NO. 18/19 FLORIDA STATE SEMINOLES ( 5-2 OVERALL, 1 ......NO. 18/19 SEMINOLES PLAY HOST TO DUKE ON SA...
Transcript of NO. 18/19 FLORIDA STATE SEMINOLES ( 5-2 OVERALL, 1 ......NO. 18/19 SEMINOLES PLAY HOST TO DUKE ON SA...
-
NO. 18/19 FLORIDA STATE SEMINOLES (5-2 OVERALL, 1-1 ACC)
VS NO. 20 DUKE BLUE DEVILS (3-2 OVERALL, 0-0 ACC)
SATURDAY, JANUARY 2, 2021; 8:00 P.M. DONALD L. TUCKER CENTER
TALLAHASSEE, FLORIDA LEARFIELD IMG RADIO NETWORK (GENE DECKERHOFF, ADRIAN CRAWFORD)
ESPN (DAVE O’BRIEN, DICK VITALE) “Leonard Hamilton has been one of the great coaches in our country. He’s touched every aspect as an assistant coach, a pro coach. He‘s been at a number of colleges, he’s started programs up. He’s really built the program at Florida State to be one of the top programs in the country. He’s made our conference better and a lot tougher. And you know what -- he’s done it in a great way.”
Mike Krzyzewski Duke Basketball
NO. 18/19 SEMINOLES PLAY HOST TO DUKE ON SATURDAY NIGHT IN TALLAHASSEE Florida State, which has won 18 consecutive ACC home games, plays host to No. 20 Duke on Saturday, January 2, 2021 at the Donald L. Tucker Center in Tallahassee. The Seminoles’ game against the Blue Devils in the only meeting between the two teams during the 2020-21 regular season. The Seminoles’ game against Duke is their second ACC home game of the season and begins a stretch of three games in eight days with two of those games on the road at Syracuse (January 6 at 4:30) and at Pittsburgh (January 9 at 2:00 p.m.) Florida State has been one of the most consistent ACC teams in conference play in the last three seasons with a 19 ACC wins at home and 11 wins on the road. Following Saturday’s game against Duke, the Seminoles travel to play at Syracuse on Wednesday, January 6, in a game that will begin at 4:30 (note the game time change). FLORIDA STATE IS THE TOP RANKED ACC TEAM IN THE NATIONAL POLLS No. 18/19 Florida State enters Saturday’s game against No. 20 Duke as the highest ranked team in the Atlantic Coast Conference. The Seminoles are ranked 18th in the Associated Press poll and 19th in the USA Today Coaches Poll. Also in the top 25 from the ACC are Duke (No 20/NR), Virginia (No. 23/24), and Virginia Tech (NR/No. 24). It marks the second time in the last three weeks (weeks three and five of the college basketball season) that the Seminoles have been the ACC’s top ranked team. FLORIDA STATE HAS WON 18 CONSECUTIVE ACC HOME GAMES Florida State enters Saturday’s game against Duke having won 18 consecutive ACC games at the Donald L. Tucker Center in Tallahassee. The Seminoles’ ACC winning streak in their home building began with a 77-68 win over Clemson on January 22, 2019. Their most recent ACC victory at home came as a 74-61 win over Georgia Tech. FLORIDA STATE IN THE ACC SINCE THE START OF THE 2018-19 SEASON Florida State is 30-10 (.750 winning percentage) in ACC regular season play since the start of the 2018-19 season. The Seminoles finished 13-5 in 2019, 16-4 in 2020 and are 1-1 this season. FLORIDA STATE HAS WON NEARLY 95 PERCENT OF ITS HOME GAMES SINCE FEBRUARY 27, 2015 Florida State is 70-4 (.946 winning percentage) in its last 74 home games since the tail end of the 2015-16 season. The Seminoles enter Saturday’s game against Duke having won .946 percent of their games (70-4) and .925 percent of their ACC games (37-3) at home since the tail end of the 2015-16 season. Florida State’s streak began with a 77-56 win over No. 23 Notre Dame on February 27, 2015. The Seminoles are 5-1 at home this season, were 16-0 at home last season (including 10-0 in ACC play), were 15-1 at home (including 8-1 in the ACC) during the 2018-19 season and were 18-0 at home (including 9-0 in the ACC) in the 2016-17 season. HAMILTON ON BALLOT FOR NAISMITH HALL OF FAME CLASS OF 2021 Florida State’s Leonard Hamilton, who has won nearly 600 games and who is the fifth all-time winningest coach in ACC history, was named as an eligible candidate for the Naismith Hall of Fame Class of 2021. Hamilton highlights the list of four first time coaching candidates including Ken Anderson (Wisconsin-Eau Claire), Lou Henson (Hardin-Simmons, New Mexico State, Illinois) and Paul Westhead (NBA and college). Hamilton has been named as the National Coach of the Year four times and by four different national governing bodies. He was named the Clarence “Big House” Gaines National Coach of the Year in 2018, the Basketball Times Coach of the Year in 2009, the BCA National Coach of the Year in 2000 and the UPI National Coach of the Year in 1995. Hamilton has also been named the ACC Coach of the Year three times (2009, 2012 and 2020) and the Big East Coach of the Year twice (1995 and 1999). FLORIDA STATE SINCE THE START OF THE 2018-19 SEASON Florida State is 60-14 (.810 winning percentage) since the start of the 2018-19 season. The Seminoles finished 29-8 in 2018-19, 26-5 in 2019-20 and are 5-1 this season. Since defeating Clemson on December 8, 2019, the Seminoles have won nearly 85 percent of their games with a record of 23-4 (.852 winning percentage). LOOK FOR FLORIDA STATE TO… …Defeat Duke and gain its second win of the 2020-21 season over a nationally ranked team. The Devils enter Saturday’s game ranked No. 20 in this week’s Associated Press poll. Florida was ranked No. 25 nationally when the Seminoles defeated the Gators, 83-71, on December 12, in Tallahassee.
2020-21 Florida State Schedule D2 North Florida W, 86-58 D9 1 Indiana W, 69-67 (OT) D12 Florida W, 83-71 D15 * Georgia Tech W, 74-61 D19 UCF L, 74-86 D21 Gardner-Webb W, 72-59 D29 * at Clemson L, 67-77 J2 * Duke 8:00 p.m. J6 * at Syracuse 4:30 p.m. J9 * at Pittsburgh 2:00 p.m. J13 * NC State 6:30 p.m. J16 * North Carolina 12 Noon J18 * at Louisville 7:00 p.m. J23 * Clemson 3:00 p.m. J27 * Miami 6:00 p.m. J30 * at Georgia Tech 4:00 p.m. F2 * at Boston College 9:00 p.m. F9 * at Virginia Tech 8:30 p.m. F13 * Wake Forest 12 Noon F15 * Virginia 7:00 p.m. F20 * Virginia Tech 12 Noon F24 * at Miami 8:30 p.m. F27 * at North Carolina 4:00 p.m. M3 * Boston College 9:00 p.m. M9-13 2 at ACC Tournament TBD *ACC Game. 1 ACC/Big Ten Challenge at Tallahassee, Fla.; 2 ACC Tournament Greensboro Coliseum, Greensboro, N.C.
2019-20 ACC Standings
Team W L Pct. W L Pct. Florida State 16 4 .800 26 5 .839 Virginia 15 5 .750 23 7 .767 Louisville 15 5 .750 24 7 .774 Duke 15 5 .750 25 6 .806 Georgia Tech 10 9 .500 17 14 .548 NC State 10 10 .500 19 12 .613 Syracuse 10 10 .500 17 14 .548 Notre Dame 10 10 .474 18 12 .600 Clemson 9 11 .450 16 15 .516 Miami 7 13 .350 15 15 .500 Boston College 7 13 .368 13 18 .419 Virginia Tech 7 13 .368 16 15 .516 Wake Forest 6 14 .316 13 17 .433 Pittsburgh 6 14 .300 15 16 .484 N. Carolina 6 14 .300 13 18 .419
Leonard Hamilton’s Career Record
W L Pct. Years Career 565 432 .567 1987-Pr. at Okla. State 56 63 .471 1987-90 at Miami 144 147 .495 1991-00 at Florida State 365 223 .621 2002-Pr.
ACC Operation Basketball Predicted Order of Finish
1. Virginia 9. Georgia Tech 2. Duke 10. Clemson 3. FLORIDA STATE 11. Virginia Tech 4. North Carolina 12. Notre Dame 5. Louisville 13. Pittsburgh 6. Syracuse 14. Boston College 7. Miami 15. Wake Forest 8. NC State
-
HAMILTON AMONG ALL-TIME GREATEST COACHES IN ACC Florida State Head Coach Leonard Hamilton enters Saturday’s game against Duke as the fifth winningest coach in ACC history with 365 career wins at Florida State. Hamilton became only the sixth coach in the illustrious history of the nation’s best basketball conference to win 350 career games with the Seminoles’ victory over Miami on January 18, 2020. Hamilton In ACC History Rank Coach, School Career Wins 1. Mike Krzyzewski, Duke 1,087 2. Dean Smith, North Carolina 879 3. Roy Williams, North Carolina 471 4. Gary Williams, Maryland 461 5. Leonard Hamilton, Florida State 365 SEMINOLES IN THE ACC SINCE THE START OF THE 2019-20 SEASON Florida State, the defending ACC Champion, is the winningest team in ACC play since the start of the 2019-20 season and is joined by Louisville as the only conference teams to win 30 or more games since the start of last season. The Seminoles won the ACC championship with a 16-4 ACC record in 2020 as they set a school-record for conference wins in a regular season. ACC Play Overall Play Team W L Pct. W L Pct. Florida State 17 5 .773 31 7 .816 Duke 16 5 .762 28 8 .778 Louisville 16 5 .762 30 8 .789 Virginia 16 5 .762 27 9 .750 HAMILTON WITH 74 WINS OVER RANKED TEAMS Florida State’s Leonard Hamilton enters Saturday’s game against No. 20 Duke looking for his 75th career win over a nationally ranked team. He earned two wins over ranked teams at Oklahoma State, 17 at Miami and 55 at Florida State. He has earned four wins over No. 1 ranked teams: against No. 1 Oklahoma (February 4, 1989 while at Oklahoma State); against No. 1 Duke (March 1. 2006 while at Florida State); against No. 1 North Carolina (March 4, 2009 while at Florida State) and against No. 1 Duke (January 12, 2011 while at Florida State). FLORIDA STATE WITH NINE VICTORIES OVER AP TOP 25 TEAMS IN LAST THREE SEASONS Florida State enters its game against No. 20 Duke with one victory over a nationally ranked team this season (No. 25 Florida, 83-71, December 12) and 11 wins over nationally ranked opponents since the start of the 2018-19 season. The Seminoles won a school-record seven games against nationally ranked opponents during the 2016-17 season and have defeated a school-record 55 nationally ranked opponents under head coach Leonard Hamilton. Florida State’s Wins Over Nationally Ranked Opponents in Last Three Seasons Date Opponent Ranking Final Score November 23, 2018 LSU No. 19/21 Florida State, 79-76 (OT) November 28, 2018 Purdue No. 18/19 Florida State, 73-72 February 9, 2019 Louisville No. 16/17 Florida State, 80-75 (OT) March 5, 2019 Virginia Tech No. 15/16 Florida State, 73-64 (OT) March 14, 2019 Virginia Tech No. 16/15 Florida State, 65-63 (OT) March 15, 2019 Virginia No. 2/4 Florida State, 69-59 November 10, 2019 Florida No. 6/6 Florida State, 63-51 November 29, 2019 Tennessee No. 17/16 Florida State, 60-57 January 4, 2020 Louisville No. 7/8 Florida State, 78-65 February 24, 2020 Louisville No. 11/11 Florida State, 82-67 December 12, 2020 Florida No. 25 Florida State, 83-71 SEMINOLES RANKED IN 22 CONSECUTIVE NATIONALL POLLS The Seminoles’ current 22-week stay in both of the nation’s most recognized polls is the second longest streak as a nationally ranked team in school history after being nationally ranked for the final 14 weeks of the 2016-17 season. FLORIDA STATE’S MINUTES PLAYED CHART Florida State enters Saturday’s game against Duke with nine players averaging at least 10.1 minutes played per game. Senior M.J. Walker is averaging a career-high 32.2 minutes played per game while Anthony Polite (29.1 mpg), Scottie Barnes (26.4 mpg) and RaiQuan Gray (25.1 mpg) are all averaging more than 25 minutes played per game. Seminole head Coach Leonard Hamilton, who has utilized the same starting lineup in each of his teams’ first seven games (Gray, Balsa Koprivica, Polite, Barnes and Walker) has played at least 10 players in each game this season. FLORIDA STATE AVEARGING NEARLY EIGHT STEALS PER GAME Florida State, which has earned at least eight steals in four of its first seven games, enters Saturday’s game against Duke averaging 7.6 steals per game. The Seminoles totaled a season-high 12 steals in its season-opening win over North Florida and earned 14 total steals in their first two ACC games of the season (7.0 spg). SEMINOLES AVERAGING 8.0 3-POINT FIELD GOALS MADE PER GAME Florida State, which made nine 3-point shots against Clemson on Tuesday night, enters Saturday’s game against Duke averaging 8.0 3-point field goals made per game. The Seminoles made a season-high 10 shots from the bonusphere against UCF and totaled eight each in wins over Indiana (December 9), Florida (December 12) and Georgia Tech (December 15). Florida State is averaging 8.5 3-point shots made in its first two ACC games of the season. SEMINOLES ON THE BLOCKS Florida State totaled eight blocked shots in its victory over Gardner-Webb (December 21) and sent back six Clemson shots against the Tigers on Tuesday night and is averaging 7.0 blocked shots in their last two games.
