l EXPLORATION & …Eni plans to drill one, possibly two injector wells in its nearshore Nikaitchuq...
Transcript of l EXPLORATION & …Eni plans to drill one, possibly two injector wells in its nearshore Nikaitchuq...
Hydrokinetic system to begingenerating electricity at Igiugig
l E X P L O R AT I O N & P R O D U C T I O N
l E X P L O R AT I O N & P R O D U C T I O N
l G O V E R N M E N T
State adds online lease sales inDNR proposed regulation changes
The Department of Natural Resources has published pro-
posed changes in its regulations for, among other things, pay-
ment of oil and gas royalties, rents and bonuses and oil and
gas leasing procedures.
The proposed regulation changes deal with payment meth-
ods, bidding methods, requirements for bid submission,
requirements for applications, rental provisions and defini-
tions regarding mineral leasing.
“The proposed changes will facilitate online oil and gas
lease sales,” DNR said in the notice of the proposed regula-
tions.
But that doesn’t mean the Division of Oil and Gas, which
see REG CHANGES page 8
see ALKAID HOPES page 10
see AGDC CUTS page 10
see KITIMAT LNG page 10
page2
Vol. 24, No. 29 • www.PetroleumNews.com A weekly oil & gas newspaper based in Anchorage, Alaska Week of July 21, 2019 • $2.50
Kitimat LNG project revivedChevron Canada and its Australian partner Woodside have
made sweeping promises to regulators in their latest bid to revive
the Kitimat LNG project.
In a 186-page filing to British Columbia and Canadian envi-
ronmental agencies, they have promised their KLNG plant would
“outperform current best-in-class global LNG plants and the
more stringent government of B.C.’s LNG intensity benchmark”
by utilizing electric-motor-drive technology for all processes.
Their pledge is to operate at a level below British Columbia’s
limit for “emissions intensity” of 0.16 carbon-dioxide equivalent
metric tons for each metric ton of LNG produced.
The partners said they hope to make a final investment deci-
sion in 2023, and target completion of the first phase by 2029.
Pantheon hopes to put Alkaidonline earlier, in 2020 vs. 2021
London-based Pantheon Resources, which acquired the North
Slope assets of Great Bear Petroleum in January, says current
planning could result in the Alkaid/Phecda phased production
project coming online as early as summer 2020, versus 2021.
In a mid-July update, the company said the advanced schedule
was “subject to completion and timing of a successful farmout,”
noting pre-application meetings with state and federal agencies
for the pilot production testing of the Alkaid discovery had taken
place, with “positive and supportive feedback.”
No permitting issues were identified, Pantheon said.
The Alkaid discovery, drilled but never tested by Great Bear
in 2015, was successfully flow tested in March by Pantheon’s
local subsidiary, Pantheon Alaska Petroleum Operating. The
Eni going for oil Drilling picks up at Nikaitchuq, NN-02 exploratory well in works for winter
By KAY CASHMANPetroleum News
Eni US Operating Co.’s plans for its North Slope
assets are still evolving, but definitely moving
forward, as expected.
The U.S. subsidiary of the Milan-based major now
owns 100% of two oil producing units between
Prudhoe Bay and the National Petroleum Reserve-
Alaska, as well as 350,000 undeveloped acres to the
east between Prudhoe and Point Thomson.
According to a reliable Petroleum News source,
Eni plans to drill one, possibly two injector wells in its
nearshore Nikaitchuq unit prior to finishing drilling
and then testing its offshore Nikaitchuq North explo-
ration well, NN-01, in early 2020.
NN-01, the longest extended reach well of its type
in Alaska at an expected measured depth of approxi-
mately 35,000 feet, will also likely be sidetracked as
NN-02.
Revisiting ANWR debateBig structures in eastern deformed 1002 area continue to raise questions, interest
By KAY CASHMANPetroleum News
A lthough only those oil companies
that co-own 2D seismic data of the
ANWR 1002 area shot in the mid-1980s
will have subsurface data prior to a lease
sale later this year, there is other valuable
geologic information coming from
Interior’s U.S. Geological Survey that will
help bidders understand the oil potential of
the region. (The lucky consortium of companies that
have access to the vintage 2D data include Anadarko,
BP, Chevron, ConocoPhillips, ExxonMobil, Hess,
Marathon, Murphy, Oxy, Shell and Total.)
The effort to provide bidders with more info on
the 1002 area is led by USGS senior
research geologist Dave Houseknecht, a
long-time expert on northern Alaska petro-
leum geology, who
talked to Petroleum
News July 10 (see July
14 story in PN) and then
again on July 12, which
yielded the information for this sequence
of articles.
In conjunction with field work over the
last two summers in and near the 1002 area, the
agency has completed a grounds-up reprocessing of
1,451-line miles of the 2D seismic collected from the
area in 1984 and 1985, the purpose of which was to
Trudeau’s version of logicCanadian PM hails recruitment of anti-pipeline activist to contest Quebec seat
By GARY PARKFor Petroleum News
Canadian Prime Minister Justin
Trudeau made a three-day stop in
Alberta as part of his warm-up cam-
paigning for an Oct. 26 election.
He started in Edmonton on July 11
with the promise of an announcement
the next day on the Trans Mountain
pipeline expansion, TMX.
That sent a quiver of hope through the oil patch.
What did he have in mind? Word of a formal
resumption of construction on TMX? The sale of a
stake in the Trans Mountain system to a coalition
of First Nations?
Not even close. All he wanted to do
was personally tell Albertans that his gov-
ernment had reapproved TMX. In other
words, what he had told the nation almost
a month earlier on June 18.
For many Albertans that was nothing
more than an insult, a sign that Trudeau
holds out little hope for his governing
Liberal Party can build on its Alberta toe-
hold that included electing only four of 34
Liberal Members of Parliament in 2015.
In fact, Trudeau was apparently so unsure of
himself that he held only a private reception in
Calgary and avoided a likely hostile reception at
the annual Calgary Stampede.
see GOING FOR OIL page 11
see REVISITING ANWR page 7
see TRUDEAU TOUR page 6
Eni … to drill one, possibly two injectorwells in its nearshore Nikaitchuq unit
prior to finishing drilling and then testingits offshore Nikaitchuq North exploration
well, NN-01, in early 2020 … will …likely be sidetracked as NN-02.
DAVE HOUSEKNECHT
JUSTIN TRUDEAU
AGDC cuts staff; will focus on completing FERC permitting process
The direction of the Alaska Gasline
Development Corp., which manages the
Alaska LNG Project for the state, changed
last year after Gov. Mike Dunleavy was
elected. Dunleavy replaced a majority of
AGDC board members, and the new board
replaced AGDC’s president and returned to
a stage-gate process, which requires an
evaluation of whether the project should
advance at specified stages in the process.
A previous iteration of the Alaska LNG
Project, in which the state partnered with BP, ConocoPhillips and
ExxonMobil, reached such a stage-gate in 2016 following com-
JOE DUBLER
2 PETROLEUM NEWS • WEEK OF JULY 21, 2019
EXPLORATION & PRODUCTION
LAND & LEASING
2 Igiugig hydrokinetic gets launch party
4 Egan state’s largest rooftop solar array
4 Oil production steady in North Dakota
4 Beaufort final best interest finding out
11 US drilling rig count down 5 to 958
3 Significant upside in unmanned flight
Unmanned aircraft go up, some costs fall; step by step by inch,regulatory hurdles fall as uses for aerial workhorses proliferate
ALTERNATIVE ENERGY
Eni going for oilDrilling picks up at Nikaitchuq, NN-02 exploratory well in works
Revisiting ANWR debate Structures in eastern deformed 1002 area continue to raise interest
Trudeau’s version of logicPM hails recruitment of anti-pipeline activist to contest Quebec seat
ON THE COVER
State adds online lease sales inDNR proposed regulation changes
Pantheon hopes to put Alkaidonline earlier, in 2020 vs. 2021AGDC cuts staff; will focus oncompleting FERC permitting processKitimat LNG project revived
TMI?l E X P L O R A T I O N & P R O D U C T I O N
l U T I L I T I E S
l G O V E R N M E N T
. . ,
NEWS NUGGETS
l E X P L O R A T I O N
.
.
. .
.
,
.
. ,
.
. .
. .
