and (B) with the fluorogenic substrate N-(4-methylcoumarin)palmitamide in fluorescent assay. Assays were performed at37 �C in pH 4.5 buffer, and data were fit to the Michaelis�Mentenequation using a Levenberg�Marquardt algorithm. Mean values ( SDare shown.
Figure 4. Molecular weight of active mature NAAA estimated by sizeexclusive chromatography using a Sephacryl-100 column. SDS-PAGE ofSephacryl-100 column load and elution fractions; lane 1, molecularweight markers; lane 2, purified NAAA; lane 3, purified NAAA after 2 hacid treatment that was loaded onto column; lanes 4�14, eluted columnfractions 5�15 (A). Relative activity of column fractions measured withfluorogenic assay using 10 μL aliquots of each fraction (B). Peak activityobserved in column fraction 7 (lane 6), corresponding to a calculatedmolecular weight of 45 ( 3 kDa.
![Page 252: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/252.jpg)
977 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
Evaluation of the Molecular Weight of the Active MatureEnzyme by Size Exclusion Chromatography
Human acid ceramidase, the closest known homologue toNAAA with 70% similarity and 33% identity in amino acidsequence, is a heterodimer composed of α- and β-subunits;10,11
however, NAAA purified from rat lung was found to have onlythe β-subunit.22 Western blot and immunoprecipitation analysisof FLAG tag purified active and inactive mature hNAAAsuggested that the α- and β-subunits formed a complex.12 Toobtain more evidence confirming the subunit structure of theactive mature hNAAA enzyme we performed size exclusivechromatography studies using a Sephacryl S-100 column cali-brated by running a mixture of protein standards. The purifiedzymogen after cleavage by acid treatment, dialysis, and concen-tration was loaded on calibrated Sephacryl S-100 column andelution fractions were collected. The fractions activities weremeasured with the PAMCA substrate hydrolysis assay, while theprotein composition of the fractions were determined using SDS-PAGE analysis. As shown in lane 3 of Figure 4A, the purifiedzymogen was mostly cleaved, formingα- and β-subunits after theincubation at acidic pH. The highest amount of α- and β-subunitsand peak of hydrolyzing activity was observed in elution fractions
7�8 (lane 6�7 of Figure 4A and B). The molecular weight ofprotein in fractions 7�8 was estimated based on calibratedstandard curve as 45 ( 3 kDa, suggesting that the active matureNAAA enzyme is a heterodimer.
MALDI-TOF-MS Analysis of Zymogen, Its Processing andDeglycosylation
As shown in Figure 2A, the linear mode MALDI-TOF massspectrum of the purified enzyme sample confirmed the previousSDS-PAGE results that NAAA had been purified to near homo-geneity. The majority of purified enzyme was in the zymogenform, with an average mass of 47.7 kDa, however the α- andβ-subunits also were observed (14.5 and 33.2 kDa, respectively).In addition, the relative broadness of the peaks suggests that thepurified enzyme pool is heterogeneous due to the variablemodifications of the oligosaccharide side chains in N-glycosy-lated protein. After incubation of the zymogen under acidicconditions, the linear mode MALDI-TOF mass spectrum shownin Figure 2B confirmed that the enzyme had been nearlycompletely converted into the active form comprising the twomain peaks belonging to the α- and β-subunits with an averagemass of 14.6 and 33.3 kDa, respectively.
Figure 5. MALDI-TOFMS spectra of trypsin digest of (A) mature NAAA and (B) deglycosylated mature NAAA obtained in reflectron mode. (Insets)Zoom scan area 2500�3500 Da obtained in linear mode.
![Page 253: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/253.jpg)
978 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
We encountered significant difficulty using both enzymatic andchemical approaches in obtaining a fully deglycosylated sample ofNAAA to determine the molecular weight of the enzyme withoutthe oligosaccharide chains. The glycoamidase PNGase F, thatcleaves between the innermost N-acetylglucosamine (GlcNAc)and asparagine resides in N-glycosylated proteins, is the mosteffective with denatured samples, while heat denaturation of NAAAwithout detergents caused the protein to precipitate. Alternatively,the added SDS kept the protein in solution, however it completelysuppressed MS signal detection. Chemical deglycosylation usingtrifluoromethanesulfonic acid24 treatment of lyophilized NAAAresulted in the loss of the protein. Therefore we used a relativelyhigh concentration of PNGase F and incubated with non denaturedNAAA over extended periods (1�3 days) at 37 �C. After 48 hincubation we observed partial deglycosylation (Figure 2C), whilebeyond this time the NAAA proteins could not be detected byMALDI or by SDS-PAGE. It is likely that NAAA is much morestable in its glycosylated form, similar to previous observations withother N-glycosylated proteins.25�27 The spectrum in Figure 2C,obtained at 48 h incubation with PNGase F, shows peaks represent-ing both the fully de- and glycosylated forms, as well as partiallydeglycosylatedNAAA intermediates. The fully deglycosylated forms
were observed in linear mode MALDI-TOFMS as: α-subunit withan average mass of 10972 Da, which is relatively close to thetheoretical mass of 10966Da, the β-subunit with an averagemass of29659 Da, which is close to the theoretical mass of 29662 Da, andthe pro-enzyme with an average mass of 40593 Da, also close to thetheoreticalmass of 40610Da.Thepartially deglycosylatedβ-subunitand zymogen intermediates, as shown in Figure 2C, are comprisedof groups of two and four individual peaks, respectively. Thedistance between peaks in each group is approximately 1500 Da,corresponding to the incremental removal of the N-linked oligo-saccharide chains from glycosylation sites, which is in agreementwith the typical mass of a high mannose type oligosaccharide that isphosphorylated (∼1500 Da).28 Therefore, there are a total of 4 and2 glycosylation sites in the zymogen and in each of the subunits,respectively. Our result agrees with a previous site-directed muta-genesis study of NAAA that identified 4 actual N-glycosylation sites(Asn37, Asn107, Asn309, and Asn333) out of 6 predicted.12
MALDI-TOF MS Fingerprinting of Tryptic Digest of Glycosy-lated and Deglycosylated Mature NAAA
We performed the trypsin digestion of glycosylated and degly-cosylated mature NAAA and characterized the obtained peptides
Table 1. MALDI-TOF MS Fingerprinting of the Purified Mature Human NAAA Digested with Trypsin
position peptide sequences with mass exceeding 500 Da m/z calculated m/z measured error (ppm)
T1/29�35 SPPAAPR 695.3835 695.3828 �0.99T2/36�47 FNVSLDSVPELR 1376.7056b 1376.698 �5.52T3/48�53 WLPVLR 783.4876 783.4904 3.6
T4/54�61 HYDLDLVR 1030.5316 1030.5302 �1.41T5/62�71 AAMAQVIGDR 1031.5302 1031.5302c 0
T7/75�82 WVHVLIGK 951.5774 951.5658 �12.19T8/83�89 VVLELER 857.5091 857.5087 �0.43T9/90�100 FLPQPFTGEIR 1304.6997 1304.7002 0.38
T10-αa/101�125 GMCDFMNLSLADCLLVNLAYESSVF 2755.2486
T10-βa/126�135 CTSIVAQDSR 1079.515 1079.5109 �3.8T10-β+IAM C(IAM)TSIVAQDSR 1136.5364 1136.533 2.992
T10-β+NEM C(NEM)TSIVAQDSR 1204.5627 1204.5626 0.083
T11/136�142 GHIYHGR 839.4271 839.4293 2.65
T12/143�153 NLDYPFGNVLR 1307.6743 1307.6743 0
T14/155�163 LTVDVQFLK 1062.6194 1062.6024 �15.98T15/164�188 NGQIAFTGTTFIGYVGLWTGQSPHK 2680.3518 2680.3652 5.01
T16/189�196 FTVSGDER 910.4265 910.4551 31.39
T18/199�211 GWWWENAIAALFR 1619.8118 1619.7942 �10.87T20/213�221 HIPVSWLIR 1120.6626 1120.6652 2.29
T21/212�236 ATLSESENFEAAVGK 1552.7489 1552.7358 �8.41T23/240�256 TPLIADVYYIVGGTSPR 1821.9745 1821.9734 �0.61T24/257�263 EGVVITR 773.4516 773.4504 �1.5T26/266�283 DGPADIWPLDPLNGAWFR 2039.9974 2040.0183 10.25
T27/284�296 VETNYDHWKPAPK 1584.7805 1584.7699 �6.69T28/297�300 EDDR 534.2154 534.2266 21.01
T30/302�306 TSAIK 519.3137 519.2904 �44.8T31/307�348 ALNATGQANLSLEALFQILSVVPVYNNLTIYTTVMSAGSPDK 4458.2901
T32/349�352 YMTR 570.2704 570.2725 3.61
T37/363�369 GHPFEQK 842.4155 842.4346 22.67
T38/370�387 LISEEDLNMHTGHHHHHH 2180.9791 2180.9756 �1.6aT10 peptide is split into two peptides belonging to different subunits after acid treatment, which was performed prior to trypsin digest. bCalculatedmolecular weight of the T2 peptide was corrected for conversion of asparagine to aspartic acid after deglycosylation by PNGaseF. cT5 monoizotopicpeak coincides with more abundant the T4 + 1 Da isotope peak.