Florida State Basketball / National Polls
ASSOCIATED PRESS POLL Rk. Team 20-21 Rec. 1. Gonzaga (62) 7-0 2. Baylor (2) 6-0 3. Kansas 8-1 4. Villanova 8-1 5. Houston 7-0 6. Wisconsin 8-1 7. Tennessee 6-0 8. Texas 7-1 9. West Virginia 7-2 10. Iowa 7-2 11. Creighton 7-2 12. Missouri 6-0 13. Texas Tech 7-2 14. Rutgers 6-1 15. Illinois 7-3 16. Michigan 7-0 17. Michigan State 6-2 18. FLORIDA STATE 5-1 19. Northwestern 6-1 20. Duke 3-2 21. Oregon 6-1 22. Minnesota 8-1 23. Virginia 4-2 24. Virginia Tech 7-1 25. Ohio State 7-2
USA TODAY POLL Rk. Team Points 1. Gonzaga (29) 797 2. Baylor (30) 771 3. Villanova 698 4. Kansas 674 5. Houston 636 6. Tennessee 612 7. Wisconsin 576 8. West Virginia 543 9. Texas 526 10. Creighton 462 11. Iowa 442 12. Missouri 407 13. Rutgers 359 14. Texas Tech 347 15. Michigan 338 16. Illinois 320 17. Oregon 194 18. Michigan State 182 19. FLORIDA STATE 178 20. Xavier 164 Ohio State 164 22. Northwestern 117 23. San Diego State 112 24. Virginia 107 Minnesota 107
Florida State’s 2020-21 Poll History Week AP Coaches Preseason 21 18 Week 1 22 NP Week 2 20 21 Week 3 15 15 Week 4 21 21 Week 5 18 19
Florida State’s Defensive Players Of the Game
North Florida RayQuan Evans Indiana Wyatt Wilkes Florida Balsa Koprivica Georgia Tech Nathanael Jack UCF Harrison Prieto Gardner-Webb Tanor Ngom Clemson Nathanael Jack
-
STARTING LINEUP FOR FLORIDA STATE… F #1 RaiQuan Gray (7.0 ppg, 6.0 rpg; 6pts and 2 rebs vs. Duke, February 10, 2020) C #5 Balsa Koprivica (9.9 ppg, 5.9 rpg; 2 pts and 2 rebs vs. Duke, February 10, 2020) G #2 Anthony Polite (10.9 ppg, 5.1 rpg; 0 pts and 1 reb vs. Duke, February 10, 2020) G #4 Scottie Barnes (11.1 ppg, 4.3 apg; First career game vs. Duke) G #23 M.J. Walker (15.3 ppg, 2.7 rpg; 10 pts and 2 assists vs. Duke, December 30, 2017) …AND TOP RESERVES G #0 RayQuan Evans (4.7 ppg, 1.0 apg; 2 pts and 0 rebs vs. Duke, February 10, 2020) F #10 Malik Osborne (3.6 ppg, 5.1 rpg; 14 pts and 5 rebs vs. Duke, February 10, 2020) G #31 Wyatt Wilkes (4.4 ppg, 1.7 rpg; 0 pts and 0 rebs vs. Duke, February 10, 2020) C #15 Quincy Ballard (1.2 ppg, 0.4 rpg; First career game vs. Duke) G #24 Sardaar Calhoun (3.9 ppg, 0.9 rpg; First career game vs. Duke) G #11 Nathanael Jack (3.4 ppg, 0.3 apg; First career game vs. Duke) C #34 Tanor Ngom (1.7 ppg, 1.3 rpg; First career regular season game vs. Duke) POSSIBLE STARTING LINEUP FOR DUKE F #12 Patrick Tape (1.3 ppg. 1.3 rpg; First career game vs. Florida State) F #21 Matthew Hurt (18.8 ppg, 8.0 rpg; 12 pts and 2 rebs vs. Florida State, February 10, 2020) G #2 DJ Steward (12.6 ppg, 2.6 apg; First career game vs. Florida State) G #3 Jeremy Roach (8.6 ppg, 3.0 apg; First career game vs. Florida State) G #14 Jordan Goldwire (6.6 ppg, 3.4 apg; 13 pts and 0 rebs vs. Florida State, February 10, 2020) FLORIDA STATE VS. DUKE -- A SERIES HISTORY The Series: Duke leads, 41-10 First Game: January 3, 1954; at Duke 97, Florida State 75 Last Game: February 10, 2020; at Duke 70, Florida State 65 Last Florida State Win: January 10, 2017; at Florida State 88, Duke 72 Last Duke Win: February 10, 2020; at Duke 70, Florida State 65 Last Florida State Win in Tallahassee: January 10, 2017; at Florida State 88, Duke 72 Last Duke Win In Tallahassee: January 12, 2019; Duke 80, at Florida State 78 Current Streak: Duke has won 5 Current Streak in Tallahassee: Duke has won 1 Leonard Hamilton vs. Duke: 7-17 (all at Florida State) FLORIDA STATE VS. DUKE – THE LAST FOUR GAMES Feb. 10, 2020 March 16, 2019 Jan. 12, 2019 Dec. 30, 2017 Florida State 65 Florida State 63 Florida State 78 Florida State 93 at Duke Duke 73 Duke 80 at Duke 100 FLORIDA STATE VS. DUKE – THE LAST GAME Tre Jones had 13 points for the Blue Devils, who shot 45 percent and hit seven of 17 3-pointers to overcome 21 turnovers to defeat Florida State, 70-65 on February 20, 2020 at Cameron Indoor Stadium in Durham. Duke’s defense also gave Florida State tough looks and forced Trent Forrest to carry the offensive burden for much of the night for the Seminoles. Forrest finished with 18 points, nine rebounds and eight steals to lead the Seminoles, who shot just 38 percent from the field. Contributions came from throughout the Duke lineup on a quiet night for big man Vernon Carey Jr. Junior guard Jordan Goldwire matched his career high with 13 points on 5-for-5 shooting -- including three 3s -- after coming in averaging 4.0 points. Alex O’Connell had five straight points during a key second-half sequence after FSU had gone up 52-50, then freshman Matthew Hurt went 4 for 4 at the line in the final 11.7 seconds as a the game clincher TONIGHT’S OFFICIALS Tonight’s referee is Roger Ayers and the umpires are Ron Groover and A.J. Desai 2020-21 FLORIDA STATE ROSTER No. Name Pos. Ht. Wt. Yr. Hometown 0 RayQuan Evans G 6-4 210 Sr. Billings, Mont./North Idaho College 1 RaiQuan Gray F 6-8 260 RJr. Ft. Lauderdale, Fla./Dillard 2 Anthony Polite G 6-6 215 RJr. Lugano, Switzerland/St. Andrews Christian School (Fla.) 4 Scottie Barnes G/F 6-9 227 Fr. West Palm Beach, Fla./Montverde Academy (Fla.) 5 Balsa Koprivica C 7-1 240 So. Belgrade, Serbia/Montverde Academy 10 Malik Osborne F 6-9 225 RJr. Matteson. Ill./Bosco Institute/Rice 11 Nathanael Jack G 6-5 195 Sr. Mississauga, Ontario, Canada/Eastern Florida State 12 Justin Lindner G 6-1 180 RSr. Memphis, Tenn./Christian Brothers 15 Quincy Ballard C 6-11 240 Fr. Syracuse, N.Y./Quality Education Academy (N.C.) 20 Travis Light G 6-6 190 RSr. Vienna, Va./IMG Academy 23 M.J. Walker G/F 6-5 213 Sr. Riverdale, Ga./Jonesboro 24 Sardaar Calhoun G 6-6 220 Jr. Tappahannock, Va./Missouri University West Plains 30 Harrison Prieto F 6-8 230 RSr. Mandeville, La./St. Paul’s School 31 Wyatt Wilkes F 6-8 220 RJr. Orlando, Fla./Winter Park 33 Will Miles G 6-6 220 RSr. Orlando, Fla./Trinity Prep 34 Tanor Ngom C 7-2 236 Sr. Dakar, Senegal/Ryerson University (Canada) 40 Isaac Spainhour G 6-3 180 Fr. King, N.C./West Stokes 42 Cleveland Yates G 6-3 200 So. Memphis, Tenn./Briarcrest Christian School 44 Max Thorpe G 6-3 160 Fr. Clearwater, Fla./Clearwater Countryside PRONUNCIATION GUIDE: RayQuan Evans (RAY-Qwan); RaiQuan Gray (RAY-Qwan); Balsa Koprivica (Ball-Sha Ko-Pra-Vizza); Sardaar Calhoun (Suh-DAR Cal-Hoon); Tanor Ngom (Tuh-NOR en-GOM)
lorida State Basketball / National Polls
ASSOCIATED PRESS POLL Rk. Team 20-21 Rec. 1. Gonzaga (57) 2-0 2. Baylor (6) 2-0 3. Iowa 2-0 4. Wisconsin 2-0 5. Illinois 3-0 6. Duke 1-0 7. Kansas 1-1 8. Michigan State 2-0 9. Creighton 1-0 10. Houston 3-0 11. West Virginia 3-0 12. Villanova 2-1 13. Tennessee 0-0 14. North Carolina 1-0 15. Virginia 1-1 16. Virginia Tech 3-0 17. Texas Tech 2-1 Texas 1-0 19. Richmond 2-0 20. Kentucky 1-1 21. Oregon 0-0 22. FLORIDA STATE 0-0 23. Ohio State 2-0 24. Rutgers 3-0 25. Arizona State 2-1
USA TODAY POLL Rk. Team Points 1. Baylor (12) 764 2. Gonzaga (10) 762 3. Villanova (8) 755 4. Virginia 666 5. Kansas 612 6. Iowa 587 7. Wisconsin 579 8. Duke 555 9. Kentucky 541 10. Illinois 523 11. Creighton 458 12. Michigan State 437 13. Texas Tech 420 14. Tennessee 383 15. West Virginia 347 16. North Carolina 266 17. Arizona State 240 18. FLORIDA STATE 203 Houston 203 20. Oregon 193 21. UCLA 145 22. Texas 137 23. Rutgers 104 24. Ohio State 102 25. Alabama 62
Florida State’s 2020-21 Poll History Week AP Coaches Preseason 21 18
What’s Your #Hashtag for 2020 Quincy Ballard #downhill Sardarr Calhoun #challenging RayQuan Evans #different Nathanael Jack #pressure Balsa Koprivica #wow Will Miles #ohboy Malik Osborne #whatelse Anthony Polite #keeppushing Harrison Prieto #2021pls Wyatt Wilkes #pleaseletitend M.J. Walker #help
Florida State Basketball Upcoming Milestones
Leonard Hamilton
Victories as an ACC Coach 365 (Career at Florida State)
+98 (needs) 463
To become the 4th Winningest Coach in ACC History (all victories) (surpassing Gary
Williams of Maryland)
Leonard Hamilton ACC Victories at Florida State (Regular Season + ACC Tourn.)