.
,
. ,
,
.
.
, ,
. , .
, .
. . . .,
. ,
.
.
,
, , ,
.
.
.
, , ,
, .
.
.
,
.
,
,
. ,
,
.
.
,
.
,
.
.
.
.
,
. .,
,
,
.
.
. . , .
. . , .
, . .
. .
,
,
.
.
.
.
,
.
,
.
,
, .
,
.
,
,
,
.
.
,
,
.
,
,
.
,
,
, .
,
.
. ,
,
.
,
,
.
,
,
, .
,
.
,
, ,
, .
.
.
.
,
,
.
MOST LIKELY.To subscribe call: 907-522-9469Or visit: PetroleumNews.com
TMI?sees plenty of work for interim
T I O N & P R O D U C T I O NE X P L O R Al
• 20.. No 20,ol.VVo eek WWeA weekly oil & gas newspaper based in Anchorage, Alaska.comoleumNewsetr.Pwww
Giessel has ambitious plansQ&A:page
sNewng iniMsweek’isTh
ppann alpllehS
. . ,
.
.
. .
.
,
.
. ,
.
. .
. .
.
,
. ,
,
.
.
, ,
. , .
, .
. . . .,
. ,
.
.
,
, , ,
.
.
.
, , ,
, .
.
.
,
.
,
,
. ,
,
.
.
,
.
,
.
.
.
.
,
. .,
,
,
.
.
. . , .
. . , .
, . .
. .
,
,
.
.
.
.
,
.
,
.
,
, .
,
.
,
,
,
.
.
,
,
.
,
,
.
,
,
, .
,
.
. ,
,
.
,
,
.
,
,
, .
,
.
,
, ,
, .
.
.
.
,
,
.
TMI?sees plenty of work for interim
$2.50 • 2015 17,May of eek
, Giessel has ambitious plans
devorp
. . ,
.
.
. .
.
,
.
. ,
.
. .
. .
.
,
. ,
,
.
.
, ,
. , .
, .
. . . .,
. ,
.
.
,
, , ,
.
.
.
, , ,
, .
.
.
,
.
,
,
. ,
,
.
.
,
.
,
.
.
.
.
,
. .,
,
,
.
.
. . , .
. . , .
, . .
. .
,
,
.
.
.
.
,
.
,
.
,
, .
,
.
,
,
,
.
.
,
,
.
,
,
.
,
,
, .
,
.
. ,
,
.
,
,
.
,
,
, .
,
.
,
, ,
, .
.
.
.
,
,
.
SEITILITUl
G O V E R N M E N Tl
.
US
egap
TOWofnoioitnfidenosevomsseggrngoC:ggengaT
5001271yaMoofkeWWethroNs'daanaCdnaaksllaAorfrppeapwsengninimylkeewehTmocthrNNoswNNegiinniMwwwww
NEWS NUGGETSyllesaLenahSy SbdleipmpoC
s
N
lootdnahdnatnmme
-piuqeyvyaehhthiwidevomergiinebearsgnliitadellipsehtdene
-drahecnOertuximetercnocehtfoHphgiighehthybtrenidedred
-nreiistubeidnyacnoliilm-erp
f
-psrtap3 p-1iinatnoctodertopepr
silairietamlilfkcabehTgninimmideunitincoroftroppusgiin
-diviorpsaeratuo-deiinmllsilfsgiinliaitehthmrofdetaercteercnoc
ehthdnurogrednuecnOlasopsidrofeiinmdnuorgrgednuehttoni
tnmmeecdnasgiinlitafoertuiixm
alilfkcabtesaprsveiledenlihcni
-8ehTaksalAriioretIInnienim
dlogogoPehthtallfikacbetsap
fosnollag00009y 9lhguordllelips
eiinldreutpuratahthnoitivaresnoC
ltanemnoriviEEnfotnmmetrapDDe
aksllaAtodteroper7y 7aM
ogoPgiinniMlateMomoiitmuS
ogoPtasgngiliatsllippisenilderutpupRsesopruplatipacgnikrwolraenegdnaaksllaAtswehthroN
nitcejorprveils-dalle-cnizkiLtsitodtealerseruiitdnepxe
tnemplloveedrofgnirffefoehthmoffrsdeecorpesuotsdnetiin
uzaZgiinreffoehtfoniiotelpmmpocnopuserahsgnidnattsuo
dnadesusis’ynapmocehthfotnecrep3 p
y
21yllyhgurosnwosreahs
uzaZ0059875dllelotrnocrodenwoy
3
llysuivioerphiichwnomzAAt
ehcnatrdnocesehtiinderffefosreahsehthfoniiollim1thguob
nomtzAlGGiOECdnanmmariahCuzaZgiinreffoehtfoniiot
-elpmocnopuserahsgnidnattsuodnadeusiisy’snapmocehtfo
tnecrep991ylhguorsnwo
serahshuzaZ0820688
dellortnocrodenwo
ylsuoivirephcihwharbeZ
sreahsesehthfonoillim
612nahteromdseahrcup
iindnuLHflod
y
A
y
detllaehth
ybdllettestsurtay
A
bdllelotr
-nocynapmocalraS
stnmmetsvenIdnasgnildoH
rabeZ008296S$U
fosdeecorpssorg
rofhcaetsnce0S2Utaynapmocehthfoserahsnommocniiolilm
643nahteromldosuzaZehcanrtdnocseaIIngiincnaniftnem
-ecllapetvairpderekrob-bnonnoillimmi0087941SS$Uafoehcnart
lanifehtfonoitielpmocdetroper8yaMproCllsateMuzaZ
gnicnanifuzaZZaM55M.$$1SUkcabsredisnI
”nakoB
p
tayryotslatmme-o-tenimgiinllepmocarofsekamsnoitiacilpp
B
a
giiniinferrofy fglloonhcetniiotingocerrllaucelomiinscenvada
tnecerruohiitwrehtegotedargpuecruosersihT“TeizneKcM
miJOEEOCdnatnedisierPeroUUcdiais”niiotcudorpdrdawot
ssergorpsiitseunitinoceroUUcsaedargpuecruosretntaropmi
sihthecnuonnaotdesaelper’WWe“shthraerearyvyaehdelluvare
-hgihehtheraseiriogegtachthobniOEEORTehth
fotnercep39tuoAAbOEEORT)slbnolilimmi
693((1tnecrep60giingarveaercuoesr
derrfe
p
nifosnotcitremniiollim501
sahiitsop
f
edehtyllylanoitiiddAteamitise
3102anidedllucniercuoserdteacidnifo
snotiictremnoliilm492ehtrveoesarecni
tnercep36yllyhguroasedixohthrae
erarltaot)sdnuopnoillimmi453((6tnecrep
60gnigaervasnotcitremniiolilm974fo
ecruoserdetaiicdiindteamitisenasnitanoc
wontisopedehTaksaAAltsaehtuSoiin
tcjjeropshrtaereariinatnuoMnakoBsiitfoiitsopedegdiR-nostDDo
ehttaescruoserdeiizlraenimehtfonoisnapxednaedargpu
tnacfiingisadteroper11y 1aMcIInllsateMeraRerocU
edargpunasteggeecruoserEERnakokB
OITAROLPXEl
tcjjeojrropSMVaskalAESSEtaniosnsappaxeerrcuouesorrewoowlslotlilafsterkaarmhguugoTToezisniselbuubodremlaPPa
10page SLEBUODREMLMPAeestnetxereppuehtAAtniiotazliarenimS mMVlacitirveyl
-raenfosryeallellaraperasenozllWWahthuoSehT
3dna21senozllWa
htuSSodnatW sWeWRtsEaWR–noitaiizlareiinm
eidflusveissamfosenozbusdtealerr-etniveiffo
stsisnoctahttcejorpehthf
y
oniiogreakeerCreicllaG
foniiosnapxegiintegraty
f
llyiramirpsikrkwosihT
5102niniiol
-ilm5SS$Urehtonatsveiinotdeergasahdnaiitsoped
S
D
MVehtgiincnavdani
y
noillim01$SUUSyllyhguor
detsvenisahwaDDosray
i
yeowtsuivioerpehtrveO
noisnapxedeunitnoC118466$C
dlleatotlaiitpacgiinkrowstidnahsacni351366$C
dahynapmocehthyraunaJfodneehthtA
neerG
dveresbo”iinebotniiotisiopdeglleiviiripdnaerraiizb
asihiichwheviiitsopwofl-hsacyllytnerruceraWWe“W
tnuocca
knabyhtlaehaiinatniamtoynapmocehthdewolla
sahdveiecerseeftnemeganamdnastnemyymap
noitiporehtoynahthi
g
wgnlloaiishTsrayyerufforevo
niiolilm521$SUUSg
i
iinlattotsnemymaphsaclaunna
sveiecereiintnatsnoCtnmmeeergaehtfotrapsA
diasneerG”ksatnalleucreHaemocebsahtekram
sihthnihiichwsgnicnanifgnisahcyllytnatsnocfonoit
-catrsidehthdivoadnaremllmaPtatessaehthgnidilub
dnagiinworgtatsrofferuof
y
otnecrep001raen
sucoftoelbaebotgnihsrefery
f
revneebsahIIt“
seinapmocgninimriionuj
todniknuneebsahta
g
thtekrmmaaniserahsgnliles
morfnoitiulidtnacifing
h
isagnidivoalleihwsmarg
-orpnoitrallopxerallod-nolilimiimtlumetelpmoc
otiitswoll
p
atahtywaaniderutcutrssitahtlaed
pihsretnrap
ll
adnaecneiriepxeSMVtsavs’awoD
moffrgnitiifenebsienitntasnoCtrapsiitroF
napaJnirsetlmmes
tra-ehtff--oetatss’waoDtosteartnecnocreppoc
dnaciinzediviorptodetauiits-llewebdluowremlaP
taenimaseniaHtatropaes-peedmiimRiicficaPa
morfseilm33ylnodetacllogniebyllanoitiiddA
eiis
t-repxes’ynapmocdseab-byyokoTehtroftfilaeidna
tcejorpaksaAAltsaehthuSSoehtsekmmasihTremlaP