![Page 254: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/254.jpg)
979 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
by MALDI-TOF MS fingerprinting (Figure 5). The majority ofthe tryptic peptides with a mass exceeding 500 Da were identified(Table 1) with good mass accuracy (the error typically less than10 ppm and at most 45 ppm between the calculated andmeasuredmasses). We were unable to directly observe the T5 peptide(1031.5302 m/z), most likely because T4 (1030.5316 m/z) wasthe more prominent peptide and its +1 Da isotope peak coincidedwith monoisotopic mass of T5. Analysis of the expected andobserved isotope distribution curves for the T4 and T5 peptidesrevealed their overlapping and confirmed the presence of bothpeptides in the tryptic digest.
It was previously suggested12 that either the first 27 or 28amino acids represent a signal sequence of nascent NAAAprotein, necessary for the translocation of a pro-enzyme intothe endoplasmic reticulum. We identified in the tryptic digestof mature NAAA an ion at 695.4 m/z that after MS/MSfragmentation was confidently assigned to the sequence SPPAAPR(amino acid 29�35 in prepro-enzyme) corresponding to theT1 peptide (Figure 6A). Therefore, the signal peptidase cleavesprepro-enzyme after the signal peptide between the 28th and29th amino acid residues, resulting in an N-terminal serine inthe α-subunit.
The Cys126 of human NAAA was presumed to be located atthe N-terminus of the β-subunit, similar to Cys131 in purified ratlung NAAA,14and shown to be essential for the proteolyticcleavage of the pro-enzyme.12 The cysteine 126 to alaninemutant was unable to undergo self-proteolysis and convert fromthe pro-enzyme to the active mature form,12 leaving someambiguity of it is importance for activity. Here we showed the
significance of the cysteine residue(s) for enzyme activity by theirselective alkylation in mature NAAA, as alkylation by either IAMor NEM resulted in an almost complete loss of activity. We wereable to detect the 1079.5 m/z ion corresponding to the T10-βpeptide and perform its MS/MS analysis, confirming that theN-terminal residue of the β-subunit of the human enzyme is acysteine (Figure 6B).
In an MS based investigation of acid ceramidase all 6 cysteineswere found to be involved in the formation of 3 disulfide bridges,one linking the two subunits, while the two other are locatedin the β-subunit.10 Unexpectedly, the N-terminal cysteine ofβ-subunit that was supposed to be the catalytic nucleophile isinvolved in formation of an intrasubunit disulfide bridge.10 Thereare a total of three cysteines in the primary amino acid sequenceof humanNAAA (two in the α-subunit, Cys103 and Cys113, andone in the b\β-subunit, Cys126). Thus, disulfide bridge formationbetween two subunits is possible only if Cys126 of β-subunitis involved. To determine the oxidation state of Cys126 weperformed a series of cysteine alkylation and reductionexperiments of mature NAAA followed by trypsin digestionand MALDI TOF MS analysis. The treatment of the enzymewith alkylation reagent (IAM or NEM), followed by reductionwith DTT and exposure to the second alkylation reagent (NEMor IAM) should determine whether the cysteine is in a reduced(labeled with the first reagent) or an oxidized state (labeled afterreduction with the second reagent). We performed the experi-ment by reversing the order in which IAM and NEM were usedto ensure the results were not dependent on the reactivity ofthese reagents. When IAM was the first reagent used in the
Figure 6. MALDI-TOF MS/MS analysis of the NAAA tryptic peptides containing the N-terminal sequences of (A) α- and (B) β-subunits.
![Page 255: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/255.jpg)
980 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
treatment of mature NAAA, followed by DTT reduction andNEM alkylation, in the trypsin digest we observed a peptide witha molecular weight of 1136.64 m/z that was not present in thenon-alkylated control. Analysis by MS/MS fragmentation re-vealed this peptide to have the sequence CTSIVAQDSR, withthe carbamidomethylated cysteine (data not shown). We ob-served neither nonalkyated (1079.52 m/z), nor NEM modifiedpeptide (1204.56 m/z) with that sequence. When NEM wasadded first, followed by DTT reduction and IAM treatment, onlythe NEM alkylated peptide (1204.56 m/z) was identified intryptic digested mature NAAA. In addition, as previously notednearly all enzymatic activity was extinguished after alkylation byeither IAM or NEM, strongly suggesting that cysteine 126 at theN-terminus of the β-subunit is the catalytic nucleophile and notinvolved in disulfide bridge formation with α-subunit.
There are four actual N-glycosylation sites in mature NAAAthat should be found after trypsin digest in three predictedN-glycosylated peptides � T2NGlc, T10-αNGlc, and T312NGlc.The group of peaks starting at 2593m/z and ending at 3077m/zwas detected using MALDI TOF analysis (Figure 5A, insert) ofmature NAAA digested with trypsin. In the tryptic digest of thedeglycosylated mature NAAA those peaks are not present, whilewe clearly observe the 1376 m/z T2 peptide (Figure 5B, insert).The difference inmass between peptides in this group and the T2peptide is in the range 1200�1700 Da, close to the average massof the oligosaccharide chains we determined from the linearmode MALDI-TOF MS analysis of the intact mature anddeglycosylated enzyme. The most intense 2593 and 3077 m/zpeaks were subjected MS/MS analysis, however we were unableto obtain good quality fragmentation data to identify thestructure and composition of the oligosaccharide chains attachedto glycosylation site in these peptides. The detailed posttransla-tional mature NAAA characterization is beyond the scope of thisinitial proteomic analysis, and will be undertaken later.
We were unable to observe the two other glycosylated ordeglycosylated T10-α and T31 peptides in the trypsin digest ofmature or PNGase F treated NAAA usingMALDI TOFMS. Thedetection of glycosylated peptides was compromised likely dueto heterogeneous glycosylation producing several glycoforms asis typical inN-glycosylated proteins,29 resulting in signal intensityspreading into a group of peaks and their relatively high masses.In addition, extraction of deglycosylated peptides after in geltrypsin digestion was possibly not efficient enough to observethem in the MALDI TOF MS spectra.
Overall, 26 of the 28 total tryptic peptides with masses higherthan 500 Da, covering more than 80% of the mature NAAAamino acid sequence, were identified using MALDI TOF MSfingerprinting.
’CONCLUSION
We established a HEK293 cell line stably expressing humanNAAA and developed a relatively simple single chromatographicstep purification that together are capable of yielding milligramquantities of pure enzyme. We kinetically characterized thepurified human enzyme, and developed a fluorescent assay basedon a novel fluorogenic substrate PAMCA, that has comparableaffinity to the native substrate PEA and allows for a more efficienthigh throughput screening of enzyme inhibitors. We confirmedthe number of glycosylation sites and determined the molecularweights of the fully glycosylated and deglycosylated forms of theenzyme, along with the approximate molecular weights of the
oligosaccharide chains. Our results suggest that the structure ofthe active mature form of the enzyme is a heterodimer, consistingof a non-covalent complex of the α- and β-subunits. MALDITOF MS fingerprinting covered more than 80% of the matureNAAA amino acid sequence including theN-terminal peptides ofthe α- and β-subunits. The putative catalytic nucleophile, whichis the N-terminal cysteine 126 residue of the β-subunit, wasdemonstrated to be in a reduced state. The loss of virtually allenzymatic activity of mature NAAA treated with IAM or NEMwas correlated with cysteine 126 alkylation, determined byMS/MSanalysis of the tryptic digest. Our work establishes that HEK293NAAA expression and purification can provide adequate enzymequantities for more detailed future proteomic analysis, pharmaco-logical characterization and structural studies.
’AUTHOR INFORMATION
Corresponding Author*Alexandros Makriyannis, Ph.D., Northeastern University Centerfor Drug Discovery, 116 Mugar Life Sciences Building, 360Huntington Avenue, Boston, MA 02115. E-mail: [email protected]. Tel.: 617-373-4200. Fax: 617-373-7493.
’ACKNOWLEDGMENT
We thank Prof. Natsuo Ueda, Prof. Kazuhito Tsuboi, and Dr.Toru Uyama for the kind gift of the full length human NAAAclone, a NAAA antibody, and for the valuable advice provided.We thank Dr. Yazen Jmiean and Mahmoud Nasr for experi-mental assistance. This work was supported by grants DA003801,DA007312, and DA009158 from the National Institutes ofHealth/National Institute on Drug Abuse. The views expressedin this publication do not necessarily reflect the official policies ofthe Department of Health and Human Services; nor doesmention by trade names, commercial practices or organizationsimply endorsement by the U.S. Government.
’REFERENCES
(1) Solorzano, C.; Antonietti, F.; Duranti, A.; Tontini, A.; Rivara, S.;Lodola, A.; Vacondio, F.; Tarzia, G.; Piomelli, D.; Mor, M. Synthesis andstructure-activity relationships of N-(2-oxo-3-oxetanyl)amides as N-acyl-ethanolamine-hydrolyzing acid amidase inhibitors. J. Med. Chem. 2010,53 (15), 5770–81.
(2) Solorzano, C.; Zhu, C.; Battista, N.; Astarita, G.; Lodola, A.;Rivara, S.; Mor, M.; Russo, R.; Maccarrone, M.; Antonietti, F.; Duranti,A.; Tontini, A.; Cuzzocrea, S.; Tarzia, G.; Piomelli, D. SelectiveN-acylethanolamine-hydrolyzing acid amidase inhibition reveals a keyrole for endogenous palmitoylethanolamide in inflammation. Proc. Natl.Acad. Sci. U.S.A. 2009, 106 (49), 20966–71.