171 (career at Florida State) +40 (needs)
211 To become the 4th Winningest Coach in ACC
History (ACC games) – surpassing Gary Williams of Maryland
Leonard Hamilton
Wins vs. AP No. 1 In Career 4 (career at Florida State)
+4 (needs) 8
To move into a tie for first place in college basketball history with Roy Williams for all-
time wins vs. the nation’s No. 1 ranked team
Florida State
All-Time Victories 1250 (current)
+50 (needs) 1,300
Florida State has an all-time record of 1,250-860 for a winning percentage of .592.
M.J. Walker
Career Points Scored 891 (career at Florida State)
+ 109 (needs) 1,000
To become the 49th player in school history to score 1,000 or more career points
M.J. Walker
Career 3-Point Field Goals Made 143 (career at Florida State)
+4 (needs) 147
To move into 10th place in school history with 147 career 3-point field goals made –
surpassing Ian Miller (2011-14)
M.J. Walker Career 3-Point Field Goals Made
143 (career at Florida State) +7 (needs)
150 To become the 10th player in school history with 150 or more career 3-point field goals
made
M.J. Walker Career 3-Point Field Goals Attempted
412 (career at Florida State) +38 (needs)
450 To become the 10th player in school history with 450 or more career 3-point field goals
attempted.
-
FLORIDA STATE A TOP NATIONAL TEAM IN REBOUNDING AFTER A LOSS Including its’ victor over Gardner-Webb (72-59, December 21), the Seminoles are 25-7 (.781 winning percentage) following a loss since the start of the 2015-16 season. Only Duke at 23-5 (.821 winning percentage) is better than the Seminoles in the last five seasons in rebounding after a loss. Wins After a loss by Win Percentage - Since 2016 Rank Team Record Pct. In 2020-21 1. Duke 21-5 .808 2-0 following a loss 2. Florida State 24-7 .774 1-0 following a loss 3. Virginia 18-6 .750 2-0 following a loss 4. Louisville 29-12 .707 1-0 following a loss 5. Syracuse 34-21 .618 1-0 following a loss M.J. WALKER’S RECORD WATCH Senior M.J. Walker enters Saturday’s game against Duke ranked in the top 11 in three different Florida State career statistical categories. He is ranked ninth in career free throw percentage (.805), 11th in career 3-point field goals made (143) and 11th in career 3-point field goals attempted (412). M.J. WALKER HAS… …Made at least one 3-pont field goal in each of Florida State’s seven games this season and in nine consecutive games dating back to Florida State’s win over Notre Dame on March 4, 2020. During that span of nine games, he is shooting .396 percent (19 of 48) from the bonusphere; …Made 26 of his last 28 free throws (.929 percent) in the last five games. He was a perfect 12 of 12 in Florida State’s victory over No. 25 Florida on December 12, 2020; …Has scored in double figures in six of seven games this season and is averaging a career-high 15.3 points scored per game entering Saturday’s game against Duke; …Has scored 891 career points and need 109 to become the 47th player in school history with 1,000 or more career points. NOTING SCOTTIE BARNES IN ACC PLAY Freshman Scottie Barnes is Florida State’s leading scorer with a 15.0 points per game scoring average in the Seminoles’ first two ACC games of the season and in his career. Barnes Off To A Hot Start In ACC Play Opponent Points FGM FGA Steals Rebounds Georgia Tech 16 6 10 2 6 Clemson 14 6 10 2 4 Totals 30/15.0 12 20 4 10/5.0 BARNES TIED FOR THE TEAM LEAD IN STEALS Freshman Scottie Barnes enters Saturday’s game against Duke tied for the team lead in steals with 12 and has earned multiple steals in four of the last six games. He totaled his career-high of four steals in Florida State’s victory over Indiana in the ACC/Big Ten Challenge. ANTHONY POLITE IN HIS LAST FIVE GAMES… …Has scored 60 points, averages 12.0 points per game, has scored in double figures four times, scored his career-high of 15 points in Florida State’s victory over Gardner-Webb, is shooting .568 from the field (21 of 37) and .579 from the 3-point line (11 of 19). POLITE’S SHOOTING Redshirt junior Anthony Polite is shooting a career-high .500 from the field (26 of 52) and a career-high .519 from the 3-ponit line (14 of 27). He entered the season shooting .399 from the field (after shooting .406 as a redshirt sophomore during the 2019-20 season) and shooting .317 from the bonusphere (after shooting .354 as a redshirt sophomore during the 2019-20 season) GRAY IS FLORIDA STATE’S MAN OF STEAL Redshirt junior RaiQuan Gray, who has six steals in Florida State’s last three games, enters Saturday’s game against Duke tied for the team lead in steals with 12. In averaging a career-high 1.7 steals per game (12 in seven games this season) he has upped his career-total of one full steal per game. In 72 career games, Gray has 72 steals. He has earned multiple steals in three of Florida State’s first seven games of the season including four in Florida State’s win over North Florida on December 2. WILKES EARNING PLAYING TIME AS 3’S CONTINUE TO FALL Redshirt junior Wyatt Wilkes, who enters Tuesday’s game against Duke averaging a career-high 13.4 minutes played per game, made three 3-point shots in scoring nine points in Florida State’s game against Clemson on Tuesday night. He has made six three point shots in the last four and has shot especially well from the bonusphere in Florida State’s two ACC games. Wilkes is averaging 10.0 points and shooting .750 from the 3-point line (six of eight) against Georgia Tech and Clemson. In 24 career ACC games, Wilkes is shooting .469 from the 3-point line (23 of 49) as compared to his .239 career 3-point shooting percentage (17 of 71) in 32 non-conference games. TANOR NGOM VS. DUKE Florida State senior center Tanor Ngom will face Duke for the second time in his career on Saturday. Ngom, a transfer from Ryerson University in Canada and his teammates faced Duke in an exhibition game on August 15, 2018. Ngom scored 12 points, blocked three shots and pulled down two rebounds in the game won by the Blue Devils by an 86-67 margin. “He’s got a 7-6 wingspan. He’s got a good skill level. A unique player. It came down to UConn and Ryerson for his services. That’s really amazing, that Ryerson was able to get a player of this caliber and especially to get him away from UConn,” said ESPN’s Jay Bilas.
Florida State Basketball By The Numbers
.500 Senior RayQuan Evans is shooting .500 from the 3-point line in the last two games (three of six). He made his season-high of two shots from the bonusphere in Florida State’s victory over Gardner-Webb. .533 Freshman Scottie Barnes his shooting .533 from the field (24 of 45) in the last five games. He shot .700 percent (seven of 10) in Florida State’s victory over Florida, .600 percent (six of 10) in the Seminoles’ win over Georgia Tech and .600 percent (six of 10) against Clemson. .633 Freshman Scottie Barnes has scored in double figures in three of the first seven games of his career. In this three games against Florida (career-high 17 points), Georgia Tech (16 points) and Clemson (14 points), he is shooting .633 percent from the field (19 of 30). .658 Sophomore Balsa Koprivica is shooting .658 percent from the field (77-117) as a Seminole. He is on pace to challenge the all-time Florida State field goal shooting percentage record of .668 by Murray Brown (566-847, .668 percent). .800 Senior RayQuan Evans, who was a perfect two of two from the free throw line against Clemson, is shooting .800 percent from the free throw line in the last two games (four of five). .857 Sophomore Balsa Koprivica is shooting .857 from the free throw line (six of seven) in the last two games. 4 Senior M.J. Walker enters Saturday’s game against Duke having made four consecutive free throws. He was a perfect two of two against both Gardner-Webb (December 21) and Clemson (December 29). Walker is ranked fourth in the ACC with his career-high .925 free throw shooting percentage through the first seven games of the season. 5 Florida State is undefeated, 5-0, when it outscores its opponent. 7 Redshirt junior Anthony Polite has made at least one 3-point shot in each of the Seminoles’ first seven games of the season and enters Saturday’s game against Duke shooting a career-high .519 from the 3-point line. 11 Sophomore Balsa Koprivica is averaging a near double-double of 11.0 points and 8.5 rebounds in his last two games. He scored 14 points against Gardner-Webb (December 21) and totaled nine rebounds against Clemson (December 29). 23 Redshirt junior Wyatt Wilkes has made 23 3-point shots in 24 career ACC games (23 of 49, .469) as compared to 17 made 3-point shots (17 of 71, .239) in 32 non-conference games during his career as a Seminole.