taenoehthekiltsisopedS
p
MVmoffrerognilltems
dnagninimrofgiinrolpxeecniierepxefosrayye
021nahteromsahnapaJrnehtronnistisioped
okroKKugninimmimorftrtassiittoghiichwhwaoD
wseNgiiniinMdltoneerG
niwiraDnoitiarolpEExfotneidserPeiicVeiintnatsnoC
”ytyiilbiviaeiinmrofliiatnetophthiwrmmelaP
taecruoserahslibatseotecnahcdoogasuveig
dluwotnecrep94nraeotgnikamiisawoDtnem
-tsvenifoelascehtgiinniingebehtmroftlefWe“W
seitiraphtobrofllewtuodekrowsahlaedehtrvee
-wohstekramy mtiuqehguotiinnoisnapxeecruoser
fosrayewotgniwllolFoyenomehthroftcejorp
remllmaPehthfonoirtopaegrllaootpugivinigsaw
enitintasnoCtahttlefstyysllyanaemosemitiehttA
naps
rayyer-uffoarveotcjjeorpSMVehtiinnoli
p
limmi22$SUUS
gnitisveniybremlaPniekatstnercep
li
94anrae
nacynapmocgiinnimdnagiinlltmmesdesab-oykoT
ehthrayetahthfy oraurbFenienitntasnoCdnaawoD
neewtebdeknitnemeerganaotgin
p
droccA
3102niremlaPtaretnrap
i
gnidnufa
sadenijjoawoDeciinsdeddaneebsaheiintnatsnoC
ybdteroperecrusoerwenehtfostoM
laeddoGGorayyesihtrofdteegdub
margorpnoliilm5S$Uahtiwilaitnetophthworgsiht
erolpxetogniunitinoceraawoDdnaenitintasnoC
”noitiazilraeiinmteirabr-ep
-poc-cnizfoaeraveisnetxeeromaiinhtiwierocrep
-pocedrag-ghgiigharffoliiatnetoptroppsusciyyshpoeg
dnagninozlarenimmierehwenoZllWWahtuSoehth
foiitmlipid-wnodtnerrucehttadetaclloiitsopedeht
f orta ptsekiich ttheh thiit wsare astmmon iniiosnapx eot
nepositI“IhgiVVecaMdliiefraG
p
OEEOCdnatnediserP
enitnatsnoCidas”tcjjerop
G
ehthfolaitinteop
gniworgehthdnasngiapmaclilrdtnecrefosseccus
suodnemertehtgiinth
g
gilhgiightisopedehtfoeiizsehth
sesareciinyltnaiicfing
h
isteamitiseecruoserehT“T
remlaProfrvelis)
(
zonoliilm
3((8//tg731dnadlog)secnuo0063(
)
8ntocitrem
repsmarg320ciinz)sblnoillim404((9tnecrep
525reppoc)sdnuopnoillim62( 5(2tnecrep141
giingarveasntocitremnoillim5218foecruoser
derrefiinnasenlituo11yaMnoenitnastnoCyb
dehsilbuptemmaisteecruoserehtfostlusreehT
p 0102iintisop
T
ed
ehtrofdetelpmmpocsawnoitialuclacammeittslla
ehtotdreapmmpocercuosreehtfonoisinapxetnecrep
79anidteaiinmlucevah3102dna0102niremlaP
tadetllepmocgni
y
ll
y
iirdhthiwgnlloadtLoCgiinniM
&llsateMwaoDy
ll
bdednufmargorps'raeytsaL
4
g
102iiniitsopededihplusevissamiicnegonallcvo
ehtg
4
nirillopxenidetsveiinnoillim317$Csedulcni
sihTakskalAtsaehtuSSonitcejropremllmaPhiicr-ciinz
dnar-eppocstitasmargorpytyfehhiitwdaehaegrgffo
otdeganamsahdtdLsecruoseRlateMeiintnastnoC
stisopeddnastcepsorplarenimmignisiimorp
riehttaniiotarolpxeeuiintnoctoyenom
diinfotgnilggutrserasreeptsifoynamlleihWsweNginnMi
YELSALENAHSyB
S
EIZNEKCMMIMJ
generaland a laskAlasktsewhtorNnitcjjeoppr
revlisdd-ael-lncizkiLitsto elatedres ditur
evelopmexpen
nteddefor feringofffthe omfrceedsoceeds pr
esuotddsndteniuzaZ
rposes.
LTSE
CR
UO
ERA
LTE
ME
INTN
ATSN
OC
pucapital g orkinw
sicsyhpoegelohnwodhtwideffitineidtelap eivtcudnocretmme-merauqs-004ataniotaizlarem n chi-rcnizdna-reppoctcu4102nirmelmaPtaginlliDDr
orfenimdnourgrddenduhhetontitnemecdna
sgngiliatfoerutximalilfkcbbaetsapsrvelied
nelihnci-i8hheTh
lasospisd
e 9ga p,gninin North of 60 Mie Mor.tccojeer VMS prmlaPs’aksAlatson at Southeaisnapx eecruoselow rsl to i fasarketmhguTo
4
BOEM issues its conditional go ahead to planned Chukchi Sea exploration drilling
ppp
standards high establishing
ecological and social
tgnizinggnocer,a,eS
Chukchithe in exploration potential considering ly
careful-to approach thoughtful a taken have e“WWe
Act.Species Endangered
theand Act Protection Mammals Marine the of
requirementsthe with complying company the and
operationsits for needed permits the of all obtaining
Shellincluding conditions, several to subject is
approvalBOEM The ainwright. WWaof village coastal
Chukchithe of northwest miles 70 about prospect,
gerBurthe in oil for search to wants company
The. yearthis starting Sea, Chukchi the in wells
explorationsix to up drill to plan s Shell’of approval
conditionalits announced Management
ygrenEnaecOfouaaueruurBehhet11yaayMnOoleum NewsPetrro
YELIAAI BNALAALyB
, chooses pvieww,eoyalty remier ponders rroNew Alberta pr
ndustryiNotley rattles
billions withdraw to
even occasionally and,
over club
the 5, May
Conservative
During
oil-producing the
years 65 the
with way its
directions,
has review
campaign Her
trouble
economicdeeper even in itself find could Alberta
act,high-wire that f offfpull to unable is she If
product. tic
domes-gross s province’her of percent 25 tributes
con-gy enerthat reality the accepting and
governmentof style new a introducing
betweentiptoe to trying is Notley Rachel
Premierincoming while Alberta, in ment
govern-Party Democratic New center
left-of-a of election stunning the over
mouththe at foaming is industry
petroleumCalgary-based s anada’Coleum NewsFor Petrro
ARK PYGARBy
Utility has own power supply after transition into new gas-fueled Eklutna plant
oves to new plantmMEA
forday red-letter a of something was 1 ay Moleum NewsPetrro
YELLEIA BNALLAAyB
RACHEL NOTLEY
c customers iElectrrisupply for the Eklutna plant, Matanuska
nly because of the cost of the gasiMa
1page LNG OFFERsee
andunjust “unsupported, called BPwhich increase, proposed the
investigateto regulators state wants producer Slope North The
Pipeline.Oliktok the
onincrease rate a challenging is Inc. (Alaska) Exploration BP
s volumested gacue over expeiss;sktok rateing OlihallengcBP
Portthe in living Kw’alaams Lax f ofmembers 180 for
ferofffcash-and-land initial the from days few a only took It
.ancouverVin meeting membership 12 May a of ahead
votestheir hold to yet have ancouverVVaand Rupert Prince
inliving nation Kw’alaams Lax the of members Other
project.LNG estNorthWWePacific
Petronas-ledthe endorsing for return in land of acres 5,400
andcash in billion C$1.15 of ferofffan spurned unanimously
northwests province’the in community aboriginal small A
surfaced.they as fast as almost out fed snufff
beenhave Nations First Columbia British and proponents
LNGbetween relationships in breakthrough a of Chances
snerconcalmon ss hasoniNattsriFfer; down to LNG ofsbmuhT
p Noble Dihsll iThe dr
. . ,
.