(3) Ueda, N.; Tsuboi, K.; Uyama, T. N-acylethanolamine metabo-lism with special reference to N-acylethanolamine-hydrolyzing acidamidase (NAAA). Prog. Lipid Res. 2010, 49 (4), 299–315 .
(4) Calignano, A.; La Rana, G.; Giuffrida, A.; Piomelli, D. Control ofpain initiation by endogenous cannabinoids. Nature 1998, 394 (6690),277–81.
(5) Calignano, A.; La Rana, G.; Piomelli, D. Antinociceptive activityof the endogenous fatty acid amide, palmitylethanolamide. Eur. J.Pharmacol. 2001, 419 (2�3), 191–8.
(6) Lambert, D. M.; Vandevoorde, S.; Jonsson, K. O.; Fowler, C. J.The palmitoylethanolamide family: a new class of anti-inflammatoryagents? Curr. Med. Chem. 2002, 9 (6), 663–74.
(7) LoVerme, J.; Fu, J.; Astarita, G.; LaRana,G.; Russo, R.; Calignano,A.; Piomelli, D. The nuclear receptor peroxisome proliferator-activated
![Page 256: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/256.jpg)
981 dx.doi.org/10.1021/pr200735a |J. Proteome Res. 2012, 11, 972–981
Journal of Proteome Research ARTICLE
receptor-alpha mediates the anti-inflammatory actions of palmitoyletha-nolamide.Mol. Pharmacol. 2005, 67 (1), 15–9.(8) O’Sullivan, S. E. Cannabinoids go nuclear: evidence for activa-
tion of peroxisome proliferator-activated receptors. Br. J. Pharmacol.2007, 152 (5), 576–82.(9) Jhaveri, M. D.; Richardson, D.; Chapman, V. Endocannabinoid
metabolism and uptake: novel targets for neuropathic and inflammatorypain. Br. J. Pharmacol. 2007, 152, 624–32.(10) Schulze, H.; Schepers, U.; Sandhoff, K. Overexpression and
mass spectrometry analysis of mature human acid ceramidase. Biol.Chem. 2007, 388 (12), 1333–43.(11) Shtraizent, N.; Eliyahu, E.; Park, J. H.; He, X.; Shalgi, R.;
Schuchman, E. H. Autoproteolytic cleavage and activation of humanacid ceramidase. J. Biol. Chem. 2008, 283 (17), 11253–9.(12) Zhao, L. Y.; Tsuboi, K.; Okamoto, Y.; Nagahata, S.; Ueda,
N. Proteolytic activation and glycosylation of N-acylethanolamine-hydrolyzing acid amidase, a lysosomal enzyme involved in the endocanna-binoid metabolism. Biochim. Biophys. Acta 2007, 1771 (11), 1397–405.(13) Wang, J.; Zhao, L. Y.; Uyama, T.; Tsuboi, K.; Tonai, T.; Ueda,
N. Amino acid residues crucial in pH regulation and proteolyticactivation of N-acylethanolamine-hydrolyzing acid amidase. Biochim.Biophys. Acta 2008, 1781 (11�12), 710–7.(14) Pei, Y.; Mercier, R. W.; Anday, J. K.; Thakur, G. A.; Zvonok,
A. M.; Hurst, D.; Reggio, P. H.; Janero, D. R.; Makriyannis, A. Ligand-Binding Architecture of Human CB2 Cannabinoid Receptor: Evidencefor Receptor Subtype-Specific Binding Motif and Modeling GPCRActivation. Chem. Biol. 2008, 15 (11), 1207–19.(15) Andrews, P. Estimation of the molecular weights of proteins by
Sephadex gel-filtration. Biochem. J. 1964, 91 (2), 222–33.(16) Saturnino, C.; Petrosino, S.; Ligresti, A.; Palladino, C.; De
Martino, G.; Bisogno, T.; Di Marzo, V. Synthesis and biologicalevaluation of new potential inhibitors of N-acylethanolamine hydrolyz-ing acid amidase. Bioorg. Med. Chem. Lett. 2010, 20 (3), 1210–3.(17) Tsuboi, K.; Sun, Y. X.; Okamoto, Y.; Araki, N.; Tonai, T.; Ueda,
N. Molecular characterization of N-acylethanolamine-hydrolyzing acidamidase, a novel member of the choloylglycine hydrolase family withstructural and functional similarity to acid ceramidase. J. Biol. Chem.2005, 280 (12), 11082–92.(18) Williams, J.; Wood, J.; Pandarinathan, L.; Karanian, D. A.; Bahr,
B. A.; Vouros, P.; Makriyannis, A. Quantitative method for the profilingof the endocannabinoid metabolome by LC-atmospheric pressurechemical ionization-MS. Anal. Chem. 2007, 79 (15), 5582–93.(19) Wood, J. T.; Williams, J. S.; Pandarinathan, L.; Courville, A.;
Keplinger, M. R.; Janero, D. R.; Vouros, P.; Makriyannis, A.; Lammi-Keefe, C. J. Comprehensive profiling of the human circulating endo-cannabinoid metabolome: clinical sampling and sample storage para-meters. Clin. Chem. Lab. Med. 2008, 46 (9), 1289–95.(20) Wood, J. T.; Williams, J. S.; Pandarinathan, L.; Janero, D. R.;
Lammi-Keefe, C. J.; Makriyannis, A. Dietary docosahexaenoic acidsupplementation alters select physiological endocannabinoid-system metabolites in brain and plasma. J. Lipid Res. 2010, 51 (6),1416–23.(21) Zvonok, N.; Williams, J.; Johnston, M.; Pandarinathan, L.;
Janero, D. R.; Li, J.; Krishnan, S. C.; Makriyannis, A. Full mass spectro-metric characterization of human monoacylglycerol lipase generated bylarge-scale expression and single-step purification. J. Proteome Res. 2008,7 (5), 2158–64.(22) Ueda, N.; Yamanaka, K.; Yamamoto, S. Purification and
characterization of an acid amidase selective for N-palmitoylethanol-amine, a putative endogenous anti-inflammatory substance. J. Biol.Chem. 2001, 276 (38), 35552–7.(23) Ramarao,M. K.;Murphy, E. A.; Shen,M.W.;Wang, Y.; Bushell,
K. N.; Huang, N.; Pan, N.;Williams, C.; Clark, J. D. A fluorescence-basedassay for fatty acid amide hydrolase compatible with high-throughputscreening. Anal. Biochem. 2005, 343 (1), 143–51.(24) Edge, A. S. Deglycosylation of glycoproteins with trifluoro-
methanesulphonic acid: elucidation of molecular structure and function.Biochem. J. 2003, 376 (Pt 2), 339–50.
(25) Arakawa, T.; Prestrelski, S. J.; Kenney, W. C.; Carpenter, J. F.Factors affecting short-term and long-term stabilities of proteins. Adv.Drug Deliv. Rev. 2001, 46 (1�3), 307–26.
(26) Baker, H. M.; Day, C. L.; Norris, G. E.; Baker, E. N. Enzymaticdeglycosylation as a tool for crystallization of mammalian bindingproteins. Acta Crystallogr., D: Biol. Crystallogr. 1994, 50 (Pt 4), 380–4.
(27) Sola, R. J.; Griebenow, K. Effects of glycosylation on thestability of protein pharmaceuticals. J. Pharm. Sci. 2009, 98 (4), 1223–45.
(28) Varki, A.; Kornfeld, S. Structural studies of phosphorylatedhigh mannose-type oligosaccharides. J. Biol. Chem. 1980, 255 (22),10847–58.
(29) Marino, K.; Bones, J.; Kattla, J. J.; Rudd, P. M. A systematicapproach to protein glycosylation analysis: a path through themaze.Nat.Chem. Biol. 2010, 6 (10), 713–23 .
![Page 257: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/257.jpg)
Biochemical and Mass Spectrometric Characterization ofHuman N-Acylethanolamine-Hydrolyzing Acid AmidaseInhibitionJay M. West, Nikolai Zvonok, Kyle M. Whitten, Subramanian K. Vadivel, Anna L. Bowman,
Alexandros Makriyannis*
Northeastern University, Center for Drug Discovery, Boston, Massachussetts, United States of America
Abstract
The mechanism of inactivation of human enzyme N-acylethanolamine-hydrolyzing acid amidase (hNAAA), with selectedinhibitors identified in a novel fluorescent based assay developed for characterization of both reversible and irreversibleinhibitors, was investigated kinetically and using matrix-assisted laser desorption/ionization time-of-flight massspectrometry (MALDI-TOF MS). 1-Isothiocyanatopentadecane (AM9023) was found to be a potent, selective and reversiblehNAAA inhibitor, while two others, 5-((biphenyl-4-yl)methyl)-N,N-dimethyl-2H-tetrazole-2-carboxamide (AM6701) and N-Benzyloxycarbonyl-L-serine b-lactone (N-Cbz-serine b-lactone), inhibited hNAAA in a covalent and irreversible manner. MSanalysis of the hNAAA/covalent inhibitor complexes identified modification only of the N-terminal cysteine (Cys126) of theb-subunit, confirming a suggested mechanism of hNAAA inactivation by the b-lactone containing inhibitors. Theseexperiments provide direct evidence of the key role of Cys126 in hNAAA inactivation by different classes of covalentinhibitors, confirming the essential role of cysteine for catalysis and inhibition in this cysteine N-terminal nucleophilehydrolase enzyme. They also provide a methodology for the rapid screening and characterization of large libraries ofcompounds as potential inhibitors of NAAA, and subsequent characterization or their mechanism through MALDI-TOF MSbased bottom up-proteomics.