-
2020-21 Florida St. Men's BasketballCombined Team Statistics
All gamesPage 1/1
as of Dec 30, 2020
Game RecordsRecord Overall Home Away NeutralALL GAMES 5-2 5-1 0-1 0-0CONFERENCE 1-1 1-0 0-1 0-0NON-CONFERENCE 4-1 4-1 0-0 0-0
Score by PeriodsTeam 1st 2nd OT TOTFlorida St. 254 264 7 525Opponents 207 267 5 479
Team Box Score
No. PlayerTotal 3-Point F-Throw Rebounds
GP-GS MIN AVG FG-FGA FG% 3FG-FGA 3FG% FT-FTA FT% OFF DEF TOT AVG PF DQ A TO BLK STL PTS AVG23 WALKER, M.J. 7-7 225:11 32.2 28-69 .406 14-37 .378 37-40 .925 6 13 19 2.7 15 0 14 20 1 6 107 15.34 BARNES, Scottie 7-7 184:32 26.4 31-66 .470 5-18 .278 11-26 .423 9 18 27 3.9 17 0 30 16 2 12 78 11.12 POLITE, Anthony 7-7 204:34 29.2 26-52 .500 14-27 .519 10-19 .526 13 23 36 5.1 16 0 11 9 4 8 76 10.95 KOPRIVICA, Balsa 7-7 137:29 19.6 26-44 .591 0-0 .000 17-25 .680 11 30 41 5.9 16 1 4 8 7 2 69 9.91 GRAY, RaiQuan 7-7 175:40 25.1 19-48 .396 3-16 .188 8-12 .667 6 36 42 6.0 22 0 13 13 7 12 49 7.00 EVANS, RayQuan 6-0 106:48 17.8 9-27 .333 3-9 .333 7-8 .875 3 10 13 2.2 8 0 6 6 0 2 28 4.7
31 WILKES, Wyatt 7-0 95:17 13.6 12-35 .343 7-22 .318 0-0 .000 4 8 12 1.7 5 0 12 3 4 3 31 4.424 CALHOUN, Sardaar 7-0 70:30 10.1 9-27 .333 5-15 .333 4-4 1.000 1 5 6 0.9 2 0 2 1 0 2 27 3.910 OSBORNE, Malik 7-0 142:01 20.3 9-27 .333 1-9 .111 6-7 .857 18 18 36 5.1 19 0 4 9 3 5 25 3.611 JACK, Nathanael 5-0 33:13 6.6 5-13 .385 4-11 .364 3-5 .600 1 0 1 0.2 6 0 1 2 1 0 17 3.412 LINDNER, Justin 1-0 00:31 0.5 1-1 1.000 0-0 .000 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 2 2.034 NGOM, Tanor 6-0 25:07 4.2 3-5 .600 0-0 .000 4-6 .667 2 6 8 1.3 7 0 0 4 2 1 10 1.715 BALLARD, Quincy 6-0 18:06 3.0 3-3 1.000 0-0 .000 0-1 .000 1 1 2 0.3 2 0 0 2 1 0 6 1.033 MILES, Will 1-0 00:31 0.5 0-0 .000 0-0 .000 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 0 0.020 LIGHT, Travis 1-0 00:31 0.5 0-1 .000 0-1 .000 0-0 .000 1 0 1 1.0 0 0 0 0 0 0 0 0.030 PRIETO, Harrison 3-0 04:60 1.7 0-0 .000 0-0 .000 0-2 .000 0 0 0 0.0 1 0 0 1 0 0 0 0.0Team 9 8 17 2Total 7 1425 181-418 .433 56-165 .339 107-155 .690 85 176 261 37.3 136 1 97 96 32 53 525 75.0Opponents 7 1425 155-392 .395 55-161 .342 114-148 .770 75 164 239 34.1 133 2 80 109 20 42 479 68.4
Team StatisticsFSU OPP
Scoring 525 479Points per game 75.0 68.4Scoring margin +6.6 -
Field goals-att 181-418 155-392Field goal pct .433 .395
3 point fg-att 56-165 55-1613-point FG pct .339 .3423-pt FG made per game 8.0 7.9
Free throws-att 107-155 114-148Free throw pct .690 .770F-Throws made per game 15.3 16.3
Rebounds 261 239Rebounds per game 37.3 34.1Rebounding margin +3.1 -
Assists 97 80Assists per game 13.9 11.4
Turnovers 96 109Turnovers per game 13.7 15.6Turnover margin +1.9 -Assist/turnover ratio 1.0 0.7
Steals 53 42Steals per game 7.6 6.0
Blocks 32 20Blocks per game 4.6 2.9
Winning streak 0 -Home win streak 0 -
Attendance 15755 1876Home games-Avg/Game 6-2626 1-1876Neutral site-Avg/Game - 0-0
Team ResultsDate Opponent Score Att.11/27/2020 Gardner-Webb W 72-59 207812/02/2020 North Florida W 86-58 272012/09/2020 Indiana Wot 69-67 295612/12/2020 Florida W 83-71 276112/15/2020 Georgia Tech W 74-61 266412/19/2020 UCF L 74-86 257612/29/2020 at Clemson L 67-77 1876
-
2020-21 Florida St. Men's BasketballCombined Team Statistics
Specific gamesPage 1/1
as of Dec 30, 2020
Game RecordsRecord Overall Home Away NeutralALL GAMES 1-1 1-0 0-1 0-0CONFERENCE 1-1 1-0 0-1 0-0NON-CONFERENCE 0-0 0-0 0-0 0-0
Score by PeriodsTeam 1st 2nd OT TOTFlorida St. 70 71 0 141Opponents 58 80 0 138
Team Box Score
No. PlayerTotal 3-Point F-Throw Rebounds
GP-GS MIN AVG FG-FGA FG% 3FG-FGA 3FG% FT-FTA FT% OFF DEF TOT AVG PF DQ A TO BLK STL PTS AVG4 BARNES, Scottie 2-2 51:52 25.9 12-20 .600 1-6 .167 5-8 .625 2 8 10 5.0 7 0 6 6 1 4 30 15.0
23 WALKER, M.J. 2-2 67:35 33.8 8-19 .421 3-10 .300 6-6 1.000 2 5 7 3.5 2 0 4 4 0 2 25 12.531 WILKES, Wyatt 2-0 26:14 13.1 7-12 .583 6-8 .750 0-0 .000 1 2 3 1.5 3 0 2 0 2 0 20 10.05 KOPRIVICA, Balsa 2-2 45:18 22.7 8-11 .727 0-0 .000 2-5 .400 4 12 16 8.0 3 0 3 2 1 1 18 9.00 EVANS, RayQuan 1-0 20:42 20.7 3-4 .750 1-2 .500 2-2 1.000 0 2 2 2.0 2 0 0 2 0 0 9 9.02 POLITE, Anthony 2-2 61:12 30.6 6-14 .429 4-8 .500 1-2 .500 0 5 5 2.5 5 0 5 4 0 4 17 8.5
24 CALHOUN, Sardaar 2-0 16:24 8.2 3-8 .375 1-4 .250 0-0 .000 0 1 1 0.5 0 0 1 1 0 0 7 3.51 GRAY, RaiQuan 2-2 51:56 26.0 2-13 .154 0-6 .000 2-2 1.000 2 7 9 4.5 8 0 2 6 1 3 6 3.0
15 BALLARD, Quincy 1-0 04:06 4.1 1-1 1.000 0-0 .000 0-0 .000 1 0 1 1.0 1 0 0 1 0 0 2 2.010 OSBORNE, Malik 2-0 43:30 21.8 2-8 .250 0-3 .000 0-0 .000 2 7 9 4.5 5 0 3 2 1 0 4 2.011 JACK, Nathanael 2-0 08:33 4.3 1-3 .333 1-2 .500 0-0 .000 0 0 0 0.0 2 0 0 0 1 0 3 1.534 NGOM, Tanor 1-0 02:37 2.6 0-0 .000 0-0 .000 0-0 .000 0 0 0 0.0 1 0 0 1 0 0 0 0.0Team 1 1 1Total 2 400 53-113 .469 17-49 .347 18-25 .720 15 49 64 32.0 39 0 26 30 7 14 141 70.5Opponents 2 400 45-114 .395 12-44 .273 36-48 .750 25 47 72 36.0 31 1 21 24 3 14 138 69.0
Team StatisticsFSU OPP
Scoring 141 138Points per game 70.5 69.0Scoring margin +1.5 -
Field goals-att 53-113 45-114Field goal pct .469 .395
3 point fg-att 17-49 12-443-point FG pct .347 .2733-pt FG made per game 8.5 6.0
Free throws-att 18-25 36-48Free throw pct .720 .750F-Throws made per game 9.0 18.0
Rebounds 64 72Rebounds per game 32.0 36.0Rebounding margin -4.0 -
Assists 26 21Assists per game 13.0 10.5
Turnovers 30 24Turnovers per game 15.0 12.0Turnover margin -3.0 -Assist/turnover ratio 0.9 0.9
Steals 14 14Steals per game 7.0 7.0
Blocks 7 3Blocks per game 3.5 1.5
Winning streak 0 -Home win streak 1 -
Attendance 2664 1876Home games-Avg/Game 1-2664 1-1876Neutral site-Avg/Game - 0-0
Team ResultsDate Opponent Score Att.12/15/2020 Georgia Tech W 74-61 266412/29/2020 at Clemson L 67-77 1876
-
Florida State Center Balsa Koprivica Is Showing A Lot Of Improvement In Sophomore Season By Antwan Staley Tallahassee Democrat January 1, 2021 As a freshman reserve last season, Florida State center Balsa Koprivica played in 27 games. But he struggled with back and knee injuries throughout the year. A limited Koprivica averaged 4.7 points (eighth on the team) and 2.4 rebounds (seventh) while shooting a team-leading 69.9% from the field. Koprivica during the offseason was able to take time off and regain his health. Through seven games (5-2) this season heading into Saturday's home showdown against Duke (3-2), Koprivica has raised his game to another level. Koprivica, a 7-foot-1, 240-pounder, is averaging 9.9 points, 5.9 rebounds, and 1.0 blocks per game. He is also shooting 59.1% from the field. In Tuesday's 77-67 defeat at Clemson, Koprivica had eight points and tied a career-high with nine rebounds. The native of Belgrade, Serbia, credits his improvement to hard work on and off of the court. "I've been watching a lot of film and just trying to figure out ways to be as productive as I can at this level because every level you play at is different, Koprivica told the Democrat. "College basketball is different than high school and the NBA and overseas in Europe. Every level of basketball is different, so you gotta adapt your game to be as efficient as possible. "I think in college basketball, there's a lot of film to watch, teams to always prepare for, opposing players who know your tendency. Just being able to figure out what's the best for me and the best way I can be productive, and that's the man thing I focused on and working my game throughout the whole summer up into this season." Improved Long Range Shooting In today's game, not only are big men like Koprivica expected to contribute inside the paint, but also away from the basket. With that in mind, Koprivica has been working on his long-range shooting. With the help of FSU associate head coach Stan Jones, Koprivica has been tweaking his jump shot with the hopes of becoming more of a spot-up shooter. FSU recruited Koprivica from Montverde Academy in Orlando with the belief he would become more of an all-around player. Koprivica hasn't taken many jump shots this season, but his coaches trust him and are giving him the freedom to take those shots whenever he chooses. In his first career start in the Seminoles' season-opening win over North Florida, Koprivica turned in a solid all-around performance with 13 points, five rebounds, two blocked shots, one steal and one assist. "We started with a plan with him being an effective interior player, and now we have moved into Phase 2 at the start of his second year in adding his ability to go out and play on the floor and face up and get those opportunities to show he has a complete game as a player and not just a complete game as a big man," Jones told the Democrat. "He's been very receptive, very coachable, very enthusiastic about his work. I think people are starting to see the step by step improvements that he is making. Big men are that way, they don't typically go from point A to point Z. They have to go through all the letters in the alphabet.
https://www.tallahassee.com/staff/3684441001/antwan-staley/
-
"Big guys always continue to make that progress on a consistent basis. If you watch the game closely from game to game with Balsa, you will see the light getting brighter in every area of his understanding and things he needs to work on. One area of Koprivica's game that's still a work in progress is his defense. Last season, Koprivica was counted on defensively to give the Seminoles a spark off the bench. Now that he's a starter and playing more minutes, Koprivica feels like he hasn't generated the same defensive intensity as he did a season ago. "I just took pride in that and just tried to switch on anyone on the floor and guide anyone," Koprivica said. "And that also brought me energy, going to the glass and being aggressive on offense. And I think obviously this year with playing more minutes, I think I need to do a better job of doing the defensive techniques and closing out a little bit better. "So I think when it comes to close-outs, I just need to have better footwork, so I don't get blown by. Because sometimes, it is hard when you're in a rotation, and then you have to close out, and someone does rip drives next to you. In general, my defense needs to get a little bit more active this year on defense just like I did last year, just bring more energy to it." Looking To Bounce Back FSU is coming off its first ACC loss of the season at Clemson on Tuesday. The Tigers outrebounded the Seminoles 49-35. Additionally, Clemson converted 24 of 33 free throws, while FSU went 6 of 9. The Seminoles were called for 24 personal fouls, compared to 14 for the Tigers. Turnovers were also a contributing factor in the Seminoles' loss. They had 17. Koprivica says he is confident FSU will continue to get better and learn and grow from the loss as the team gets deeper into ACC play. Duke provides an important test as the Seminoles have dropped two of their last three games. "They shot a pretty poor percentage from the field, and so did we," Koprivica said of the Clemson defeat. "They didn't shoot the ball well, so that means that we were doing a decent job. They had way more offensive rebounds, I think they had 19 offensive rebounds, and we had turnovers in the beginning as we had six turnovers in the first few possessions. "And they attacked the basket more and got to the free-throw line. So those three things are what we need to focus on, attacking the glass, don't let the opposing team get offensive rebounds, and shoot more free throws than the other team. If we do those three things, everything else will fall into place. We will hit shots, and we will get open looks." 2020 has been a difficult year for everyone in all walks of life. But there have been some positives when it comes to FSU basketball. Last season, the Seminoles finished 26–5 and won the ACC regular-season championship. However, the 2020 ACC Tournament and the 2020 NCAA Tournament was canceled because of the COVID pandemic. Even before this season started, FSU players dealt with the new normal in the world of COVID. Players were limited in the number of times they could practice as many worked out individually to prepare for this season. Koprivica is determined to embrace the learning experiences. "I think 2020 had a lot of ups and downs," Koprivica said. "I think a lot of people had a lot of ups and downs. But just in general, I just try to learn from everything that happened throughout this whole year."