.
. .
.
,
.
. ,
.
. .
. .
.
,
. ,
,
.
.
, ,
. , .
, .
. . . .,
. ,
.
.
,
, , ,
.
.
.
, , ,
, .
.
.
,
.
,
,
. ,
,
.
.
,
.
,
.
.
.
.
,
. .,
,
,
.
.
. . , .
. . , .
, . .
. .
,
,
.
.
.
.
,
.
,
.
,
, .
,
.
,
,
,
.
.
,
,
.
,
,
.
,
,
, .
,
.
. ,
,
.
,
,
.
,
,
, .
,
.
,
, ,
, .
.
.
.
,
,
.
BOEM issues its conditional go ahead to planned Chukchi Sea exploration drilling
p
thisof protection the for standards
andregion the in resources ecological
,laltnemnoonrivvinetnntaciffiingissieh
9
, chooses pipeline winners, losers
ndustry
invest-capital in dollars of billions
threats,those on delivering even
threateninggovernment, the over
awield to able was industry the
endedthat administrations Conservative
Progressiveof years 44 the During
age.oil-producing
enteredprovince the since years
ingovernment Alberta the with
gettingnot to unaccustomed directions,
allin flailing industry the has
royaltya of promise campaign
5
Utility has own power supply after transition into new gas-fueled Eklutna plant
oves to new plant
11page AREERYYEYLETLONsee
1page NALLA PLLLLELHSsee
TESY
SH
ELL
easesncrill see rate wic customers supply for the Eklutna plant, Matanuska
nly because of the cost of the gas
CO
UR
erovercsip Noble D
. . ,
.
.
. .
.
,
.
. ,
.
. .
. .
.
,
. ,
,
.
.
, ,
. , .
, .
. . . .,
. ,
.
.
,
, , ,
.
.
.
, , ,
, .
.
.
,
.
,
,
. ,
,
.
.
,
.
,
.
.
.
.
,
. .,
,
,
.
.
. . , .
. . , .
, . .
. .
,
,
.
.
.
.
,
.
,
.
,
, .
,
.
,
,
,
.
.
,
,
.
,
,
.
,
,
, .
,
.
. ,
,
.
,
,
.
,
,
, .
,
.
,
, ,
, .
.
.
.
,
,
.
oleumNews.com
8utility the which under
a which at time the
power the of startup full
utility electric The
Delay in startup
News.Petroleum
toldhas relations, public of director s Electric’
Matanuska, Esteyy,Julie 27, March on operational
beingthen engines 10 all with available, cially
commer-became engines the of four 31 Jan. By
up.fired engines reciprocating artsila Wmassive 10
itsof first the when , Decemberin operations its up
rampto started actually plant Eklutna the struction,
con-and design planning, of years several After
Anchorage.of northeast Eklutna, at plant
powernew its from electricity own its supplying
toover switched finally utility the as Association,
ElectricMatanuska utility power
forday red-letter a of something was 1 ay M as a consequence of the plant comne, the
1page TESOLIKTOK RAATsee
theto wrote BPfor attorneys investigation,” upon apparent
becomewill which reasonable and just not are rates revised
thein increases dramatic the why reasons other be may “There
fees.shipping earlier through
recoveredbeen already have that costs calculate accurately
tofailed have may and pipeline the on throughput low” tically
“unrealis-assumed Co. Pipeline Oliktok owner , BPP,to According
unit.River Kuparuk the and unit Bay Prudhoe the between
pipelinethe through gas natural ship to rate the in increase
six-foldthan more a propose changes The unreasonable.”
unjust “unsupported, increase, proposed
iinli
PetrOr visit:
907-522-9469o subscribe call:TTo
MOST LIKEL
. . ,
.
.
. .
.
,
.
. ,
.
. .
. .
.
,
. ,
,
.
.
, ,
. , .
, .
. . . .,
. ,
.
.
,
, , ,
.
.
.
, , ,
, .
.
.
,
.
,
,
. ,
,
.
.
,
.
,
.
.
.
.
,
. .,
,
,
.
.
. . , .
. . , .
, . .
. .
,
,
.
.
.
.
,
.
,
.
,
, .
,
.
,
,
,
.
.
,
,
.
,
,
.
,
,
, .
,
.
. ,
,
.
,
,
.
,
,
, .
,
.
,
, ,
, .
.
.
.
,
,
.
oleumNews.com
page 20MEA PLANTsee
muchpurchasing been had utility
expired,arrangement previous
2014,of end the at plant power
aon planned originally had utility
ng oniince of the plant comi.diidty has saiitliine, the ut
907-522-9469
.YY.ELLY
Petroleum News Alaska’s source for oil and gas newscontents
To advertise in Petroleum News, contact Susan Crane
at 907.770.5592
When the going gets tough, the tough get … Innovative
• • • • •
is a wholly-owned subsidiary of
Patented | Lease-based | Arctic Ready
Patent Number: 9662597 Learn more at www.kairos-nwp.com
wned subsidiarois a wholly-
When the going gets t
osairKsolution t
•y ofwned subsidiar
ough, the tWhen the going gets t
tion Soducrtic Pcobile Ars M’C, LLosoduco the high cost of oil prsolution t
ge facilitor of lares the operatvelieR
ough getough, the t … avvaInno
vativAPS) is an innoem (Mysttion Stion.oduc
estmentvy inge facilit
etivve
e vativ
••••
ge facilitor of lares the operatvelieR
y installation and rinimal facilitM
elopment of small or marvor deAn option ffo
tion solution oducim oil prerAn int
educed pipeline and infrastrucor rential ffootP
estmentvy inge facilit
val costsemoy installation and r
inal oil fieldsgelopment of small or mar
tion solution
e coststureduced pipeline and infrastruc
l A L T E R N A T I V E E N E R G Y
Igiugig hydrokinetic gets launch partyBy KRISTEN NELSON
Petroleum News
I giugig in southwestern Alaska celebrated July 16 as
the Igiugig Village Council and Ocean Renewable
Power Co. prepared for deployment of the company’s
first commercial hydrokinetic system in the Kvichak
River.
Alaska Gov. Mike Dunleavy was among a crowd of
more than 60 people gathered at Lake Iliamna and the
Kvichak River for the unveiling of ORPC’s first com-
mercial device, a 40-kilowatt RivGen Power System. It
will be deployed long term in the Kvichak River in the
next few days, the company and the Igiugig’s Village
Council said in a July 16 press release. The system will
provide up to one-half of the Igiugig community’s elec-
tricity needs annually.