Citation: West JM, Zvonok N, Whitten KM, Vadivel SK, Bowman AL, et al. (2012) Biochemical and Mass Spectrometric Characterization of Human N-Acylethanolamine-Hydrolyzing Acid Amidase Inhibition. PLoS ONE 7(8): e43877. doi:10.1371/journal.pone.0043877
Editor: Andreas Hofmann, Griffith University, Australia
Received June 25, 2012; Accepted July 30, 2012; Published August 31, 2012
Copyright: � 2012 West et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permitsunrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
Funding: This work was supported by grants DA003801, DA007312, and DA009158 from the National Institutes of Health/National Institute on Drug Abuse. Thefunders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
Competing Interests: The authors have declared that no competing interests exist.
* E-mail: [email protected]
Introduction
Current pharmacological strategies in drug development
targeting the endocannabinoid system are focused on the discovery
of therapeutic agents that selectively modulate the cannabinergic
signaling for the treatment of human disorders, without being
accompanied by undesirable psychotropic side effects [1,2,3].
Toward this goal, two principal endocannabinoid enzymes, fatty
acid amide hydrolase (FAAH) and monoacylglycerol lipase
(MGL), are promising candidates for drug discovery, by modu-
lating the effects of the two principal endocannabinoids,
anandamide (AEA) and 2-arachidonylglycerol (2-AG), respective-
ly, at the cannabinoid receptors 1 and 2 (CB1 and CB2) [4,5].
Other important bioactive fatty acid amides, such as N-
palmitoylethanolamine (PEA), N-oleoylethanolamine (OEA) and
oleamide (OA), with no or very low affinity for the cannabinoid
receptors, are potential substrates in FAAH and N-acylethanola-
mine-hydrolyzing acid amidase (NAAA) regulated metabolism.
NAAA is a lysosomal enzyme that carries out hydrolysis of fatty
acid amides, with its highest activity against PEA [6]. It has been
suggested that the anti-inflammatory, analgesic, and neuroprotec-
tive properties of PEA are mainly due to the activation of
peroxisome proliferator-activated receptor alpha (PPAR-a), and
also in part by activation of the GPR55 and GPR119 receptors
[7,8,9]. Therefore interest in NAAA as a target for novel
therapeutics has been increasing of late [10,11,12], yet unlike
FAAH and MGL there is a complete lack of direct structural
information on the enzyme. The amino acid sequence of hNAAA
has 34% identity with human acid ceramidase (hAC), another
lysosomal enzyme that is not well characterized, which hydrolyzes
ceramide to sphingosine and free fatty acid [13,14]. A very limited
homology of hNAAA and hAC to conjugated bile acid hydrolase
(CBAH) from Clostridium Perfringens, with an available X-ray
structure [15], has been used to generate homology models for
both proteins [12,16]. All three enzymes belong to the cysteine N-
terminal nucleophile (Ntn) hydrolase superfamily, each with the
highly conserved amino acid catalytic triad of Cys, Arg and Asp
[17,18]. CBAH is a single chain protein whose biological assembly
is a homotetramer [15], whereas hNAAA and hAC after self-
catalyzed cleavage of the zymogen at the catalytic nucleophile
Cys126 and Cys143, respectively, under acidic conditions form a-
and b- subunits [16,19]. The hNAAA mutant with Cys126 to
serine substitution was resistant to self-proteolysis and remained
inactive [19]. The precursor zymogen is most likely inactive but
the active mature form of the enzyme is a heterodimer, consisting
of a non-covalent complex of the a- and b-subunits [19,20]. Site-
directed mutagenesis identified four actual N-glycosylation sites in
hNAAA, which were confirmed by our laboratory in a recent
PLOS ONE | www.plosone.org 1 August 2012 | Volume 7 | Issue 8 | e43877
![Page 258: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/258.jpg)
study using mass spectrometry [19,20]. A putative hNAAA
catalytic triad of amino acid residues Cys126, Arg142 and
Asp145 has been predicted from the highly conserved nature of
these residues in the cysteine Ntn hydrolase superfamily and site-
directed mutagenesis experiments, which also identified Glu195 as
a key determinant of acidic cleavage, and suggested that Asn287
plays an important role in proteolytic zymogen activation [19,21].
Recently a mechanism of catalysis via a zwitterionic N-terminal
cysteine in CBAH was proposed based on computational analyses
of free energy simulations and suggested that NAAA may cleave its
substrates using the same catalytic strategy [22].
Previously we overexpressed hNAAA in stably transfected
HEK293 cells and purified the enzyme in an amount sufficient
for its biochemical and proteomic characterization [20]. We have
further optimized hNAAA expression to obtain a three-fold
increase of hNAAA yield. Additionally we developed novel high
throughput fluorescent inhibitor assays for characterization of both
reversible and irreversible hNAAA inhibitors and identified several
potent inhibitors in our compound libraries. 1-isothiocyanatopen-
tadecane (AM9023) is a potent, selective and reversible hNAAA
inhibitor, while 5-((biphenyl-4-yl)methyl)-N,N-dimethyl-2H-tetra-
zole-2-carboxamide (AM6701) and N-Benzyloxycarbonyl-L-serine
b-lactone (N-Cbz-serine b-lactone) inhibit hNAAA in a covalent
and time-dependent manner. The mechanisms of hNAAA
inactivation by AM9023, AM6701 and N-Cbz-serine b-lactone
were investigated using kinetic and MS experimental approaches.
MALDI-TOF analysis of the tryptic digest of hNAAA treated with
AM6701 or N-Cbz-serine b-lactone inhibitor identified modifica-
tion only for the N-terminal cysteine (Cys126) of the b-subunit.
Materials and Methods
MaterialsStandard laboratory chemicals, buffers, culture media and
media components were purchased from Sigma-Aldrich and
Fisher Chemical. AM6701 was made as previously described [23].
N-Cbz-serine b-lactone was purchased from TCI America.
Synthesis of 1-isothiocyanatopentadecane, AM90231,19-thiocarbonyldipyridin-2(1H)-one (65 mg, 0.28 mmol) was
added to a suspension of 1-aminopentadecane (50 mg, 0.22 mmol)
in 5 mL of anhydrous CH2Cl2. Upon completion (0.5 h) the
reaction was quenched with water and the organic layer was
separated and concentrated. The resulting residue was chromato-
graphed on silica to yield AM9023 (55 mg, 94%) as a colorless oil.1H NMR (500 MHz, CHLOROFORM-d) d 3.51 (t, J = 6.80 Hz,
2H), 1.69 (td, J = 6.84, 15.14 Hz, 2H), 1.36–1.44 (m, 2H), 1.21–
1.34 (m, 22H), 0.88 (t, J = 6.84 Hz, 2H). 13C NMR (126 MHz,
CHLOROFORM-d) d 127.3, 45.3, 32.2, 30.2, 30.0, 29.96, 29.94,
29.92 (2C), 29.8, 29.7, 29.6, 29.1, 26.8, 23.0, 14.4. IR (neat) cm21
2924, 2854, 2185, 2090. HRMS for C16H30NS (M-H+) 268.2111.
Calcd. 268.2099.
hNAAA overexpression and purificationThe hNAAA expression and purification was performed as
previously described, with the exception that ammonium chloride
stimulated secretion of zymogen into media was repeated three
times for the same cells, effectively tripling our hNAAA yield [20].
In brief, HEK293 cells stably expressing human NAAA with a C-
terminal hexa-histidine tag were cultured at 37uC in a humidified
incubator (5% CO2) on 500 cm2 plates in DMEM with 10% FBS,
1% penicillin-streptomycin (P/S), and 0.6 mg/mL Geneticin to
approximately 90% confluency. The FBS containing culture
medium was exchanged for 50 ml (per culture plate) serum-free
DMEM with 1% P/S, 0.6 mg/mL Geneticin, 10 mM NH4Cl,
and allowed to incubate for 48 hours. This step was repeated two
more times at 48 hour intervals, with the medium centrifuged to
remove cells and debris and the proteins were precipitated by
adding ammonium sulfate to 60% saturation. The remainder of
the purification was as previously described [20]. The day that
assays or covalent labeling were performed 100 mM citrate-
phosphate buffer, pH 4.5, was added to purified NAAA at a 4:1 v/
v ratio and incubated for 2 hours at 37uC in order to activate the
enzyme.
Fluorometric assay to determine hNAAA inhibition usingN-(4-methyl coumarin)palmitamide (PAMCA) substrate
We previously described the fluorogenic substrate N-(4-methyl
coumarin)palmitamide (PAMCA), which is hydrolyzed by NAAA
to the fluorescent compound 7-amino-4-methyl coumarin (AMC)
and palmitic acid [20]. For hNAAA inhibition we conducted three
point concentration assays with compounds to determine their
potencies and ranges of enzyme inhibition. Purified activated
NAAA (final concentration of 0.25 mg/mL) was incubated in assay
buffer [20] made up to a total volume of 180 mL, followed by
addition of the compound dissolved in 10 mL DMSO (along with
DMSO neat for the control sample) with the final concentrations
for each compound of 1, 10, and 100 mM, in triplicate on a 96 well
plate. These samples were allowed to incubate for 15 min at room
temperature and then 10 mL of a PAMCA stock solution in
DMSO (final PAMCA concentration 10 mM) was added. After
5 minutes of agitation on a shaking plate, the reaction was allowed
to proceed at 37uC for 30 minutes and enzyme activity was
monitored and calculated as previously described [20].