-
F L O R I D A S T A T E U N I V E R S I T Y
GuardRayQuan Evans#0
RayQuan Evans’ Career High’sPTSPTS ........... ........... 9 at Clemson (12-29-20)FGMFGM ......... ......... 3 at Clemson (12-29-20)......................................3 vs. Miami (2-8-20)......................................3 at Louisville (1-4-20)FGAFGA .......... .......... 6 vs. Gardner-Webb (12-21-20)......................................6 vs. Boston College (2-7-20)FG%FG% ......... ......... 1.000 at Clemson (2-29-20)......................................1.000 at Louisville (1-4-20)3FGM3FGM ....... ....... 2 vs. Gardner-Webb (12-21-20)......................................2 vs. Syracuse (2-15-20)3FGA3FGA ........ ........ 4 vs. Gardner-Webb (12-21-20)3FG%3FG% ....... ....... .667 vs. Syracuse (2-15-20)FTMFTM .......... .......... 4 vs. Chattanooga (11-20-19)FTAFTA ........... ........... 6 vs. Chattanooga (11-22-19)FT%FT% ......... ......... 1.000 vs. 6 Teams......................................Last at Clemson (12-29-20)OROR..........................2 vs. Gardner-Webb (12-21-20)......................................2 vs. Miami (2-8-20)DRDR ............. .............4 vs. Boston College (2-7-20)REBSREBS ........ ........4 vs. Gardner-Webb (12-21-20)......................................4 vs. Boston College (3-7-20)......................................4 at Miami (2-8-20)ASTAST ........... ...........6 vs. Boston College (3-7-20)BLKBLK .......... .......... 1 vs. 3 Teams ......................................Last vs. NC State (2-22-20)STLSTL ........... ........... 4 vs. Chattanooga (11-22-19)MINMIN .......... ..........25 vs. Chicago State (11-25-19)underlined denotes career high established or tied during the 2020-21 season
6-4, 210, Senior, Billings, Montana
2020-21 Season* A career-high 9 points and 2 rebounds in 21 minutes played in Florida State’s ACC road opener at Clemson* Totaled 8 points and a careear-high tying 4 rebounds in Florida State’s win over Gardner-Webb* Totaled 4 points, 3 rebounds and 1 assist in Florida State’s season opening victory over North Florida on Dec. 2* As a second-year player in Florida State’s rotation, Evans has earned the opportunity to play major minutes at the lead guard position for the Seminoles who have cemented themselves into the nation’s elite.* HisplayinhisfirstseasonatFloridaStatesimplyshowedwhatheiscapableofasaguardashecontinuestogrow comfortablewiththeSeminoles’offensiveanddefensivesystems.
2019-20 Season* Averaged 3.2 points (12th on the team), 1.4 assists (third) and 1.2 rebounds (10th) as he played in 29 of Florida State’s 31 games * His career high of 8 points and a career-high 4 rebounds in Florida State’s victory over Miami in Tallahassee* Made his Florida State debut with 3 minutes played in Florida State’s victory over Western Carolina* Totaled 6 points, 5 assists and 2 rebounds in Florida State’s victory at home against Saint Francis* Totaled 6 points, 2 assists and 1 steal in Florida State’s victory over Chicago State in Tallahassee
At North Idaho* Graduated from North Idaho College in 2019 with an Associate’s Degree in Graphic Design.* Recognized as the Northwest Athletic Conference Male Basketball Athlete of the Year in 2019.* Named to the All-East Region Defensive Team and as the East Region MVP in 2019.* LedtheCardinalstoatwo-yearcombinedrecordof56-10;theyfinishedwithacombined27-5overallrecord in NWAC play including a perfect 16-0 record during the 2018-19 season.* Averaged 18.2 points, 7.4 rebounds and 4.9 assists in leading North Idaho to its second consecutive Northwest Athletic Conference championship in 2019.
On Evans* His dad played basketball at the University of Montana. He played two seasons as a forward at Montana. (1993 and 1994). He averaged 9.1 points, 4.2 rebounds, 0.9 steals and 0.3 blocked during his career* Has three brothers – Tray, Tye and Cam.* Originally from (and born in) Georgetown, S.C. Moved to Montana to begin his freshman year of high school.
2020-21 Game-By-Game Statistics -- RayQuan EvansDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida 1-0 16 2-5 .400 0-1 .000 0-0 .000 1-2 3 1 1 0 0 0 4D9 Indiana 2-0 13 0-4 .000 0-0 .000 0-0 .000 0-0 0 0 1 0 0 1 0D12 Florida 3-0 18 1-4 .250 0-1 .000 3-3 1.000 0-3 3 2 2 1 0 0 5D15 * Georgia Tech DNPD19 UCF 4-0 15 1-4 .250 0-01 .000 0-0 .000 0-1 1 3 2 3 0 0 2D21 Gardner-Webb 5-0 24 2-6 .333 2-4 .500 2-3 .667 2-2 4 0 0 0 0 1 8D29 * at Clemson 6-0 21 3-4 .750 1-2 .500 2-2 1.000 0-2 2 2 0 2 0 0 9J2 * Duke J6 * at Syracuse J9 * at Pittsburgh J113 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
87-17In the last three seasons,
RayQuan Evans has led two teams at North Idaho
College (56-10) and two at Florida State (31-7) to an
overall record of 87-17 and a winning percentage of
.837
-
F L O R I D A S T A T E U N I V E R S I T Y
2020-21 Game-By-Game Statistics -- RaiQuan GrayDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida 1-1 18 4-8 .500 0-2 .000 0-0 .000 1-4 5 1 1 2 1 4 8D9 Indiana 2-2 31 5-10 .500 1-2 .500 1-4 .250 1-8 9 4 4 0 1 1 12D12 Florida 3-3 24 2-5 .400 0-0 .000 1-2 .500 2-6 8 3 2 3 2 1 5D15 * Georgia Tech 4-4 30 1-5 .200 0-1 .000 2-2 1.000 2-4 6 4 2 2 0 0 4D19 UCF 5-5 26 5-7 .714 2-2 1.000 2-2 1.000 0-3 3 4 2 1 0 2 14D21 Gardner-Webb 6-6 25 1-5 .200 0-4 .000 2-2 1.000 0-8 8 2 2 1 2 0 4D29 * at Clemson 7-7 22 1-8 .125 0-5 .000 0-0 .000 0-3 3 4 0 4 1 3 2J2 * Duke J6 * at Syracuse J9 * at Pittsburgh J/13 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
RaiQuan Gray’s Career HighsPTS ........... 14 vs. UCF (12-19-20)FGM ......... 6 vs. Notre Dame (1-25-20)FGA .......... 10 vs. 5 Teams...................Last vs. Indiana (12-9-20)FG% ......... 1.000 vs. 3 Teams...................Last at Wake Forest (3-9-19)3FGM ....... 3 vs. Murray State (3-23-19)3FGA ........ 5 at Clemson (12-29-20)3FG% ....... 1.000 vs. UCF (12-19-20)...................1.000 at Virginia (1-28-20)...................1.000 at North Carolina (2-23-19)FTM .......... 5 vs. Louisville (2-24-20)FTA ........... 7 vs. Louisville (2-24-20)FT% ......... 1.000 vs. 13 Teams...................Last vs. Gardner-Webb (12-21-20)OR.............5 vs. Syracuse (2-15-20)DR .............8 vs. Gardner-Webb (12-21-20)...................8 vs. Indiana (12-9-20)REBS ........10 vs. Syracuse (2-15-20)AST ...........5 vs. North Florida (12-17-19)BLK .......... 4 vs. North Carolina (2-3-20)STL ........... 5 vs. Murray State (3-23-19)MIN ..........31 vs. Indiana (12-9-20)underlined denotes career high established or tied during the 2020-21 season
6-8, 260, Redshirt-Junior, Ft. Lauderdale, Fla.
#1 RaiQuan Gray Forward
2020-21 Season* Scored his career-high of 14 points with 3 rebounds and 2 assists in Florida State’s game against UCF on Dec. 19* A near double double of 12 points and 9 reboinds in Florida State’s overtime victory over Indiana on Dec. 9.* One of the Seminoles’ team leaders who has put himself in position to become a star on a national level in his fourth season as a Seminole* A 24-game starter in 2020 who has started 28 career games, 19 ACC games and three NCAA Tournament games in thefirsttwoseasonsofhiscareer
2019-20 Season* Averaged6.0points(tiedfor6thontheteam)and3.8rebounds(fifth)andheplayedin29ofFloridaState’s31 games as the Seminoles won the 2020 ACC Championship.* A full-time starter as he started 24 of the 29 games he played in as a redshirt sophomore* Scored his career-high of 13 points in Florida State’s victory over Notre Dame in Tallahassee* Totaled 12 points and a career-high tying 7 rebounds in Florida State’s victory over North Carolina in Tallahassee* A career-high 10 rebounds in and 2 points and Florida State’s victory over Syracuse at the Donald L. Tucker Center
2018-19 Season* Averaged 3.9 points (10th on the team), 2.3 rebounds (sixth), 0.8 steals (third) and shot .721 from the free throw. line (seventh) as he played in 36 of Florida State’s 37 games in leading the Seminoles to the Sweet 16 of the NCAA Tournament.* AnintegralpartofFloridaState’srecord-setting2018-19seasonastheSeminolesfinishedwitha28-9record,a 13-5 record in ACC play, in fourth place in the ACC standings, with their third appearance in school history in the ACC Tournament Championship game and a second consecutive appearance in the Sweet 16 of the NCAA Tournament.* Totaled his career-high of 11 points in Florida State’s second round NCAA Tournament game victory over Murray State at the XL Center in Hartford, Conn. His 11 points came in a starters role during which he played his career- high of 24 minutes.
2017-18 Season* A redshirt season. He did not appear in any games during the regular season.* Averaged 8.5 points and 4.5 rebounds in Florida State’s pair of exhibition games wins to begin the season.
On Gray* Graduated from Dillard High School in 2017* As a senior he led Dillard to a 28-5 record overall while averaging a double-double of 16 points and 12 rebounds.* HelpedthePanthersfinish28-4andnationallyranked20thbyMaxPreps.* Was recognized by MaxPreps as a part of the Tour of Champions nationally ranked teams.* Selected as a member of the 2016 and 2017 All-Broward County First-Team by the Miami Herald.
34/39RaiQuan Gray has been
in Florida State’s starting lineup in 34 of the last 39 Seminole games dating
to Florida State’s victory over Vermont in the 2018
NCAA Tournament
-
F L O R I D A S T A T E U N I V E R S I T Y
2020-21 Game-By-Game Statistics -- Anthony PoliteDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida 1-1 24 3-7 .428 1-2 .500 0-0 .000 1-2 3 2 2 1 1 1 7D9 Indiana 2-2 33 3-8 .375 2-6 .333 1-4 .250 4-4 8 3 0 0 1 0 9D12 Florida 3-3 28 4-7 .571 3-4 .750 3-4 .750 2-3 5 1 2 1 1 1 14 D15 * Georgia Tech 4-4 34 4-7 .571 2-4 .500 0-0 .000 0-1 1 3 1 0 0 3 10D19 UCF 5-5 31 5-8 .625 3-4 .750 1-2 .500 4-2 6 3 1 3 0 0 14D21 Gardner-Webb 6-6 28 5-8 .625 1-3 .333 4-7 .571 2-7 9 2 1 0 1 2 15D29 * at Clemson 7-7 27 2-7 .286 2-4 .500 1-2 .500 0-3 3 4 2 3 0 1 7J2 * Duke J6 * at Syracuse J9 * at Pittsburgh J113 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F10 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
Anthony Polite’s Career HighsPTS ........... 15 vs. Gardner-Webb (12-21-20)FGM ......... 5 vs. 3 Teams ...................Last vs. Gardner-Webb (12-21-20)FGA .......... 10 at Pitt (11-6-19)FG% ......... 1.000 vs. Wake Forest (2-13-19)3FGM ....... 4 vs. Virginia (1-15-20)...................4 vs. Clemson (12-8-19)3FGA ........ 7 vs. USF (12-21-19)3FG% ....... 1.000 vs. Virginia (1-15-20)...................1.000 vs. Murray State (3-23-19)FTM .......... 4 vs. Gardner-Webb (12-21-20)...................4 vs. Canisius (11-19-18)FTA ........... 7 vs. Gardner-Webb (12-21-20)FT% ......... 1.000 vs. 11 teams...................Last vs. Georgia Tech (12-31-19)OR.............4 vs. 3 Teams...................Last vs. UCF (12-19-20)DR .............7 vs. Gardner-Webb (12-21-20)...................7 vs. Miami (2-8-20)REBS ........9 vs. Gardner-Webb (12-21-20)AST ...........5 vs. Notre Dame (1-25-20)...................5 vs. Chicago State (11-25-19)BLK .......... 1 vs. 11 Teams...................Last vs. Florida (12-12-20)STL ........... 5 at Miami (1-18-20)...................5 vs. Saint Francis (11-23-19)MIN ..........33 vs. Indiana (12-9-20)underlined denotes career high established or tied during 2020-21 season
GuardAnthony Polite#26-6, 215, Redshirt-Junior, Lugano, Switzerland
2020-21 Season* Scored his career-high of 15 points to go along with a career-high 9 rebs in Florida State’s win over Gardner-Webb* Totaled 14 points with 6 rebounds and 1 assist against UCF on Dece. 19* Totaled 10 points, 3 assists and 3 steals in Florida State’s 74-61 victory over Georgia Tech on December 15* Tied his career-high with 14 points to go along with 5 rebounds and 2 assists in Florida State’s victory over Florida* A breakout season is on the horizon for Florida State’s two-way weapon who could be considered the best on-ball defender and best long range shooter on the Seminoles’ roster for the 2020-21 season.* Will contend for All-ACC and All-Defensive team honors as he has worked on making himself a tremendous two- way player in the Seminoles’ system as he continues to take on a leadership role in helping Florida State increase its’ nationalprofile.