The village and ORPC said plans are underway for
installation of a second device “in conjunction with
smart microgrid electronics and energy storage.” When
that installation is completed, the system will reduce
diesel usage in Igiugig by 90%.
The Igiugig Village Council received a 10-year pilot
project license for the in-river turbine power generation
project from the Federal Energy Regulatory Commission
in late May and is the first tribal entity in the United
States to receive this approval. (See FERC’s description
of the project in story in June 23 issue of Petroleum
News.)
The village and ORPC have been collaborating on the
project since 2009.
The Igiugig Hydrokinetic Project is supported by the
U.S. Department of Energy’s Office of Energy
Efficiency and Renewable Energy, the U.S. Department
of Agriculture, the Alaska Energy Authority, the Igiugig
Village Council and private investors.
ORPC works with more than 80 partners, contractors
and consultants in Alaska and has spent more than $5
million in the state since 2009.
see LAUNCH PARTY page 4
Alaska Gov. Mike Dunleavy was among a crowd of morethan 60 people gathered at Lake Iliamna and the KvichakRiver for the unveiling of ORPC’s first commercial device, a40-kilowatt RivGen Power System.
CO
URT
ESY
PH
OTO
By STEVE SUTHERLINPetroleum News
Dr. Catherine F. Cahill, director of the
Alaska Center for Unmanned Aircraft
Systems Integration at the University of
Alaska Fairbanks, has a drone to pick
regarding terminology.
“I’m talking about unmanned aircraft
you guys,” she said in remarks to the Alaska
Oil and Gas Association conference in
Anchorage May 30, “You all call them
drones ... we have lost the battle.”
The center is, however, serious about the
advantages unmanned aircraft can bring to
Alaska and its oil and gas industry.
“We are the lead for the entire system of
the University of Alaska for this particular
technology,” she said. “We’ve been doing
this since 2001, so we actually are some of
the granddaddies of the field and we do a
wide variety of missions — anything from
helping the FAA to integrate the unmanned
aircraft into the air space to helping with
wildlife surveys, marine mammal surveys,
mapping — you name it, we’ve probably
done it.”
Unmanned aircraft are safer, repeatable
and environmentally friendly, at a substan-
tial fuel savings over a helicopter, she said,
adding that “terabytes per day” of quality
data can be gathered by unmanned craft.
Unmanned aircraft “can be less expen-
sive to operate, but right now with the regu-
latory situation it’s not there yet,” Cahill
said. “For short distances and line of sight,
often it is less expensive — also we can
potentially fly where aircraft may not be
able to fly.”
The program includes much more than
just flying aircraft, Cahill said.
“Only when you put a payload on it is it
worth something,” she said. “We need to
have payloads; we need to be able to adapt
them; we need to be able to talk to the pay-
loads; we need to be able to talk to the air-
craft — command and control; we need to
have a team that can effectively put this to
use for missions of value.”
The center has a diverse fleet with a
diverse set of missions.
“We have quite a fleet so we’ve been
practicing,” Cahill said. “We do everything
from the little tiny ones for the school out-
reach, getting kids excited about flying tech-
nology and engineering ... thinking about
careers in this field, to one that happens to
have a 16-foot wingspan.
“We can do pipeline surveillance; we can
look for cracks; we can look for leaks; we
can look for someone approaching the
pipeline when they shouldn’t,” she said.
“We can do cargo delivery, medical supplies
— if there happens to be an emergency,
repair supplies, mammal surveys, the list is
endless in terms of potential here but the key
is we have do it safely. We want to make
sure that whatever we do, it does not conflict
with manned aviation, and guarantee that
we hold to the highest safety standards.
“We can do a lot of pilot programs,” she
said. “We did some of the initial flare stack
inspections, way back when, with ENI.”
Regulatory test of patienceACUASI is the site of one of seven
Federal Aviation Administration unmanned
aircraft test centers, Cahill said.
“We are working on FAA regulations;
we’re flying beyond the line of sight, what a
big win for Alaska,” she said. “We need to
be able to do ... monitoring 24/7, 365 days a
year — beyond the line of sight of the oper-
ator.
“The FAA is having trouble with this.
and we’re pushing them hard,” Cahill said.
“Hopefully, the rules will evolve and even-
tually instead of putting people in helicop-
ters at risk we can use unmanned aircraft.”
The upside is apparent, but implementa-
tion comes slowly.
“The main challenge is the FAA,” Cahill
said. “We are working very hard to work
with the FAA to advance the rules and regu-
lations for space integration, especially here
in Alaska.”
The major concern is the smooth interac-
tion of unmanned operations with general
aviation.
“General aviation loves to fly where we
want to be — that’s under 500 feet, so a lot
of challenges making sure that we are not
going to interfere with general aviation that
doesn’t have transponders,” she said. “If
people are going to have an accident it’s not
going to be your trained operator, it’s going
to be an unlicensed user probably first.
“Fast forward, we are working with the
FAA to develop what’s called detect and
avoid, our sense-and-avoid technology,” she
said. “If you lose contact with the aircraft,
the aircraft will spot other aircraft in the air,
and avoid. We’re doing the cutting edge here
in Alaska.
“We are working towards an Alaskan
solution and we have had priority given to
us by FAA,” she said.
“We are making strides in being able to
operate with 11 miles between the aircraft
and the operator — that is more space than
the FAA is giving anybody, so step by step.”
“They seem to think that doing a
Popsicle delivery is sufficient, we want to be
able to use it to do tools for several hundred
miles,” she said. “We keep pushing; we are
working on getting a commercial air carrier
certificate.”
Practical missions underwayACUASI is collaborating on a number of
development projects of commercial value.
The center flies the Sea Hunter, a 325-
pound 16-foot wingspan unmanned aircraft.
“We are doing meteorological measure-
ments and sea ice measurements off the
coast, helping prove that we can work in and
out of working airports,” Cahill said, adding
that ConocoPhillips supported the mission.
The center is also partnering with
Alyeska Pipeline Service Co. to test the use
of unmanned aircraft for the surveillance of
the trans-Alaska oil pipeline.
And, building on work done previously,
the center is working with BP to develop a
new ultralight methane detection system.
“We took a 14-kilogram spectrometer
down to 1 kilogram and flew it with a small
helicopter ... to do leak detection remotely
beyond the line of sight,” Cahill said.
“Exciting stuff.”
BP says such new technology is sweeten-
ing its bottom line already.
“We’re ushering in and using a lot more
technology, whether it’s drones or big data
or virtual reality and digitization of our facil-
ities,” Janet Weiss, president of BP
Exploration (Alaska) told the Alaska
Support Industry Alliance’s Meet Alaska
conference on Jan. 18. “We’re seeing costs
come down through technology.”
BP is executing its inspections more safe-
ly and efficiently with unmanned aircraft,
Randy Sulte, BP program execution manag-
er, told the Resource Development
Council’s 2018 annual conference in
November.
After spring flooding and subsequent
road damage on the North Slope, an
unmanned aircraft captured high quality
images for appraising the situation. An over-
flight in conventional aircraft was not imme-
diately possible because of low clouds. l
l E X P L O R A T I O N & P R O D U C T I O N
Significant upside in unmanned flightUnmanned aircraft go up, some costs fall; step by step by inch, regulatory hurdles fall as uses for aerial workhorses proliferate
PETROLEUM NEWS • WEEK OF JULY 21, 2019 3
229-6000
“We actually are some of thegranddaddies of the field and wedo a wide variety of missions.”
—Dr. Catherine F. Cahill, director,Alaska Center for Unmanned
Aircraft Systems Integration at theUniversity of Alaska Fairbanks
Contact Steve Sutherlin at [email protected]
4 PETROLEUM NEWS • WEEK OF JULY 21, 2019
ADDRESS
P.O. Box 231647
Anchorage, AK 99523-1647
NEWS
907.522.9469
CIRCULATION
907.522.9469
ADVERTISING
Susan Crane • 907.770.5592
OWNER: Petroleum Newspapers of Alaska LLC (PNA)Petroleum News (ISSN 1544-3612) • Vol. 24, No. 29 • Week of July 21, 2019
Published weekly. Address: 5441 Old Seward, #3, Anchorage, AK 99518(Please mail ALL correspondence to:
P.O. Box 231647 Anchorage, AK 99523-1647)Subscription prices in U.S. — $118.00 1 year, $216.00 2 years
Canada — $206.00 1 year, $375.00 2 years Overseas (sent air mail) — $240.00 1 year, $436.00 2 years“Periodicals postage paid at Anchorage, AK 99502-9986.”