For compounds that inhibited hNAAA in the range of
IC50,1 mM full inhibition curves using eight different concentra-
tions of inhibitor (8 point assay) were generated. To set up 8 point
fluorescent and radioactive assays for each point, the compound in
45 mL DMSO and purified activated NAAA (final enzyme
concentration of 0.25 mg/mL) in 810 mL of NAAA assay buffer
were incubated for 2 hours in order for the covalent compounds to
reach full inhibition. For the fluorescent assays, 190 mL of each of
the above samples (in triplicate) were transferred to a 96 well plate,
followed by addition of 10 mL of a PAMCA stock solution in
DMSO for a final PAMCA concentration of 10 mM. After
5 minutes of agitation on a shaking plate, the reaction was allowed
to proceed at 37uC for 30 minutes and enzyme activity was
monitored and calculated as previously described [20]. The
complete description of the novel fluorescent 8 point assay to
determine the IC50 value for compounds inhibiting hNAAA
activity will be detailed elsewhere.
Radioactive assay to determine IC50 value for reversibleNAAA inhibition using [1,2 214C]N-palmitoylethanolaminesubstrate
The 8 point radioactive assays, similar to that described by
Saturnino et. al., [10] were performed by taking 95 mL of the
enzyme-compound solution described above and adding a 5 mL
solution of [1,2 214C]N-palmitoylethanolamine (10,000 c.p.m./
sample) in DMSO, with a final PEA concentration of 25 mM. The
reaction was performed for 30 minutes at 37uC and terminated by
addition of 200 mL chloroform/methanol (1:1, v/v). The aqueous
layer containing the [1,2 214C]Ethanolamine was quantified by
reading with a 1450 Microbeta Walluc Trilux Liquid Scintillation
and Luminescence Counter. Inhibition constants were calculated
using pro Fit software (Quantum Soft, Uetikon am See,
Switzerland) and a Levenberg-Marquardt algorithm.
Characterization of Human NAAA Inhibition
PLOS ONE | www.plosone.org 2 August 2012 | Volume 7 | Issue 8 | e43877
![Page 259: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/259.jpg)
Fluorometric assay to determine kinact/Ki value forirreversible hNAAA inhibition
The kinact and KI values for covalent inhibitors were determined
similar to Mileni et. al. [24] The fluorescence-based assays were
performed as above with the following exceptions: fluorescence
readings were initiated immediately (data were collected for
120 minutes at 30 second intervals) after mixing the inhibitor
compound and PAMCA substrate (final concentration of
12.4 mM = 26Km) with NAAA in the assay buffer using a
PerkinElmer Wallac EnVision 2104 Multilabel reader to monitor
the fluorescence. The data for each inhibitor concentration ([I])
were fit to a first order equation (Eq. 1) shown below using
KaleidaGraph (Synergy Software, Reading, PA) in order to
determine kobserved (kobs), where Ft is the fluorescence at time t, F0 is
the fluorescence at t = infinite time, F1 is the total fluorescence
change, and kobs is the first order rate constant for enzyme
inactivation. To determine the inhibitor dissociation constant (KI)
and the first order rate constant for enzyme inactivation at infinite
inhibitor concentration (kinact), the kobs values for each [I] obtained
above were fit to a curve using pro Fit software and a Levenberg-
Marquardt algorithm according to Eq. 2, which simplifies to Eq. 3
at [S] = 26Km as used in this experiment.
Ft~F0{F1e{kobst ð1Þ
kobs~kinact½I�
½I�zKI 1z½S�Km
� � ð2Þ
kobs~kinact½I�½I�z3 KIð Þ
ð3Þ
Trypsin digestion of hNAAA treated with inhibitorsTo 10 mg (0.2 nmol) of purified and activated NAAA in 18 mL
of 100 mM citrate-sodium phosphate buffer (pH 4.5) 2 mL of a
DMSO solution containing 2 nmol of the compound of interest
were added or 2 mL DMSO. The inhibitor and DMSO treated
enzyme solutions were incubated at 37uC for 2 hours and then
desalted prior to digestion. These were desalted by re-concentrat-
ing 3 times to original volume after 25 fold dilution with 50 mM
ammonium bicarbonate buffer, pH 8.0, using 10 kDa membrane
Ultra-0.5 Centrifugal Filters (Millipore). The NAAA samples were
incubated overnight at 37uC with MS-grade trypsin (‘‘Trypsin
Gold’’, Promega) at a NAAA:trypsin mass to mass ratio of 100:1.
The tryptic digested NAAA was analyzed immediately or frozen at
280uC for future analysis.
MALDI-TOF-MS Analysis0.5 mL of the trypsin digested NAAA was mixed with 0.5 mL a-
cyano-4-hydroxycinnaminic acid matrix solution (5 mg/mL dis-
solved in 50% acetonitrile, 50% water, and 0.1% trifluoroacetic
acid) and spotted onto an Opti-TOF 384-well plate insert.
MALDI-TOF MS spectra were acquired on a 4800 MALDI
TOF/TOF mass spectrometer (Applied Biosystems, Foster City,
CA) fitted with a 200-Hz solid state UV laser (wavelength
355 nm). The spectra of the peptides were acquired in reflectron
mode. The conditions used for the MS experiments and
instrument calibration were performed as described by Zvonok
et. al. [25]
Molecular ModelingThe sequence for human NAAA was taken from the SWISS-
PROT protein sequence database (amino acids 126–359 primary
accession number Q02083). The homology model of hNAAA was
constructed using the crystal structure of conjugated bile acid
hydrolase (CBAH) from Clostridium Perfringens (PDB ID: 2BJF) [15]
as a template in Prime (1.6 ed., Schrodinger, LLC, New York,
NY). An initial BLAST alignment between the two sequences was
adjusted by taking secondary structure into account using SSpro
and PSIPRED [26]. This alignment was further refined manually
to superimpose Asn204 and Asn287 of hNAAA with Asn82 and
Asn175 of CBAH respectively as previously suggested [12]. The
resultant alignment (13% identity, 21% homology, 34% gaps) was
used for construction of the initial hNAAA model. Loops 2–6 and
8–14 were refined using an ab initio loop prediction algorithm. The
loop refinement step deletes the loop and reconstructs it from a
backbone dihedral library; the loop is then exhaustively sampled to
identify the lowest energy conformation. All other loops featured
mainly homologous residues and contained no gaps or insertions.
The protein underwent a truncated-Newton energy minimization,
using the OPLS_2005 all-atom force field and a Generalized Born
continuum solvation model.
AM6701 and N-Cbz-serine b-lactone were prepared for docking
using the LipPrep (2.2 ed., Schrodinger, LLC, New York, NY)
protocol and the OPLS_2005 force field. The ligands were docked
to hNAAA using the extra precision (XP) procedure in Glide (5.6
ed., Schrodinger, LLC, New York, NY). The top pose for each
ligand was then used to create the product for reaction. A covalent
bond was imposed between the carbonyl carbon of the ligand and
the sulfur atom of Cys126, for AM6701 the leaving group was
removed and for N-Cbz-serine b-lactone the ring was opened.
Atom types were reassigned and the entire system underwent
minimization.
Results and Discussion
hNAAA overexpression and purificationThe multiple harvesting of media containing the secreted
enzyme, after the stimulation of lysosomal protein secretion via
ammonium chloride treatment of the HEK293 cells, was used to
increase the yield of overexpressed hNAAA. With this modifica-
tion the stably transfected HEK293 cells with hNAAA construct
produces ,1 mg of IMAC purified enzyme per 56103 cm2
culture plate area (106500 cm2 culture plates). This amount of
enzyme is sufficient for 26104 data points in fluorescence-based
inhibition assays (,200696 well plates) with 50 ng enzyme per
well, enough to generate full inhibition curves for approximately
800 compounds. All other steps of hNAAA purification were
similar to previously described.16
Kinetic analysis of hNAAA inhibition by AM9023,AM6701, and N-Cbz-serine b-lactone
We previously introduced the novel fluorogenic compound N-
(4-methyl coumarin) palmitamide (PAMCA), which has an affinity
for hNAAA comparable to the native substrate PEA (Km 6.2 mM
and 21 mM for PAMCA and PEA, respectively), and which is
enzymatically hydrolyzed to the fluorescent 7-amino-4-methyl
coumarin (AMC) and palmitic acid [20]. Although the rate of
PAMCA versus PEA hydrolysis is two orders of magnitude slower
the sensitivity, set up time, safety, and rapid readout of the
fluorescence assay makes it superior to the radioactivity based
Characterization of Human NAAA Inhibition
PLOS ONE | www.plosone.org 3 August 2012 | Volume 7 | Issue 8 | e43877
![Page 260: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/260.jpg)
assay methods. Therefore, PAMCA was selected as a substrate to
develop a high throughput fluorescent inhibition assay to discover
novel hNAAA inhibitors, similar to assays with FAAH and MGL
enzymes [25,27]. We first performed 3 point assay screens of our
compound library to identify potential inhibitors of PAMCA
hydrolysis by hNAAA. The enzyme and compounds at concen-
trations of 1, 10 and 100 mM (3 point assays) were pre-incubated
for 15 min followed by addition of the substrate PAMCA and then
monitoring the increase in fluorescence. For selected compounds
we performed 8 point assays, shown in Figure 1, to obtain full
inhibition curves and IC50 values. AM9023, AM6701 and N-Cbz-
serine b-lactone, identified in the 3 point assay, were characterized
both in radioactive (14C labeled PEA) and fluorescent 8 point
assays to validate the observed IC50 values. The IC50 values for
each selected inhibitor are very similar between those two assays
and are presented in Table 1.