2019-20 Season* Averaged 5.8 points (seventh on the team), 2.9 rebounds (sixth) and made 34 3-point shots (third) as he played in all 31 of Florida State’s games.* Startedacareer-higheightgamesincludingfiveinACCplayasFloridaStatewonthe2020ACCChampionship* Named the Most Outstanding Player with 11 points, 5 rebounds and 4 assists in Florida State’s 66-60 victory over USF in the Orange Bowl Classic at the BB&T Center in Sunrise, Fla.* Hiscareer-highof14pointson4of4made3-pointfieldgoalsinFloridaState’svictoryoverVirginiainTallahassee* AstarterforthefirsttimeinhiscareerintheSeminoles’victoryoverChattanoogainTallahassee
2018-19 Season* Averaged 2.7 points (11th on the team), 1.6 rebounds (ninth) and 0.6 steals (seventh) while playing in 30 of Florida State’s 37 games during its record-setting and NCAA Tournament season.* Averaged 11.5 minutes played per game as one of 11 Seminoles who averaged 11 or more minutes played per game* Ahugeliftoffofthebenchwith9points,4reboundsand3stealsinFloridaState’svictoryoverMurrayStatein the NCAA Tournament -- a win that sent the Seminoles to the Sweet 16 of the NCAA Tournament
2017-18 Season * A redshirt season as he did not play in any games for the Seminoles during the regular season* Averaged 6.0 points and 3.5 assists in Florida State’s two exhibition game victories to begin the season* Totaled 1 rebound, 1 assist and 1 steal in his career debut against George Washington on Nov. 14
On Polite* Graduated from St. Andrew’s Christian School in 2017* Averaged a double-double of 19.1 points and 11.7 rebounds to go along with 4.6 assists and 2.4 steals in 26 games whileleadingSt.Andrew’stoaregionalsemifinal.Scored24pointsinthesemifinalloss* Finished his high school career with 1,545 points
1Anthony Polite was a perfect 4 of 4 from the 3-point line in Florida
State’s victory over Vir-ginia on Jan. 15, 2020 -- his perfect shooting percentage istiedforfirstinschoolhis-
tory for a single game
-
F L O R I D A S T A T E U N I V E R S I T Y
#4 Scottie Barnes Guard/Forward
Scottie Barnes’ Career HighsPTS ..........17 vs. Florida (12-12-20)FGM ........7 vs. Florida (12-12-20)FGA .........11 vs. North Florida State (12-2-20)FG% .........700 vs. Florida (12-12-20)3FGM ......1 at Clemson (12-29-20)..................1 vs. Gardner-Webb (12-21-20)..................1 vs. Florida (12-12-20)..................1 vs. Indiana (12-9-20)3FGA .......4 vs. Gardner-Webb (12-21-20)3FG % ......500 vs. Florida (12-12-20)...................500 vs. Indiana (12-9-20)FTM .........4 vs. Georgia Tech (12-15-20)FTA ..........6 vs. Georgia Tech (12-15-20)..................6 vs. Florida (12-12-20)FT% .........667 vs. Georgia Tech (12-15-20)OR............3 vs. North Florida State (12-2-20)DR ............6 vs. Georgia Tech (12-15-20)REBS .......6 vs. Georgia Tech (12-15-20)..................6 vs. North Florida State (12-2-20)AST ..........6 vs. North Florida State (12-2-20)BLK .........STL ..........4 vs. Indiana (12-9-20)MIN .........30 vs. Georgia Tech (12-15-20)..................30 vs. Indiana (12-9-20)underlined denotes career high established or tied during 2020-21 season
6-9, 227, Freshman, West Palm Beach, Fla.
2020-21* The ACC Freshman of the Week (Dec. 14) for his performances against Indiana and Florida* Scored a team-high of 14 points at Clemson in Florida State’s ACC road opener* Scored a team-high 16 points and pulled down six rebounds in Florida State’s victory over Georgia Tech* Totaled 17 points to go along with 5 assists and 2 rebounds in Florida State’s victory over Florida in Tallahassee* Scored the game wining shot with 1.8 seconds left to play in Florida State;s victory over Indiana in the ACC/Big Ten Challenge. He totaled 9 points and 5 assists agains the Hoosiers. * Totaled 8, a team-high 6 rebounds and a team-high 6 asists in his career debut as a starter in Florida State’s season- opening victory over North Florida* A Preseason All-American Third-Team by CBS Sports.* Named as a preseason All-ACC First Team player by CBS Sports.* A candidate for the Bob Cousy Award as presented by the Naismith Basketball Hall Of Fame as the nation’s top point guard.* Named as the preseason ACC Freshman of the Year and as a preseason All-ACC First Team Selection at ACC Opera tion Basketball.
On Barnes* Graduated from Montverde Academy in 2020.* Averaged 11.6 points, 6.5 rebounds and 4.6 assists in helping Montverde to a 25-0 record.* The Eagles earned an average margin of victory of 39 points per game.* Earned All-American First Team honors from both MaxPreps and Sports Illustrated.* AfinalistastheMaxPrepsNationalPlayeroftheYear.* Selected to play in the McDonald’s All-American game, the Jordan Brand Classic and the Nike Hoop Summit.
2020-21 Game-By-Game Statistics -- Scottie BarnesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S Pts D2 North Florida 1-1 24 3-11 .364 0-2 .000 0-3 .000 3-3 6 0 6 2 0 0 8D9 Indiana 2-2 30 3-10 .300 1-2 .500 2-4 .500 2-2 4 3 5 2 0 4 9D12 Florida 3-3 28 7-10 .700 1-2 .500 1-6 .333 0-2 2 3 5 3 1 0 17D15 * Georgia Tech 4-4 30 6-10 .600 0-3 .000 4-6 .667 0-6 6 3 1 3 0 2 16D19 UCF 5-5 29 3-8 .375 1-3 .333 1-3 .333 1-2 3 2 3 1 0 1 8N27 Gardner-Webb 6-6 22 2-7 .286 1-3 .333 1-2 .500 1-1 2 2 5 2 2 1 6D29 * at Clemson 7-7 22 6-10 .600 1-3 .333 1-2 .500 2-2 4 4 5 3 1 2 14J2 * Duke J6 * at Syracuse J9 * at Pittsburgh J13 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
7Scottie Barnes is one of 50
players from around the nation -- and one of seven from the ACC -- who is on the 2021 Naismith Award
Preseason Watch List
-
F L O R I D A S T A T E U N I V E R S I T Y
Balsa Koprivica’s Career HighsPTS ........... 15 vs. Boston College (3-7-20)...................15 vs. North Florida (12-17-19)FGM ......... 6 vs. 3 Teams...................Last vs. Indiana (12-9-20)FGA .......... 12 vs. Indiana (12-9-20)FG% ......... 1.000 vs. 4 teams...................Last vs. Boston College (3-7-20)FTM .......... 6 vs. Gardner-Webb (12-21-20)FTA ........... 6 vs. Gardner-Webb (12-21-20)...................6 vs. UCF (12-19-20)...................6 vs. North Florida State (12-2-20)FT% ......... 1.000 vs. 5 Teams...................Last vs. Gardner-Webb (12-21-20)OR.............4 vs. Pitt (2-18-20)...................4 vs. Notre Dame (1-25-20)DR .............7 at Clemson (12-29-20)REBS ........9 at Clemson (12-29-20)AST ...........3 vs. Georgia Tech (12-15-20)...................3 vs. Pitt (2-18-20)BLK .......... 2 vs. Gardner-Webb (12-21-20)...................2 vs. North Florida State (12-2-20)...................2 vs. Purdue (11-30-19)STL ........... 2 vs. Tennessee (11-29-19)...................2 vs. Saint Francis (11-23-19)MIN ..........26 vs. Georgia Tech (12-15-20)underlined denotes career high established or tied dur-ing 2020-21 season
#5 Balsa Koprivica Center7-1, 240, Sophomore, Belgrade, Serbia
2020-21 Season* Scored 14 points to goa loing with 8 rebounds and 2 blocks in Florida State’s victory over Gardner-Webb* Totaled 10 points and a team-leading 8 rebounds in Florida State’s 74-61 victory over Georgia Tech in Tallahassee* Totaled 12 points and 8 rebounds in Florida State’s victory over Indiana in the ACC/Big Ten Challenge* Totaled13points,5reboundsand2blockedshotsasafirst-timestarterinFloridaState’svictoryoverNorthFlorida* A talented big man whose maturation began during his freshman season, and with hard work, will continue for the remainder of his career* With the building blocks of his Seminole career now in place, he will seize the opportunity to be one of the top players in the ACC* A member of Florida State’s ACC Championship team in 2020
2019-20 Season* Averaged4.7points(eighthontheteam),2.4rebounds(seventh)andshot.699fromthefieldin27gamesasheled the Seminoles to the 2020 ACC Championship.* Played in 27 of Florida State’s 31 games.* Career-high 15 points in Florida State’s victory over North Florida* Tiedhiscareerhighwith15pointsonaperfect6of6shootingfromthefieldinFSU’swinoverBostonCollege* Doublefiguresscoringforthefirsttimeinhiscareerwith10pointsand7reboundsinFSU’swinoverChattanooga* Totaled 11 points, 3 rebounds and 2 steals in Florida Stat’s victory over Saint Francis in Tallahassee* Doublefiguresforthethirdstraightgamewith10pointsand7reboundsinFloridaState’swinoverChicagoState* Doublefigureswith13pointsand3reboundsinFloridaState’svictoryoverNorthAlabama
On Koprivica* A consensus top-60 national recruit* A four-star recruit by Scout, Rivals, 247 Sports and ESPN* The No. 12 center and the No. 56 overall player in the 2019 recruiting class according to 247Sports* Considered to be the third best player in the talent-rich state of Florida* Has good hands, can consistently make jump shots and has strong rebounding abilities.
2020-21 Game-By-Game Statistics -- Balsa KoprivicaDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida 1-1 18 4-8 .500 0-0 .000 5-6 .833 2-3 5 3 1 1 2 1 13D9 Indiana 2-2 21 6-12 .500 0-0 .000 0-1 .000 3-5 8 5 0 1 0 0 12D12 Florida 3-3 16 3-7 .429 0-0 .000 0-1 .000 0-3 3 1 0 3 1 0 6D15 * Georgia Tech 4-4 26 4-5 .800 0-0 .000 2-4 .500 2-6 8 0 3 2 0 0 10D19 UCF 5-5 14 1-1 1.000 0-0 .000 4-6 .667 0-11 1 2 0 1 1 0 6D21 Gardner-Webb 6-6 23 4-5 .800 0-0 .000 6-6 1.000 2-6 8 2 0 0 2 0 14D29 * at Clemson 7-7 20 4-6 .667 0-0 .000 0-1 .000 2-7 9 3 0 0 1 1 8J2 * Duke J6 * at Syracuse J9 * at Pittsburgh J13 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
90-10In the last three+ seasons,
the teams that Balsa Koprivica has played on
(two at Montverde Academy and two at Flor-ida State) are a combined 90-10 for a .900 winning
percentage
-
F L O R I D A S T A T E U N I V E R S I T Y
ForwardMalik Osborne#106-9, 225, Redshirt-Junior, Matteson, Ill.