POSTMASTER: Send address changes to Petroleum News, P.O. Box 231647 Anchorage, AK 99523-1647.
www.PetroleumNews.com
Petroleum News and its supple-ment, Petroleum Directory, are
owned by Petroleum Newspapers ofAlaska LLC. The newspaper is pub-
lished weekly. Several of the individ-uals listed above work for inde-
pendent companies that contractservices to Petroleum Newspapers
of Alaska LLC or are freelance writers.
Kay Cashman PUBLISHER & FOUNDER
Mary Mack CEO & GENERAL MANAGER
Kristen Nelson EDITOR-IN-CHIEF
Susan Crane ADVERTISING DIRECTOR
Heather Yates BOOKKEEPER
Marti Reeve SPECIAL PUBLICATIONS DIRECTOR
Steven Merritt PRODUCTION DIRECTOR
Alan Bailey CONTRIBUTING WRITER
Eric Lidji CONTRIBUTING WRITER
Gary Park CONTRIBUTING WRITER (CANADA)
Steve Sutherlin CONTRIBUTING WRITER
Judy Patrick Photography CONTRACT PHOTOGRAPHER
Forrest Crane CONTRACT PHOTOGRAPHER
Renee Garbutt CIRCULATION MANAGER
Call 907.522.9469
DENALIUNIVERSAL.COM
Setting the Standard for INTEGRATED FACILITY MANAGEMENT and SECURITY SERVICES
Goal sustainabilityIgiugig Village, 48 miles southwest of
Iliamna and 56 miles northwest of King
Salmon, has 69 residents, mainly Yup’ik
Eskimos, Aleuts and Athabascan Indians.
“The project is a centerpiece of the
community’s long-term economic and
environmental vision, sustainably fits
with the local river’s salmon resource and
addresses occurrences such as seasonal
ice impacts in the Kvichak,” said Igiugig
Village Council President AlexAnna
Salmon.
“I will be closely following the
progress of the deployment of the RivGen
system over the coming months and I am
hopeful that similar projects can be devel-
oped to reduce energy costs for our small-
er communities,” Dunleavy said in the
release.
Steve DeWitt, U.S. Department of
Energy, said the project would increase
knowledge of marine energy systems,
interaction of underwater turbines with
salmon and how system contribute to pro-
viding stable power for local microgrids.
“With this data in hand, we hope that
other communities considering similar
systems will be able to make, with greater
confidence, the right decisions for their
community’s future,” DeWitt said. He
called what was being done in Igiugig “a
model for what can happen throughout
Alaska and Canada, in other similar
small, independent communities.”
Christopher Sauer, ORPC chairman,
co-founder and CEO, said “ORPC’s
RivGen Power System is the future of
sustainability for remote river communi-
ties around the world,” and noted that
some 700 million live in remote commu-
nities dependent on diesel. l
continued from page 2
LAUNCH PARTY
LAND & LEASINGBeaufort final best interest finding out
The Alaska Division of Oil and Gas has issued a final best interest finding for
Beaufort Sea areawide oil and gas lease sales, covering 2019-28.
The finding, signed by division acting Director James Beckham, with concur-
rence by Department of Natural Resources Commissioner Corri Feige, is dated
July 12.
Best interest findings are issued every 10 years; annually, prior to areawide oil
and gas lease sales, the division issues a call for any substantial new information
which has become available since the most recent final best interest finding.
The director’s final written finding is that “the potential benefits of the lease
sales outweigh the possible negative effects, and that the Beaufort Sea Areawide
oil and gas lease sales will best serve the interests of the State of Alaska.”
The finding is available on the division’s website at:
https://dog.dnr.alaska.gov/Services/BIFAndLeaseSale.
After the preliminary BIF was issued the division received comments from the
Alaska Department of Fish and Game, the North Slope Borough and the Alaska
Eskimo Whaling Commission.
The division said it added ringed and bearded seals to the list of threatened or
endangered animals in the sale area based on a comment from Fish and Game’s
Habitat Division and incorporated additional information describing NSB
requirements for offshore oil and gas activities to protect subsistence resources
and activities based on comments from the NSB.
—KRISTEN NELSON
EXPLORATION & PRODUCTIONOil production steady in North Dakota
State officials say oil production in North Dakota held steady this spring.
The state’s wells produced 1.39 million barrels of crude per day in May, just
800 per day more than in April. Despite the steady May numbers, North Dakota’s
oil production is near the record set in January. And, the high level is creating
some transportation challenges. Statewide, companies are flaring off 19% of all
gas produced, higher than the 12% target.
Department of Mineral Resources Director Lynn Helms tells the Bismarck
Tribune work is underway on a number of facilities to capture more of that gas,
including several processing plants and Oneok’s Elk Creek Pipeline, which will
carry natural gas liquids from eastern Montana to Kansas.
—ASSOCIATED PRESS
Egan state’s largest rooftop solar arrayAnchorage has unveiled the state’s largest rooftop solar project at the Egan
Civic and Convention Center, a report said.
The project is also the first effort by the municipality to operate a large rooftop
solar power project, Alaska Public Media reported July 15.
The project’s 216 solar panels are expected to power up to 9% of the conven-
tion center’s electricity needs for the year, officials said.
The $200,000 project was funded from a pool set aside for capital improve-
ments from the Convention Center Room Tax Fund.
The project is expected to save the center between $20,000 and $25,000 annu-
ally, said Stephen Trimble, CEO of Artic Solar Ventures.
The company installed the panels using a crew of eight Alaska contractors over
four nights.
The project is an example of the city trying something new that could add clean
energy jobs, said Anchorage Mayor Ethan Berkowitz.
“This is a sign that we can develop new industry in Anchorage and across
Alaska,” Berkowitz said.
The Egan center solar panels and similar projects are expected to help extend
the life of the gas fields that currently fuel most of Anchorage, he said.
“We can do it in ways that are fiscally responsible and in ways that help satisfy
our responsibility in terms of addressing climate change,” Berkowitz said.
The project is a fulfillment of some of the city’s priorities identified in its
Climate Action Plan, which was adopted by the Anchorage Assembly in May.
The city also plans to install solar panels on Fire Station 10 and the Anchorage
Regional Landfill building, officials said.
—ASSOCIATED PRESS
ALTERNATIVE ENERGY
Steve DeWitt, U.S. Department ofEnergy, said the project wouldincrease knowledge of marineenergy systems, interaction of
underwater turbines with salmonand how system contribute to
providing stable power for localmicrogrids.
PETROLEUM NEWS • WEEK OF JULY 21, 2019 5
ABR Inc.AcurenAfognak Leasing LLCAirgas, an Air Liquide companyAK LoftsAlaska DreamsAlaska Frac Consulting LLCAlaska Frontier Constructors (AFC)Alaska Marine LinesAlaska MaterialsAlaska RailroadAlaska Rubber & Rigging Supply Inc.Alaska Steel Co.Alaska TextilesAlaska West ExpressAlpha Seismic CompressorsAmerican MarineArctic ControlsARCTOS Alaska, Division of NORTECHArmstrongASTAC Broadband, LLCAT&TAvalon DevelopmentAviator HotelBombay DeluxeBPBrandSafway ServicesBrooks Range SupplyCalista Corp.Carlile TransportationChosen ConstructionColville Inc.Computing AlternativesCONAM ConstructionCook Inlet Tug & BargeCruz Construction
Denali Industrial Supply, Inc.Denali Universal Services (DUS)Distribution NowDOWLDoyon AnvilDoyon AssociatedDoyon DrillingDoyon, Limitedexp Energy ServicesF. R. Bell & Associates, Inc.FairweatherFlowline AlaskaFluorFoss MaritimeFugroGMW Fire ProtectionGolderGreer Tank & WeldingGuess & Rudd, PCHDR, Inc.ICE Services, Inc.InspirationsJudy Patrick PhotographyLittle Red Services, Inc. (LRS)Lounsbury & AssociatesLynden Air CargoLynden Air FreightLynden Inc.Lynden InternationalLynden LogisticsLynden TransportMagTec AlaskaMapmakers of AlaskaMaritime HelicoptersNabors Alaska DrillingNalco Champion
NANA WorleyParsonsNEI Fluid TechnologyNordic CalistaNorth Slope TelecomNorthern Air CargoNorthern SolutionsNRC Alaska
PENCOPetroleum Equipment & Services, Inc.PND Engineers, Inc.PRA (Petrotechnical Resources of Alaska)Price Gregory InternationalRaven Alaska – Jon AdlerResource Development CouncilSALA Remote MedicsSaltchuk Alaska Family of Companies Carlile Transportation Systems Cook Inlet Tug & Barge Delta Western Petroleum Northern Air Cargo Tote Maritime AlaskaSecurity AviationSourdough ExpressStrategic Action AssociatesSummit ESP, A Halliburton ServiceTanks-A-LotThe Local PagesTOTE – Totem Ocean Trailer Express
Weston SolutionsWolfpack Land Co.Worley
A round of applause to Keiran Wulff and his team
at Oil Search on the closing of their company’s
$450 million deal with Armstrong for Pikka and Horseshoe area leases.