hNAAA inhibition by AM9023AM9023 contains an isothiocyanate group (Figure 2a), and it
was expected that it would react irreversibly with the cysteine
nucleophile in the active site. We have used isothiocyanate based
probes extensively to characterize the cannabinoid receptors,
which covalently react with the cysteines in the receptor
[28,29,30]. However, the following evidence suggested that
AM9023 is a competitive reversible inhibitor: a) the IC50 was
unaffected by longer pre-incubation of hNAAA with AM9023; b)
enzyme activity was fully recovered in a rapid dilution experiment;
c) the profile of a Lineweaver-Burk (double reciprocal) plot
suggested it was a competitive type inhibitor. Yet AM9023 was a
relatively potent inhibitor, with an IC50 = 350670 nM as mea-
sured with the fluorescent assay and an IC50 = 6006130 nM
obtained with the radioactivity based assay (Figures 1a and 1b and
Table 1). AM9023 was selective for hNAAA as compared to
hMGL or rFAAH, which each had an IC50.10 mM. These results
suggested that AM9023 is a reversible and non-covalent inhibitor
of NAAA, and mass spectrometric analysis was used to test this
hypothesis in the mass spectrometric experimental section.
hNAAA inhibition by AM6701AM6701 was recently found to be a very potent inhibitor of
both human MGL and FAAH, with both enzymes having
equivalent IC50 values of 1.2 nM [31]. We identified AM6701
as also a very potent inhibitor of hNAAA with the IC50 values
determined to be 7.262.5 nM (radioactive assay) and
7.760.2 nM (fluorescent assay) as shown in Figures 1a and 1b
and Table 1. The AM6701 potency to inhibit hNAAA was time
dependent; the longer enzyme was preincubated with inhibitor the
lower IC50 was observed (extension of preincubation time to
120 min decreased the IC50 more than 50 fold; data not
presented). A rapid dilution assay experiment with hNAAA and
AM6701 was performed to determine if the inhibition was
reversible. AM6701 was incubated with hNAAA at a concentra-
tion of 100 nM for 120 min, and after twenty-fold dilution to a
final inhibitor concentration of 5 nM there was no recovery of
enzyme activity, even after 24 h incubation, indicating that
inhibition was irreversible, unlike the reversible inactivation of
hMGL by AM6701 [23,32].
hNAAA inhibition by N-Cbz-serine b-lactoneAnother compound, N-Cbz-serine b-lactone, initially discovered
as a hepatitis A virus 3C proteinase inhibitor [33], and more
recently identified as an inhibitor of rat NAAA with an IC50 in the
low micro molar range, was characterized both in radioactive and
fluorescent assays. Structure-activity relationship experiments
suggested that the b-lactone portion of the compound was
essential for inhibition [11,12]. N-Cbz-serine b-lactone inhibited
hydrolysis of the substrate heptadecenoylethanolamide by
HEK293 cell lysate, containing overexpressed recombinant rat
NAAA, with an IC50 = 2.9660.3 mM as determined in LC/MS
based assay [11,12]. The IC50 inhibition values we obtained for
purified hNAAA with the same inhibitor using the radioactive
(IC50 = 1.960.5 mM) and fluorescent (IC50 = 1.760.2 mM) assays,
as shown in Table 1, were similar. The potency of N-Cbz-serine b-
lactone hNAAA inhibition was time dependent; however we
observed a slow regeneration of enzyme catalytic activity in a rapid
dilution experiment of hNAAA inhibited with this compound,
similar to the previously reported partial recovery of initial enzyme
activity (4462%) following 12 h dialysis of rNAAA inhibited with
N-Cbz-serine b-lactone analog.12 The recovery of enzyme activity
after rapid dilution suggested that N-Cbz-serine b-lactone either
introduces enzyme modification(s) that are reversible under assay
conditions or it is a tight-binding reversible inhibitor. It was
proposed that the b-lactone class of inhibitors inhibit NAAA via a
covalent mechanism, that either alkylates or acylates the catalytic
nucleophile cysteine via b-lactone ring opening (Figure 2c).
Figure 1. Concentration dependent inhibition of purifiedhNAAA by three compounds. hNAAA was incubated with thecompounds AM6701 (squares), N-Cbz-serine b-lactone (circles), andAM9023 (diamonds) for two hours in order to reach full inhibitionbefore measuring activity. Panel (A). A radioactivity-based assay with[14C] PEA as substrate. Panel (B). A fluorescence-based assay withPAMCA as substrate. Representative curves are displayed.doi:10.1371/journal.pone.0043877.g001
Characterization of Human NAAA Inhibition
PLOS ONE | www.plosone.org 4 August 2012 | Volume 7 | Issue 8 | e43877
![Page 261: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/261.jpg)
Characterization of irreversible AM6701 and N-Cbz-serineb-lactone inhibitors of hNAAA
Variable pre-incubation time of the enzyme with the irreversible
inhibitors AM6701 or N-Cbz-serine b-lactone resulted in a
significant variation of IC50. To characterize this class of inhibitors
the use of a second order rate constant, derived from the ratio of
kinact/Ki, has been suggested as the appropriate way to describe
inhibitor potency [24,34]. Unlike IC50 values, kinact/Ki are
independent of pre-incubation times and therefore are a better
measure of potency for irreversible inhibitors [24,34]. To
accurately determine kinact/Ki values it is necessary to follow the
enzymatic reaction continuously, determining the concentration of
either the substrate or product in the course of inhibition, which
we can do with our fluorescence-based assay by monitoring the
fluorescence at 460 nm, the emission peak of the product AMC.
AM6701 was found to have a relatively high kinact/KI of
55000 M21 s21 (Table 1), indicating that AM6701 is a very
potent inhibitor. N-Cbz-serine b-lactone was much less potent
with a kinact/KI of 290 M21 s21. In summary, this novel
fluorescent inhibition assay may be used for characterization of
both reversible (based on IC50 values) and irreversible (based on
kinact/KI values) hNAAA inhibitors.
MALDI-TOF MS analysis of hNAAA inhibition by AM9023,AM6701, and N-Cbz-serine b-lactone
To determine if the selected compounds covalently modified the
enzyme, we employed LAPS methodology similar to that
previously used with hMGL [23]. This approach consists of
incubating the purified enzyme with and without a putative
covalent inhibitor, evaluating extent of inactivation, performing a
tryptic digest, comparing the peptide profile fingerprints using
MALDI-TOF MS, and then assigning the site and nature of any
covalent modification by MS/MS analysis.
MALDI-TOF MS analysis of hNAAA inhibition by AM9023The MALDI-TOF MS spectra of the tryptic digest of untreated
and AM9023 treated hNAAA were identical (data not presented).
This evidence along with the kinetic experiments strongly suggests
that this isothiocyanate based compound is a reversible and non-
covalent inhibitor of hNAAA.
MALDI-TOF MS analysis of hNAAA inhibition by AM6701MALDI-TOF MS analysis of the tryptic digests of untreated
and AM6701 treated hNAAA identified a peptide with mass of
1079.5177 Da (T-10b peptide; CTSIVAQDSR), containing the
catalytic cysteine in the control (untreated) sample, while a peptide
Table 1. Potencies of hNAAA inhibitors.
Inhibitor IC50 [14C] PEA (nM) IC50 PAMCA (nM) kinact (min21) KI (nM) kinact/KI (M21s21)
AM6701 7.262.5 7.760.2 0.04260.007 1363 55000
N-Cbz-serine b-lactone 19006500 17006200 0.02360.005 13006400 290
AM9023 6006130 350670 NA NA NA
The kinact and KI values for the covalent inhibitors were obtained as described in the Experimental Procedures. The IC50 values were calculated after 2 hourspreincubation of the enzyme and inhibitor before addition of the substrate. Values are averages 6 SD of three independent experiments.doi:10.1371/journal.pone.0043877.t001
Figure 2. Putative mechanism of inhibition of hNAAA for three compounds studied. Panel (A). Reversible inhibition of hNAAA by AM9023.Panel (B). Irreversible inhibition of hNAAA by AM6701 via thiocarbamylation of Cys126. Panel (C). Irreversible inhibition of hNAAA by N-Cbz-serine b-lactone most likely proceeds via route 2.doi:10.1371/journal.pone.0043877.g002
Characterization of Human NAAA Inhibition
PLOS ONE | www.plosone.org 5 August 2012 | Volume 7 | Issue 8 | e43877
![Page 262: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/262.jpg)
Characterization of Human NAAA Inhibition
PLOS ONE | www.plosone.org 6 August 2012 | Volume 7 | Issue 8 | e43877
![Page 263: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/263.jpg)
with a mass of 1150.5459 Da was observed only in inhibitor
treated samples (Figures 3a and 3b), with a concomitant decrease
in the intensity of the unmodified T-10b peptide peak. The
observed difference in mass, 71.0282 Da, between these two
peptides is equivalent to the mass of a dimethylcarbamyl group
(calculated 71.0371 Da) (Table 2). To confirm that the
1150.5459 Da ion was the T-10b peptide and determine which
amino acid was covalently modified with a dimethylcarbamyl
group, we performed an MS/MS analysis. The fragmentation
data confirmed that this was the T-10b peptide (Figure 4a), and
that the 71 Da additional mass was derived via carbamylation of
the N-terminal cysteine. The putative covalent mechanism of
AM6701 inhibition of hNAAA is shown in Figure 2b. To visualize
the enzyme active site modified by AM6701, we constructed a
hNAAA homology model based on the protein structure available
in the protein data bank that it has the greatest homology in
primary amino acid sequence with, which is with conjugated bile
acid hydrolase (CBAH) from Clostridium Perfringens. Only the b-
subunit was modeled with carbamylated catalytic nucleophile
Cys126 because it contains the putative catalytic triad, and the a-
subunit has no sequence homology with CBAH (Figure 5).