2020-21 Season* Totaled 8 points and 8 rebounds in Florida State’s victory over Gardner-Webb in Tallahassee * Totaled 5 points and 9 rebounds in Florida State’s victory over Indiana in the ACC/Big Ten Challenge* AseasonedveteranwhoseexperienceintwodifferentconferencesandasastarteronFloridaState’s2020ACC Championship team make him a most valuable leader for the Seminoles and one of the most experienced players in the ACC during the 2020-21 season.* Has played 31 games at Florida State in the ACC (2019-20) and 31 games at Rice in Conference USA (2017-18) and enters his second season at Florida State in 2020-21.
2019-20 Season* Averaged6.0points(tiedforfifthontheteam),4.9rebounds(second)and0.7blockedshots(third)inhelpinglead Florida State to the 2020 ACC Championship.* Playedinall31gamesandstarted28games(including18ofthefinal19gamesoftheseason)in2020.* Totaled 10 points, 4 rebounds and 1 steal in Florida State’s victory at No. 6 Florida in Gainesville* Totaled 10 points and 3 rebounds as a starter in Florida State’s victory over Chattanooga in Tallahassee* Florida State career-high of 14 points with 4 rebounds in Florida State’s victory over North Alabama* Totaled 14 points, 5 rebounds and 2 blocked shots in Florida State’s game at Duke in Durham* Scored 11 points to go along with 8 rebounds in Florida State’s game at Clemson
2018-19 Season * Sat out the 2018-19 season after transferring from Rice where he played as a freshman during the 2017-18 season* TraveledwiththeSeminolestoHartford,Conn.,forthefirsttworoundsofthe2019NCAATournament
2017-18 Season* Averaged9.0points(fourthontheteam),6.5rebounds(second),0.8blockedshots(first)and0.6steals(third), whileshooting.414fromthefield* Ranked third amongst his Owl teammates with 280 points* Rankedfifthontheteamwith223-pointshotsmade* Started 27 of the Owls’ 31 games
On Osborne* Graduated from Rich South High School in Illinois in 2016* Averaged 10.8 points, 7.1 rebounds and 1.6 blocked shots as a member of the varsity team as a senior* Led the Stars to an 18-8 record* Earned All-Conference First Team and All-Area Honorable Mention honors in 2017* A team leader as Rich South advanced to the second round of the state high school championship tournament* Played in 25 of the Rich South’s 26 games
Malik Osborne’s Career HighsPTS ........... 22 vs. Marshall (2-15-18)FGM ......... 7 at FIU (2-14-18)................... 7 vs. Marshall (2-15-18)FGA .......... 17 vs. Marshall (2-15-18)FG% ......... 1.000 vs. Chicago State (11-25-19)................... 1.000 vs. Western Carolina (11-15-19)3FGM ....... 3 vs. 6 teams...................Last at Clemson (2-29-20)3FGA ........ 9 vs. Marshall (2-15-18)3FG% ....... 1.000 vs. Indiana (12-9-20)................... 1.000 at Clemson (2-29-20)................... 1.000 vs. Miami (2-8-20)FTM .......... 9 vs. Charlotte (1-6-18)FTA ........... 11 vs. Charlotte (1-6-18)FT% ......... 1.000 vs. 14 Teams...................Last vs. North Florida (12-2-20)OR............. 6 vs. Gardner-Webb (12-21-20)DR ............. 10 vs. Marshall (2-15-18)REBS ........ 13 vs. Texas San Antonio (12-28-17)................... 13 vs. Marshall (2-15-18)AST ........... 4 vs. Gardner-Webb (12-21-20)BLK .......... 4 at Pitt (11-6-19)STL ........... 4 at Stephen F. Austin (12-9-17)MIN .......... 36 at Stephen F. Austin (12-9-17)underlined denotes career high established or tied during 2020-21 season
1Malik Osborne led the
Seminoles in total rebounds as a redshirt sophomore. He led the Seminoles in
offensivereboundswith59during the 2019-20 season
2020-21 Game-By-Game Statistics -- Malik OsborneDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida 1-0 17 2-4 .500 0-2 .000 2-2 1.000 3-0 3 1 0 1 0 2 6 D9 Indiana 2-0 31 1-3 .333 1-1 1.000 2-2 1.000 4-5 9 3 1 0 1 2 5D12 Florida 3-0 21 1-5 .200 0-1 .000 0-0 .000 1-1 2 4 0 1 0 1 2D15 * Georgia Tech 4-0 19 1-3 .333 0-0 .000 0-0 .000 0-1 1 3 1 1 0 0 2D19 UCF 5-0 13 0-0 .000 0-0 .000 0-0 .000 2-3 5 2 0 1 0 0 0D21 Gardner-Webb 6-0 17 3-7 .429 0-2 .000 2-3 .667 6-2 8 4 0 4 0 1 8D29 * at Clemson 7-0 25 1-5 .200 0-3 .000 0-0 .000 2-6 8 2 2 1 1 0 2J2 * Duke J6 * at Syracuse J9 * at Pittsburgh J13 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
-
F L O R I D A S T A T E U N I V E R S I T Y
2020-21 Game-By-Game Statistics -- Nathanael JackDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida 1-0 11 2-4 .500 1-3 .333 1-2 .500 0-0 0 1 1 2 0 0 6D9 Indiana DNPD12 Florida 2-0 3 1-1 1.000 1-1 1.000 0-0 .000 0-0 0 2 0 0 0 0 3D15 * Georgia Tech 3-0 5 1-2 .500 1-2 .00 0-0 .000 0-0 0 1 0 0 0 0 3D19 UCF DNPD21 Gardner-Webb 4-0 11 1-5 .200 1-5 .200 2-3 .667 1-0 1 1 0 0 0 0 5D29 * at Clemson 5-0 4 0-1 .000 0-0 .000 0-0 .000 0-0 0 1 0 0 1 0 0J2 * Duke J6 * at Syracuse J9 * at Pittsburgh J13 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9/ * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
Nathanael Jack’s Career HighsPTS ........... 14 vs. Chicago State (11-25-19)FGM ......... 4 vs. Chicago State (11-25-19)FGA .......... 8 vs. Boston College (3-7-20)FG% ......... 1.000 vs. Pitt (2-18-20)3FGM ....... 4 vs. Chicago State (11-25-19)3FGA ........ 6 vs. Boston College (3-7-20)................... 6 vs. Chicago State (11-25-19)3FG% ....... .667 vs. Chicago State (11-25-19)FTM .......... 2 vs. Gardner-Webb (12-21-20)................... 2 vs. Chicago State (11-25-19)FTA ........... 3 vs. Gardner-Webb (12-21-20)FT% ......... 1.000 vs. Chicago State (11-25-19)OR............. 1 vs. Gardner-Webb (12-21-20)................... 1 vs. Boston College (3-7-20)................... 1 vs. Chattanooga (11-20-19)DR ............. 4 vs. Chattanooga (11-20-19)REBS ........ 5 vs. Chattanooga (11-20-19)AST ........... 2 vs. Chicago State (11-25-19)................... 2 vs. Saint Francis (11-23-19)BLK .......... 1 at Clemson (12-29-20)STL ........... 1 vs. Chattanooga (11-20-19) MIN .......... 14 vs. Chicago State (11-25-19)................... 14 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2020-21 season
#11 Nathanael Jack Guard
6-5, 195, Senior, Mississauga, Ontario, Canada
2020-21 Season* Totaled 3 points in 5 minutes of playing time in Florida State’s ACC opening victory over Georgia Tech on Dec. 15* As pure a shooter as there is on the Seminoles’ roster and in the ACC who has put himself in position to earn in creasedplayingtimeinhisfinalseasonasaSeminoleduringthe2020-21season.* Earned playing time in 13 games as a junior during the 2019-20 season as he helped Florida State to a record setting record in ACC play.
2019-20 Season* Averaged3.3points(11thontheteam),0.8rebounds(12th)andmade113-pointfieldgoalsinhelpingleadFlorida State to the 2020 ACC Championship* Career-high 14 points and 2 assists in Florida State’s victory over Chicago State in Tallahassee* Totaled 6 points and 5 rebounds in 11 minutes of playing time in the Seminoles’ victory over Chattanooga * Totaled 5 points and 2 rebounds in Florida State’s victory over Pitt in Tallahassee
At Eastern Florida State College* Graduated from Eastern Florida State College in 2019 with an Associate’s Degree in General Education.* Helped lead Eastern Florida State College to the Junior College National Championship Tournament in Hutchinson, Kan., in both of his seasons.* TheTitansfinishedasthenationalrunners-upin2018andadvancedtothequarterfinalsin2019.* Led Eastern Florida to two consecutive Mid-Florida Conference Championships in both of his years at the school.
On Jack* Was born in Canada and still considers Canada to be his home.* Chose Florida State over Kansas, Oklahoma, Texas Tech Arizona State and Miami.* Major is Social Science - with a specialization of Social Entrepreneurship and Innovation.
8Nathanael Jack was one of eight Seminoles who made doublefigure3-pointshots
during Florida State’s run to the 2020 ACC
Championship. He made four in Florida State’s win
over Chicago State
-
F L O R I D A S T A T E U N I V E R S I T Y
Justin Lindner’s Career HighsPTS ........... 4 vs. Chicago State (11-25-19)FGM .........1 vs. 5 teams...................Last vs. Gardner-Webb (12-21-20)FGA .......... 1 vs. 6 Teams...................Last vs. Gardner-Webb (12-21-20)FG% .........3FGM ....... 1 vs. Clemson (12-8-19)3FGA ........ 1 vs. Clemson (12-8-19)3FG% .......FTM .......... 2 vs. Chicago State (11-25-19)...................2 at Georgia Tech (2-16-19)FTA ........... 2 vs. Chicago State (11-25-19)...................2 at Georgia Tech (2-16-19)...................2 vs. Wake Forest (2-13-19)FT% ......... 1.000 vs. Chicago State (11-25-19) ................... 1.000 at Georgia Tech (2-16-19)OR.............1 vs. Louisville (2-24-20)...................1 vs. Wake Forest (2-13-19)DR .............2 vs. Chicago State (11-25-19)REBS ........2 vs. Chicago State (11-25-19)AST ...........2 vs. Miami (2-8-20)...................2 vs. Chattanooga (11-20-19)...................2 vs. Southern Miss (12-21-17)STL ........... 1 at Georgia Tech (2-16-19)MIN ..........5 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2020-21 season
#12 Justin Lindner Guard
2020-21 Game-By-Game Statistics -- Justin LindnerDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida DNPD9 Indiana DNPD12 Florida DNPD15 * Georgia Tech DNPD19 UCF DNPD21 Gardner-Webb 1-0 1 1-1 1.000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 2D29 * at Clemson DNPJ2 * Duke J6 * at Syracuse J9 * at Pittsburgh J13 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
6-1, 180, Redshirt-Senior, Memphis, Tennessee
2020-21 Season* InhisfifthseasonasamemberoftheFloridaStateMen’sBasketballTeamafterjoiningtheteaminthefallof2016.* Following a redshirt season in 2016-17, he has played in 20 games including a career-high nine as a redshirt junior during the 2019-20 season.* Will play as a graduate student during the 2020-21 season after earning his bachelor’s degree in Applied Mathematics with a minor in Psychology on May 1, 2020* Began work on his master’s degree in Sport Management in the fall of 2020 with aspirations of becoming a basketball coach
2019-20 Season* Averaged 1.2 points and 0.7 rebounds in helping Florida State to the 2020 ACC Championship.* Scored his career-high of 4 points in Florida State’s victory over Chicago State in the Emerald Coast Classic* Career high of 5 minutes of playing time with 2 assists in Florida State’s victory over Chattanooga in Tallahassee* Firstcareerfieldgoalandcareer-high4pointsin4minutesofplayinFloridaState’svictoryoverChicagoState* Firstcareer3-pointfieldgoaland3pointsinFloridaState’swinoverClemsoninTallahassee* EarnedhisundergraduatedegreefromFloridaStateinMayof2020andwillreturnforhisfinalseasonofeligibility during the 2020-21 season.