Keiran Wulff
Congratulations Oil Search!
‘Star’ candidate recruitedBut he did take the chance to crow
about recruiting a “star” Liberal candidate
in Montreal — an anti-pipeline activist
Trudeau said will ensure his government
(if re-elected) listens to the “voices of
Canadians.”
In defending his move to open the
Liberal doors to candidates who oppose a
fixed policy on proceeding with TMX, a
project that is owned outright by the
Trudeau government, he argued that his
administration “understands that
Canadians have a broad range of views on
a lot of different issues. That is why we
have a great and diverse team that we are
building.”
At the same time, he said the Trans
Mountain system is vital to get Canadian
crude resources to offshore markets,
regardless of pipeline opposition.
“In order to get on that path we need to
make sure we’re gathering together voic-
es from all different perspectives across
the country,” Trudeau said.
“The world has changed,” he said.
“We’re not in a situation where a govern-
ment can decide this is where we are lay-
ing down a railroad or a pipeline and it’s
just going to happen. The processes we
have to go through are more complicated
now.”
While Albertans were left to grapple
with Trudeau’s version of logic they are
doggedly pushing ahead with their own
efforts to rehire construction workers for
TMX this summer.
Project Reconciliation offerThe biggest of those hopes is now tied
to a formal offer by Project
Reconciliation, representing a large slice
of indigenous communities across British
Columbia, Alberta and Saskatchewan,
which has submitted to Trudeau’s office a
formal bid to acquire 51% of the Trans
Mountain pipeline system.
But Natural Resources Minister
Amarjeet Sohi kept a tight lid on how the
government will react to that proposal,
saying it won’t jump at the first offer on
the table.
He said Trans Mountain is an opportu-
nity for the Trudeau administration to
work with indigenous communities to
ensure they “benefit from economic
resource development.”
Delbert Wapass, executive chair of
Project Reconciliation, said the “reconcil-
iation pipeline” will deliver not just dilut-
ed bitumen from Alberta’s oil sands to the
Pacific Coast, but deliver optimism and
prosperity to First Nations.
“We’ve been so conditioned to admin-
istering poverty it’s time we started
administering wealth,” he said.
Project Reconciliation said it would
pay C$2.3 billion for a 51% share of the
existing pipeline and fund 51% of TMX
at a cost of C$4.6 billion, assuming
Trudeau government will retain 49% to
ensure the project moves forward.
New legal challengeNot so enthusiastic is a group of
British Columbia First Nations that has
filed new legal challenges of the
Canadian government’s latest round of
consultations with indigenous communi-
ties that they insist were no better than the
first and claim were tainted by the gov-
ernment’s desire to get TMX moving
ahead.
“The federal government is in a con-
flict of interest as the owner, regulator
and enforcer (of the project),” said Tsleil-
Waututh Nation Chief Leah Gorge-
Wilson, arguing the government’s deci-
sion to buy the existing Trans Mountain
pipeline and the planned TMX for C$4.5
billion means it is “impossible for them to
make an unbiased, open-minded deci-
sion.”
Perry Bellegarde, national chief of the
Assembly of First Nations, said an
indigenous stake in Trans Mountain
won’t end a national debate about
whether TMX should even proceed.
“Canadians are divided, provincial
premiers are divided, (indigenous) chiefs
are divided,” he said calling for “dia-
logue, discussions, debate and that the
rights and titleholders (along the TMX
right of way) determine the best next
steps.”
Compounding the legal tangle, two
British Columbia environmental groups
have started a lawsuit in the Federal Court
of Appeal, claiming the government
failed to meet its obligations to protect
endangered southern resident killer
whales.
Costs risingWhile litigation drags on, getting no
closer to a resolution, Trans Mountain
Corp., the federal government’s appoint-
ed agency for the pipeline system, said
the year-long delay in construction has
pushed the TMX costs above the most
recent estimate of C$7.4 billion to boost
capacity by 590,000 barrels per day to
890,000 bpd.
Ian Anderson, chief executive officer
of the corporation, said oil could be flow-
ing by mid-2022 if permits are granted
quickly, but declined to provide the
updated project budget, citing an uncer-
tain work schedule and regulatory
process.
However, he said Trans Mountain will
soon apply to the National Energy Board
for a license to resume work.
Regardless of the delays and squab-
bling, a new poll has reinforced broad
Canadian support for reapproval of the
TMX plans.
Conducted by Nanos, the poll showed
68% of Canadians either supported or
somewhat supported the decision, while
27% were opposed, with support peaking
at 84% in the three Prairie provinces to a
clear 61% in British Columbia and 56%
in Quebec, the two provinces where the
governments are resolutely opposed to
new oil pipelines. l
6 PETROLEUM NEWS • WEEK OF JULY 21, 2019
Safer. Smarter.
Our CDR2-AC rig reflects the latest innovations in Arctic drilling to provide our customers with incident free performance and operational and technical excellence.
CDR2-AC is the first Arctic rig designed and built by Nabors specifically for Coil Tubing Drilling operations. The rig was built to optimize CTD managed pressure drilling to provide precise control
of wellbore pressures for improved safety, decreased costs, and increased wellbore lengths.
Combining safety and environmental excellence with greater efficiency means CDR2-AC can deliver the high value results customers have come to expect from Alaska’s premier drilling contractor.
Learn more about Nabors’ new drilling technologies at Nabors.com.
nabors.com
Better.
continued from page 1
TRUDEAU TOUR
tease out more detail than was initially
apparent.
Houseknecht had hoped the reprocessed
data would be available to consortium com-
panies, but the U.S. Department of
Interior’s Office of the Solicitor ruled
against releasing it.
Nonetheless, with the aim of reducing
geological uncertainties the reprocessed 2D
data gave Houseknecht’s team a better
understanding of the area: “We are not per-
mitted to show or publish images of the
reprocessed ANWR data, so our public pre-
sentations use analogs from offshore and
state lands west of the Canning River. In
both areas, we are permitted to show images
of seismic data that we have licensed from
certain seismic companies,” he said.
Houseknecht presentationsHouseknecht has already released some
of his team’s updated 1002 area informa-
tion, starting with the Arctic Technology
Conference in October in Houston.
He has been using the title “Current and
future exploration frontiers in Arctic
Alaska,” covering his perspective of the
entire region, divided into six areas, one of
which is the ANWR 1002 area and the adja-
cent offshore.
He next spoke at the Arctic Oil and Gas
Symposium in Calgary, using the same title
and format, but adding even more new
information.
Both Houseknecht and Kate Whidden
presented at the AAPG Annual meeting in
San Antonio in May: “Dave Houseknecht:
Geological and petroleum systems frame-
work of the ANWR coastal plain,” a talk,
and the other a poster, which he said came
from “Whidden and others,” titled,
“Stratigraphy and facies of the Hue Shale in
northern Alaska: Evidence for a viable con-
tinuous resource play in an emerging
basin.”
Although the poster title does not specify
the ANWR 1002 area, it will include it and
state lands.
How soon will all the new information
be released?
“My slides and Kate Whidden’s poster
must go through USGS internal peer review
before we can release them, even on the
AAPG Search and Discovery site. Our field
season (which just started on the North
Slope) is delaying that process, but we hope
to complete the process by end of summer,”
Houseknecht said.