MALDI-TOF MS analysis of hNAAA inhibition by N-Cbz-serine b-lactone
Covalent modification by N-Cbz-serine b-lactone of the residue
His102, in addition to the catalytic Cys172 in the active site, of
hepatitis A virus 3C proteinase have been observed by NMR.
Alkylation of Cys172 or N-alkylation of His102 occurred in
hepatitis A virus 3C proteinase through the lactone cycle opening
at the b-carbon (Figure 2c, route 1) [35]. The most likely
mechanism of inhibition by N-Cbz-serine b-lactone with hNAAA
is that the catalytic Cys126 in hNAAA is alkylated (route 1) or
acylated (route 2) as shown in Figure 2c. A third possibility is
Cys126 carbamylation, resulting in only a fragment of the
compound covalently attached to the enzyme (Figure 2c, route
3). A slow regeneration activity of hNAAA inhibited with N-Cbz-
serine b-lactone in a rapid dilution assay suggested acylation or
carbamylation (route 2 and 3) rather than alkylation (route 1) of
Cys126 (Figure 2c). Analysis of the MALDI-TOF MS spectra for
the tryptic digests of untreated and N-Cbz-serine b-lactone treated
hNAAA identified a difference in mass of 221.0553 Da between
the peptides containing the catalytic cysteine in the control
(untreated) sample (1079.5177 Da; T-10b peptide; CTSI-
Figure 3. Tryptic digest fingerprint of purified hNAAA obtained by MALDI-TOF MS. Panel (A). Protein neat. Panel (B). AM6701 treatedenzyme. Panel (C). N-Cbz-serine b-lactone treated enzyme. The T10-b peptide (sequence: CTSIVAQDSR, theoretical mass 1079.515 Da) peakcontaining the catalytic nucleophile cysteine and its covalently modified forms are marked with an asterisk in each panel.doi:10.1371/journal.pone.0043877.g003
Figure 4. MALDI-TOF MS/MS analysis of the hNAAA tryptic peptide T10-b after covalent modification. Tandem MALDI-TOF MS/MSspectra of the T10-b peptide (sequence: CTSIVAQDSR) demonstrates covalent modification of Cys126 by both AM6701 (Panel (A)) and N-Cbz-serine b-lactone (Panel (B)).doi:10.1371/journal.pone.0043877.g004
Characterization of Human NAAA Inhibition
PLOS ONE | www.plosone.org 7 August 2012 | Volume 7 | Issue 8 | e43877
![Page 264: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/264.jpg)
VAQDSR) and inhibitor treated sample (1300.5730 Da), as
shown in Figures 3a and 3c. The 1300.5730 Da ion was not
observed in the untreated sample, and the unmodified T-10bpeptide peak is still present but at a reduced intensity. The
221.0553 Da difference between these two peptides eliminated the
possibility of route 3 in Figure 2c (calculated difference
131.0219 Da) and strongly suggested that the addition of N-Cbz-
serine b-lactone (calculated 221.06888 Da, Table 2) must proceed
by route 1 or 2 as shown in Figure 2c. The amino acid sequence of
1300.5730 Da ion identified by MS/MS analysis, as shown in
Figure 4b, was confirmed to correspond to the T-10b peptide with
Cys126 modified by the inhibitor. Our kinetic data demonstrating
the low in vitro stability of N-Cbz-serine b-lactone treated hNAAA
supports with the previous suggestion that a thioester bond is
formed after attack of sulfur at the 2-carbonyl [11], as this is a
more labile bond than the alkyl bond formed if the attack were at
the 4-methylene, and hence is strong evidence that inhibition
occurs by cysteine acylation via route 2 of Figure 2c. The
homology model of hNAAA with the N-Cbz-serine b-lactone
modified catalytic nucleophile Cys126, via acylation, is shown in
Figure 6.
In the course of preparing this manuscript it was reported by
Armirotti et al. that the b-lactones inhibit NAAA by S-acylation of
the catalytic N-terminal cysteine [36], confirming our data
presented in this manuscript and at the 2011 International
Cannabinoid Research Society meeting [37].
Conclusion
An understanding of structural organization and catalytic
mechanism of the human enzyme N-acylethanolamine-hydrolyz-
ing acid amidase is prerequisite to advance the development of
medicines with anti-inflammatory, analgesic and neuroprotective
properties. As the first step to hNAAA active site characterization
we applied an MS-based ligand-assisted protein structure
approach (LAPS) to identify an amino acid residue(s) in hNAAA
susceptible to selected irreversible inhibitors. To obtain a sufficient
amount of enzyme for the development, validation and executing
of HTS inhibitor assays we further optimized a previously
established HEK293-based hNAAA expression system to produce
three-fold more secreted functional protein. Different classes of
hNAAA inhibitors were pulled out during HTS screening of
compound libraries using a 3 point fluorescence based assay, and
the most potent were characterized further in a novel 8 point assay
for reversible (based on IC50 values) and irreversible (based on
kinact/KI values) hNAAA inhibitors. The mechanisms of hNAAA
inactivation by AM9023, AM6701 and N-Cbz-serine b-lactone
were investigated in biochemical and MS experiments. The
kinetics of hNAAA inhibition by AM9023 and MS analysis of
untreated and AM9023 treated hNAAA strongly suggest that this
isothiocyanate based compound is a reversible and non-covalent
inhibitor of hNAAA. AM6701 and N-Cbz-serine b-lactone inhibit
hNAAA in a covalent, time-dependent, and in the former case,
irreversible manner. We observed slow partial activity recovery of
hNAAA treated with N-Cbz-serine b-lactone, but not with
AM6701 in a rapid dilution assay. MS analysis of untreated and
Figure 5. Representation of the active site of hNAAA aftertreatment with AM6701. Homology model illustrates thiocarbamyla-tion of catalytic nucleophile Cys126 after treatment with AM6701.doi:10.1371/journal.pone.0043877.g005
Table 2. Mass of tryptic peptide containing Cys126 of hNAAA after covalent modification.
Peptide sequence Compound m/z calculated m/z measured Error (ppm)
CTSIVAQDSR DMSO (control) 1079.5150 1079.5177 2.5
CTSIVAQDSR AM6701 1150.5521 1150.5459 25.4
CTSIVAQDSR N-Cbz-serine b-lactone 1300.5838 1300.5730 28.3
T10-b peptides identified in the tryptic digest of untreated (control) and AM6701 or N-Cbz-serine b-lactone treated hNAAA samples.doi:10.1371/journal.pone.0043877.t002
Figure 6. Representation of the active site of hNAAA aftertreatment with N-Cbz-serine b-lactone. Homology model illus-trates acylated catalytic nucleophile Cys126 after treatment with N-Cbz-serine b-lactone.doi:10.1371/journal.pone.0043877.g006
Characterization of Human NAAA Inhibition
PLOS ONE | www.plosone.org 8 August 2012 | Volume 7 | Issue 8 | e43877
![Page 265: Synthesis and biological evaluation of novel endocannabinoid ......the cannabinoid receptors, however, the chemical and metabolic instability of 2-AG is a hindrance to its study. Previous](https://reader035.fdocuments.us/reader035/viewer/2022071402/60efdc26f1ad6e375a074657/html5/thumbnails/265.jpg)
AM6701 or N-Cbz-serine b-lactone inhibitor treated hNAAA
samples, following trypsin digestion, identified modification only
for the N-terminal cysteine (Cys126) of the b-subunit. These
experiments confirm that hNAAA belongs to the cysteine N-
terminal nucleophile class of enzymes, with Cys126 being the
critical residue in the active site susceptible to covalent inhibitors,
and establish methods to rapidly and efficiently determine the
covalent or reversible nature of NAAA inhibitors and determine
the potency of both types of inhibitors.
Author Contributions
Conceived and designed the experiments: JMW NZ SKV AM. Performed
the experiments: JMW NZ KMW SKV ALB. Analyzed the data: JMW NZ
AM. Contributed reagents/materials/analysis tools: JMW NZ KMW SKV
ALB AM. Wrote the paper: JMW NZ KMW SKV ALB AM.