2018-19 Season* Averaged 0.3 points, 0.7 rebounds and 0.7 assists as he played in a career-high seven games.* A member of Florida State’s 2018 NCAA Elite Eight team who is in his third season as a member of the Seminole men’s basketball team.
2017-18 Season* Averaged0.0pointsand0.2reboundsasheplayedinfivegamesinhissecondseasonasaSeminole* Averaged 4.0 points and 1.0 rebound in Florida State’s two-game exhibition season to begin the season* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic* Totaled 1 rebound in 2 minutes of playing time in Florida State’s victory over The Citadel on Nov. 24* Earned 1 minute of playing time in Florida State’s victory over Missouri in the NCAA Tournament
2016-17 Season* Became a member of the Seminole men’s basketball team to begin the 2016-17 season* Practiced and traveled with the team but did not play in any games
On Lindner* Graduated from Christian Brothers School in Memphis, Tenn., in 2016* A member of the varsity at Christian Brothers High School as a sophomore, junior and as a senior* Helped Christian Brothers to a 57-3 record (.950 winning percentage) and two state championship tournament appearances during his junior and senior seasons
166In the last seven years
Justin Lindner has helped his teams at Christian
Brothers High School (two yearsandFloridaState(five
years) to 166 wins -- an average of 23.7 wins per
season
-
F L O R I D A S T A T E U N I V E R S I T Y
CenterQuincy Ballard#156-11, 240, Freshman, Syracuse, N.Y.
2020-21 Season* Totaled 2 points and 1 blocked shot in his collegiate debut in Florida State’s victory over North Florida on Dec. 2* AnathleticbigmanwhofitscomfortablyintoFloridaState’smake-upasanadditionalstandoutrimprotector* Is excellent around the rim and is a superb shot-blocker.* Has a nice feel for the game while also possessing the capability of knocking down perimeter shots.
On Ballard* Graduated from the Quality Education Academy after spending his senior season and a postgraduate year at the Winston-Salem, N.C. school in 2018-19 and 2019-20.* Averaged 14.0 points, 11.0 rebounds and 6.0 blocked shots during his postgraduate season at QEA.* Led the Fighting Pharaohs to a 12-11 record during his postgraduate season of 2019-20.* Led QEA to a 15-3 record as a senior in 2018-19.
Quincy Ballard’s Career High’sPTS ........... 2 vs. UCF (12-19-20)...................2 vs. Georgia Tech (12-15-20)...................2 vs. North Florida (12-2-20) FGM ......... 1 vs. UCF (12-19-20)...................1 vs. Georgia Tech (12-15-20)...................1 vs. North Florida (12-2-20)FGA .......... 1 vs. UCF (12-19-20)...................1 vs. Georgia Tech (12-15-20)...................1 vs. North Florida (12-2-20)FG% .........3FGM .......3FGA ........3FG% .......FTM ..........FTA ........... 1 vs. UCF (12-19-20)FT% ......... OR.............1 vs. Georgia Tech (12-15-20)DR .............1 vs. North Florida (12-2-20)REBS ........1 vs. Georgia Tech (12-15-20)...................1 vs. North Florida (12-2-20)AST ...........BLK .......... 1 vs. North Florida (12-2-20)STL ...........MIN ..........7 vs. North Florida (12-2-20)underlined denotes career high established or tied during 2020-21 season
14/11Quincy Ballard averaged a double double of 14 points and 11 rebounds in his only
season at the Quality Education Academy in Winston-Salem, N.C.
2020-21 Game-By-Game Statistics -- Quincy BallardDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida 1-0 7 1-1 1.000 0-0 .000 0-0 .000 0-1 1 0 0 1 1 0 2 D9 Indiana 2-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 1 0 0 0 0 0D12 Florida 3-0 2 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0D15 * Georgia Tech 4-0 4 1-1 1.000 0-0 .000 0-0 .000 1-0 1 1 0 1 0 0 2D19 UCF 5-0 2 1-1 1.000 0-0 .000 0-1 .000 0-0 0 0 0 0 0 0 2D21 Gardner-Webb 6-0 2 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0D29 * at Clemson DNPJ2 * Duke J6 * at Syracuse J9 * at Pittsburgh J13 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
-
F L O R I D A S T A T E U N I V E R S I T Y
#20 Travis Light Guard
Travis Light’s Career HighsPTS ........... 6 vs. Miami (2-8-20)...................6 vs. Southern Miss (12-21-17)FGM ......... 2 vs. Miami (2-8-20)...................2 vs. Southern Miss (12-21-17)FGA .......... 3 vs. Southern Miss (12-21-17)FG% ......... 1.000 vs. Miami (2-8-20)3FGM ....... 2 vs. Miami (2-8-20)...................2 vs. Southern Miss (12-21-17)3FGA ........ 3 vs. Southern Miss (12-21-17)3FG% ....... 1.000 vs. Miami (2-8-20)FTM .......... 2 vs. Boston College (3-7-20)FTA ........... 2 vs. Boston College (3-7-20)FT% ......... 1.000 vs. Boston College (3-7-20)OR.............1 vs. Gardner-Webb (12-21-20)1 vs. Gardner-Webb (12-21-20)DR .............1 vs. The Citadel (11-24-17)REBS ........1 vs. Gardner-Webb (12-21-20)1 vs. Gardner-Webb (12-21-20)...................1 vs. The Citadel (11-24-17)AST ...........BLK ..........STL ...........MIN ..........4 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2020-21 season
10.4Travis Light averaged 10.4 points in his only season at IMG Academy during the
2015-16 season
6-5, 180, Redshirt-Senior, Vienna, Va.
2020-21 Season* ReturnsforhisfifthseasonasamemberoftheFloridaStateMen’sBasketballteamasagraduatestudentafterearning his bachelor’s degree in Business Management on May 1, 2020* Has begun work on his Master’s In Business Administration* Has played in 16 games in the last three seasons following a redshirt season in 2016-17 when he practiced with the team but did not play in any games.
2019-20 Season* Averaged 1.2 points and 0.0 rebounds as he played in a career-high nine games in helping Florida State to the 2020 ACC Championship* Totaled 3 points in 3 minutes of playing time in Florida State’s victory over Chattanooga* Career-hightying6pointsonacareer-high2made3-pointfieldgoalsinFloridaState’svictoryoverMiamiathome* EarnedhisundergraduatedegreefromFloridaStateinMayof2020andwillreturnforhisfinalseasonof eligibility during the 2020-21 season.
2018-19 Season* Averaged 0.0 points, 0.0 rebounds and 0.2 steals while playing a career-high six games as he helped Florida State reach the NCAA Tournament for the third time in his career.* The Seminoles advanced to the Sweet 16 of the NCAA Tournament for the third time in his career.
2017-18 Season* Averaged1.2pointsand0.2reboundsasheplayedinacareer-highfivegames* Averaged 1.5 points as he earned playing time in both of Florida State’s exhibition games in 2017-18* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic* Career-highsixpoints--thefirstpointsofhiscareer--inFloridaState’svictoryoverSouthernMiss
2016-17 Season * A redshirt season* Practiced and traveled with the team throughout the year* One of the Seminoles’ top practice players who often emulates the opponent’s best shooter in practice* Helped Florida State to a 26-9 overall record and a 12-6 record in ACC play* TheSeminoles’12-6overallrecordallowedthemtofinishinsecondplaceintheACCstandingsandtiedtheschool record for ACC wins in a single season
On Travis Light* Averaged 10.4 points, 3.6 rebounds and 2.3 assists in 18 games played at IMG Academy in 2016* Graduated from Montverde Academy in 2015* Was a member of the Eagles’ prep team coached by former North Carolina shooting guard Dante Calabria
2020-21 Game-By-Game Statistics -- Travis LightDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsD2 North Florida DNPD9 Indiana DNPD12 Florida DNPD15 * Georgia Tech DNPD19 UCF DNPD21 Gardner-Webb 1-0 1 0-1 .000 0-1 .000 0-0 .000 1-0 1 0 0 0 0 0 0 D29 * at Clemson DNPJ2 * Duke J6 * at Syracuse J9 * at Pittsburgh J13 * NC State J16 * North Carolina J18 * at Louisville J23 * Clemson J27 * Miami J30 * at Georgia Tech F2 * at Boston College F9 * at Virginia Tech F13 * Wake Forest F15 * Virginia F20 * Virginia Tech F24 * at Miami F27 * at North Carolina M3 * Boston College M6 * at Notre Dame M9-13 at ACC Tourn.
-
F L O R I D A S T A T E U N I V E R S I T Y
GuardM.J. Walker#23
M.J. Walker’s Career HighsPTS ........... 24 at Virginia Tech (1-20-18)FGM ......... 9 at Louisville (1-4-20)FGA .......... 16 vs. LSU (11-23-18)FG% ......... .800 vs. George Washington (11-14-17)3FGM ....... 6 at Miami (1-27-19)3FGA ........ 9 vs. Syracuse (2-15-20)...................9 at Miami (1-18-20)...................9 vs. LSU (11-23-18)...................9 vs. Southern Miss (12-21-17)3FG% ....... .857 at Miami (1-27-19)FTM .......... 12 vs. Florida (12-12-20)FTA ........... 12 vs. Florida (12-12-20)FT% ......... 1.000 vs. 28 Teams...................Last at Clemson (12-29-20)OR.............3 vs. Canisius (11-19-18)DR .............6 at Virginia Tech (1-20-18)REBS ........6 vs. Murray State (3-23-19)...................6 at Virginia Tech (1-20-18)AST ...........5 at Miami (1-27-19)...................5 vs. Duke (1-12-19)STL ........... 3 vs. Florida (12-12-20)...................3 vs. LSU (11-23-18)...................3 vs. Michigan (3-24-18)BLK .......... 2 at Boston College (1-20-19)MIN ..........42 vs. LSU (11-23-18)underlined denotes career high established or tied during 2020-21 season
6-5, 213, Senior, Jonesboro, Ga.
2020-21 Season* Accounted for a team-high 22 points and 3 rebs in Florida State’s game against UCF on Dec. 19 in Tallahassee* Tied for team-high scoring honors with 17 points, 3 assists and 3 steals in Florida State’s victory over Florida* A team-high 19 points in Florida State’s 69-67 win over Indiana in the ACC/Big Ten Challenge* A game-high 17 points on a perfect 6 of 6 free throw shooting in Florida State’s victory over North Florida on Dec. 2* Earned All-ACC Honorable Mention Honors as a junior in 2020
2019-20 Season* Averagedacareer-high10.6points(thirdontheteam),1.7rebounds(ninth)andmade443-pointshots(tiedforfirst) in leading the Seminoles to the 2020 ACC Championship* Earned All-ACC Honorable Mention Honors as a junior* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* Totaled 23 points on 5 made 3-point shots in Florida State’s victory over on the road in the ACC at Louisville* Totaled 21 points (16 in the second half) as Florida State earned a come from behind win at Notre Dame
2018-19 Season* Averaged 7.5 points (fourth on the team), a career-high 2.2 rebounds (seventh), a career-high 1.6 assists (fourth) and a career-high 0.8 steals (second) while making a career-high 44 3-point shots (second)* Shot a career-high .759 from the free throw line and made a career-high 49 free throws* HelpedleadtheSeminolestoa29-8overallrecord,a13-3markintheACC,toafourthplacefinishintheACCstand ings, Florida State’s appearance in the ACC Tournament Championship for the third time in school history and to the Sweet 16 of the NCAA Tournament for the second consecutive season
2017-18 Season* Averaged 7.0 points (seventh) and 1.7 rebounds (ninth) while making 41 3-point shots (fourth) in 35 games* Career-high24pointson8madefieldgoalsand4made3-pointfieldgoalsinFloridaState’swinoverVirginiaTech* Totaled14pointsinhisfirstcareerstartinFloridaState’s88-75victoryoverPittinTallahasseeonFeb.18* Totaled 12 points, 3 rebounds and 2 assists in his career debut against George Washington on Nov. 14* Scored 15 points to go along with 2 assists and 1 steal in Florida State’s victory over Southern Miss on Dec. 21* Scoredateam-high22pointson5made3-pointfieldgoalsinFloridaState’svictoryoverColoradoState
On Walker* Graduated from Jonesboro High School in 2017* Named the 6A Player of the Ye