References
1. Ahn K, Johnson DS, Mileni M, Beidler D, Long JZ, et al. (2009) Discovery andCharacterization of a Highly Selective FAAH Inhibitor that Reduces
Inflammatory Pain. Chemistry & Biology 16: 411–420.2. Alvarez-Jaimes LJ, Palmer JA The Role of Endocannabinoids in Pain
Modulation and the Therapeutic Potential of Inhibiting their Enzymatic
Degradation. Curr Pharm Biotechnol.3. Saario SM, Laitinen JT (2007) Therapeutic potential of endocannabinoid-
hydrolysing enzyme inhibitors. Basic & Clinical Pharmacology & Toxicology101: 287–293.
4. Labar G, Michaux C (2007) Fatty acid amide hydrolase: From characterization
to therapeutics. Chemistry & Biodiversity 4: 1882–1902.5. Saario SM, Laitinen JT (2007) Monoglyceride lipase as an enzyme hydrolyzing
2-arachidonoylglycerol. Chemistry & Biodiversity 4: 1903–1913.6. Tsuboi K, Sun YX, Okamoto Y, Araki N, Tonai T, et al. (2005) Molecular
characterization of N-acylethanolamine-hydrolyzing acid amidase, a novelmember of the choloylglycine hydrolase family with structural and functional
similarity to acid ceramidase. Journal of Biological Chemistry 280: 11082–
11092.7. Godlewski G, Offertaler L, Wagner JA, Kunos G (2009) Receptors for
acylethanolamides-GPR55 and GPR119. Prostaglandins Other Lipid Mediat89: 105–111.
8. Lo Verme J, Fu J, Astarita G, La Rana G, Russo R, et al. (2005) The nuclear
receptor peroxisome proliferator-activated receptor-alpha mediates the anti-inflammatory actions of palmitoylethanolamide. Molecular Pharmacology 67:
15–19.9. O’Sullivan SE (2007) Cannabinoids go nuclear: evidence for activation of
peroxisome proliferator-activated receptors. British Journal of Pharmacology
152: 576–582.10. Saturnino C, Petrosino S, Ligresti A, Palladino C, De Martino G, et al. (2010)
Synthesis and biological evaluation of new potential inhibitors of N-acylethanolamine hydrolyzing acid amidase. Bioorganic & Medicinal Chemistry
Letters 20: 1210–1213.11. Solorzano C, Antonietti F, Duranti A, Tontini A, Rivara S, et al. (2010)
Synthesis and structure-activity relationships of N-(2-oxo-3-oxetanyl)amides as
N-acylethanolamine-hydrolyzing acid amidase inhibitors. Journal of MedicinalChemistry 53: 5770–5781.
12. Solorzano C, Zhu C, Battista N, Astarita G, Lodola A, et al. (2009) Selective N-acylethanolamine-hydrolyzing acid amidase inhibition reveals a key role for
endogenous palmitoylethanolamide in inflammation. Proc Natl Acad Sci U S A
106: 20966–20971.13. Bernardo K, Hurwitz R, Zenk T, Desnick RJ, Ferlinz K, et al. (1995)
Purification, characterization, and biosynthesis of human acid ceramidase. J BiolChem 270: 11098–11102.
14. Tsuboi K, Takezaki N, Ueda N (2007) The N-acylethanolamine-hydrolyzingacid amidase (NAAA). Chemistry & Biodiversity 4: 1914–1925.
15. Rossocha M, Schultz-Heienbrok R, von Moeller H, Coleman JP, Saenger W
(2005) Conjugated bile acid hydrolase is a tetrameric N-terminal thiol hydrolasewith specific recognition of its cholyl but not of its tauryl product. Biochemistry
44: 5739–5748.16. Shtraizent N, Eliyahu E, Park JH, He X, Shalgi R, et al. (2008) Autoproteolytic
cleavage and activation of human acid ceramidase. Journal of Biological
Chemistry 283: 11253–11259.17. Brannigan JA, Dodson G, Duggleby HJ, Moody PC, Smith JL, et al. (1995) A
protein catalytic framework with an N-terminal nucleophile is capable of self-activation. Nature 378: 416–419.
18. Oinonen C, Rouvinen J (2000) Structural comparison of Ntn-hydrolases. ProteinSci 9: 2329–2337.
19. Zhao LY, Tsuboi K, Okamoto Y, Nagahata S, Ueda N (2007) Proteolytic
activation and glycosylation of N-acylethanolamine-hydrolyzing acid amidase, alysosomal enzyme involved in the endocannabinoid metabolism. Biochimica et
Biophysica Acta 1771: 1397–1405.
20. West JM, Zvonok N, Whitten KM, Wood JT, Makriyannis A (2012) Mass
Spectrometric Characterization of Human N-Acylethanolamine-hydrolyzing
Acid Amidase. J Proteome Res 11: 972–981.
21. Wang J, Zhao LY, Uyama T, Tsuboi K, Tonai T, et al. (2008) Amino acid
residues crucial in pH regulation and proteolytic activation of N-acylethanola-
mine-hydrolyzing acid amidase. Biochimica et Biophysica Acta 1781: 710–717.
22. Lodola A, Branduardi D, De Vivo M, Capoferri L, Mor M, et al A catalytic
mechanism for cysteine N-terminal nucleophile hydrolases, as revealed by free
energy simulations. PLoS One 7: e32397.
23. Zvonok N, Williams J, Johnston M, Panarinathan L, Karageorgos I, et al. (2008)
Covalent inhibitors of human monoacylglycerol lipase: Ligand-assisted proteo-
mic characterization of the catalytic site. Chemistry and Biology 15: 854–862.
24. Mileni M, Johnson DS, Wang ZG, Everdeen DS, Liimatta M, et al. (2008)
Structure-guided inhibitor design for human FAAH by interspecies active site
conversion. Proceedings of the National Academy of Sciences of the United
States of America 105: 12820–12824.
25. Zvonok N, Williams J, Johnston M, Pandarinathan L, Janero DR, et al. (2008)
Full mass spectrometric characterization of human monoacylglycerol lipase
generated by large-scale expression and single-step purification. Journal of
Proteome Research 7: 2158–2164.
26. Jones DT (1999) Protein secondary structure prediction based on position-
specific scoring matrices. Journal of Molecular Biology 292: 195–202.
27. Ramarao MK, Murphy EA, Shen MW, Wang Y, Bushell KN, et al. (2005) A
fluorescence-based assay for fatty acid amide hydrolase compatible with high-
throughput screening. Anal Biochem 343: 143–151.
28. Li C, Xu W, Vadivel SK, Fan P, Makriyannis A (2005) High affinity
electrophilic and photoactivatable covalent endocannabinoid probes for the CB1
receptor. J Med Chem 48: 6423–6429.
29. Morse KL, Fournier DJ, Li X, Grzybowska J, Makriyannis A (1995) A novel
electrophilic high affinity irreversible probe for the cannabinoid receptor. Life
Sci 56: 1957–1962.
30. Picone RP, Khanolkar AD, Xu W, Ayotte LA, Thakur GA, et al. (2005) (2)-79-
Isothiocyanato-11-hydroxy-19,19-dimethylheptylhexahydrocannabinol (AM841),
a high-affinity electrophilic ligand, interacts covalently with a cysteine in helix six
and activates the CB1 cannabinoid receptor. Mol Pharmacol 68: 1623–1635.
31. Naidoo V, Karanian DA, Vadivel SK, Locklear JR, Wood JT, et al. (2012)
Equipotent Inhibition of Fatty Acid Amide Hydrolase and Monoacylglycerol
Lipase - Dual Targets of the Endocannabinoid System to Protect against Seizure
Pathology. Neurotherapeutics.
32. Karageorgos I, Tyukhtenko S, Zvonok N, Janero DR, Sallum C, et al. (2010)
Identification by nuclear magnetic resonance spectroscopy of an active-site
hydrogen-bond network in human monoacylglycerol lipase (hMGL): implica-
tions for hMGL dynamics, pharmacological inhibition, and catalytic mecha-
nism. Molecular Biosystems 6: 1381–1388.
33. Lall MS, Karvellas C, Vederas JC (1999) Beta-lactones as a new class of cysteine
proteinase inhibitors: inhibition of hepatitis A virus 3C proteinase by N-Cbz-
serine beta-lactone. Org Lett 1: 803–806.
34. Kitz R, Wilson IB (1962) Esters of methanesulfonic acid as irreversible inhibitors
of acetylcholinesterase. J Biol Chem 237: 3245–3249.
35. Yin J, Bergmann EM, Cherney MM, Lall MS, Jain RP, et al. (2005) Dual modes
of modification of hepatitis A virus 3C protease by a serine-derived beta-lactone:
selective crystallization and formation of a functional catalytic triad in the active
site. Journal of Molecular Biology 354: 854–871.
36. Armirotti A, Romeo E, Ponzano S, Mengatto L, Dionisi M, et al. (2012) B-
Lactones Inhibit N-acylethanolamine Acid Amidase by S-Acylation of the
Catalytic N-Terminal Cysteine. ACS Medicinal Chemistry Letters.
37. West JM, Whitten KM, Vadiei SK, Zvonok N, Makriyannis A. (2011) Mass
Spectrometric Characterization of Human NAAA. Research Triangle Park, NC,
USA. International Cannabinoid Research Society. pp. P3–34.
Characterization of Human NAAA Inhibition
PLOS ONE | www.plosone.org 9 August 2012 | Volume 7 | Issue 8 | e43877