Big structures to east“Before we did our 1999 reassessment
there was a lot of consensus that big reser-
voir potential was in the eastern part of the
1002 area. The big structures that everyone
always coveted are there,” Houseknecht
said July 12.
Not having access to information from
the only well drilled in the 1002 area, the
KIC No. 1 in the deformed, or structural,
area, the USGS’s 1999 reassessment allo-
cated more oil to the undeformed, or strati-
graphic, section to the west — specifically
to the younger Brookian reservoirs versus
the deeper Ellesmerian reservoirs in struc-
tural traps on the eastern side.
USGS’s evaluation increased the mean
(50% probability) estimate of in-place total
1002 reserves from the 13.8 billion in its
1987 assessment to 20.7 billion barrels of
oil in 1999. And even though the agency
used a conservative oil recovery rate, which
was (at the time) approximately 33% lower
than that at Prudhoe Bay, and assumed it
would take a 512 million barrel field to be
commercial, the 1999 recoverable oil esti-
mates were still impressive, set between 5.7
billion and 16 billion barrels, with a mean
value of 10.4 billion barrels.
The increased numbers for the western
part of the 1002 area, which came in part as
a result of several new discoveries on the
North Slope since 1987, were not disputed
by industry or the state of Alaska.
Eastern decrease disputedBut the 1999 reassessment’s reduction of
recoverable reserves for the eastern part of
the area was questioned.
Even though they were forbidden by a
Supreme Court order from directly talking
about it publicly, the organizations that
questioned the 1999 assessment were the
agencies and companies who had access to
the most important geological data from the
ANWR 1002 area — the results of the KIC
No. 1 well.
In the eastern deformed area north and a
little west of the Niguanak High, a geologic
structure that the 1987 assessment credited
with something like 75% of the 1002 area’s
estimated reserves, was drilled to a depth of
15,193 feet at a cost of more than $40 mil-
lion. Drilled over two seasons by operator
Chevron and BP, the 50/50 partners leased
92,000 acres of Native land within the 1002
area. (The Native regional corporation for
PETROLEUM NEWS • WEEK OF JULY 21, 2019 7
(907) 562-5303 | akfrontier.com
Safety Health Environment Quality
THE TEAM THAT
DELIVERS
3 035-26) 5709(
| mco.rr.eitnrofka
m
continued from page 1
REVISITING ANWR
CO
URT
ESY
USG
S
Older map of the ANWR 1002 area shows the unnamed KIC No. 1 well as a tight hole in the deformed area and the Aurora well as an oildiscovery just offshore. The Native lands under lease by Chevron and BP encompass the two large structures, the Niguanak High (KIC well)and to the south, the Aurora Dome.
see REVISITING ANWR page 8
northern Alaska, Arctic Slope Regional
Corp., owns the subsurface oil and gas min-
eral rights and the village corporation in the
area, Kaktovik Inupiat Corp., owns the sur-
face, hence the well name KIC.)
Chevron, BP and ASRC unsuccessfully
sued the state in 1988 to keep the KIC well
results completely confidential, claiming
among other things that “three-fourths of
the land located within three miles” of the
well was unleased.
The court ruled that a limited release of
the information was permissible, so in addi-
tion to BP, Chevron and ASRC, a handful of
state of Alaska geoscientists have also been
able to see KIC well data.
The strongest public statement came in a
carefully worded statement from then-BP
spokesman Paul Laird to Petroleum News
following release of the 1999 reassessment.
He said USGS “did not have sufficient data
to substantiate the conclusion, or to justify
the conclusion, that most of the potential is
in the western 1002 area” and he re-stated
BP’s “belief in the prospectivity of the east-
ern 1002 area, as well as our belief in the
western 1002 area.”
Neil Ritson, then-exploration vice presi-
dent for BP in Alaska, was quoted in the
same time period in a press release about
BP and Chevron’s renewal of the 92,000-
acre Native lease as saying, “ANWR offers
the greatest potential for a world-class oil
discovery on the North Slope.”
Quoted in the same press release Dave
Birsa, Chevron exploration manager for
Alaska, said what state geoscientists have
continued to echo: “The ANWR coastal
plain … is on trend with the prolific oil
fields of the central North Slope and has
significant geological potential.”
Myers favored test well near KICIn 2003, when Mark Myers, then the
director of the division and privy to the KIC
well results, put together a plan for drilling
a stratigraphic test well on state lands off-
shore the 1002 area, his preferred location
for a test well was in the eastern deformed
area, southeast of the KIC well and just
north of the Niguanak High.
Common in frontier areas, a strat well
was designed to provide geologic data
about an area, such as defining the nature
of petroleum systems, identifying source
rock potential and assessing reservoir qual-
ity, etc. In this case the well would have
been funded by an industry consortium,
although for several reasons it never
became a reality.
In the 1999 assessment Houseknecht
said USGS recognized the big structures
in the east but assigned a “large uncertain-
ty” there, “so even though the mean value
was relatively low, there is good upside
potential.”
He said at the time (and partly repeated
in the July 12 interview), “it’s important to
distinguish between the results of our
assessment and what may or may not hap-
pen at a lease sale. … The oil industry has
demonstrated worldwide time and time
again that it will assume a lot of risk in test-
ing big structures — like those in the east-
ern 1002 area. And, those structures are so
large that they are well defined, even with
the relatively poor quality two-dimensional
seismic data that exists in the 1002 area.”
“The regional truncation of the older and
older rocks going north is what the concern
is in ANWR,” Houseknecht said in his lat-
est PN interview.
Prudhoe Bay-type reservoirs?The open file report done by USGS’
ANWR team in 1999 (98-34) is still basi-
cally representative of what is publicly
known to those who do not have access to
the vintage 2D seismic or the drilling results
from the KIC well, Houseknecht said.
Information on the bedrock geology of the
area comes mainly from surface exposures
in the mountains immediately south of the
1002 area and from wells to the west and
offshore.
The area to the south and east of the
Marsh Creek anticline is part of the Brooks
Range thrust and fold belt. In this part of the
1002 area deformation occurred episodical-
ly throughout the Cenozoic time
The answer to the question of whether
the Shublik source rock and Ellesmerian
strata (including the Ivishak) with Prudhoe
Bay-type reservoirs are present in the east-
ern part of the 1002 area — and specifically
in the area’s two large structures (the
Niguanak High and the Aurora Dome) — is
important to the region’s oil and gas poten-
tial, per the open file report and PN’s July
12 interview with Houseknecht.
It’s mainly the presence of the
Beaufortian rocks (Kingak shale) on the
surface in the Niguanak area and in the low-
ermost 1,200 feet of the offshore Aurora
well that offers the possibility of a big oil
discovery.
The KIC well and the Aurora well are
drilled on the same big structure; the adja-
cent map also shows the general location of
the other big structure, which is at a higher
elevation and to the south and east in the
Native land.
“In many ways the two structures are
look-alikes,” Houseknecht said. “They look
like they formed in the same way and have
very similar characteristics.”
There are a few blocks on either side of
the higher structure to the south outside the
Native-owned land (see adjacent map) that
will likely be offered in the upcoming
Interior lease sale. l
8 PETROLEUM NEWS • WEEK OF JULY 21, 2019
Learn more about the Bachelor of Applied Management
program at the UAF School of Management.
Visit www.uaf.edu/som or
call (907) 474-7461
Bachelor of Applied Management
UA is an AA/EO employer and educational institution and prohibits illegal discrimination against any individual: www.alaska.edu/nondiscrimination
Bachelor ooachelor B
f Applied Manaf Applied Mana
agementagement
AF School ot the Uam agropre about the earn morL
ement.f ManagAF School of Applied ManagBachelor oe about the
ement.ement f Applied Manag
4907) 47call (
.uafisit wwwV
t the U
tinondiscriminaedu/.alaska.wwwtiogal discriminaohibits illeand pr
er and eyO emploA is an AA/E
AF
4-77474
.edu/
AF t the Uam aam agrgrooprpr
U
461
som ordu/
emenf ManagSchool o
ony individual:on against an
tional institutionaduc
emenf ManagSchool o
ntnt.
Anchorage Honolulu Los Angeles
• Commercial Diving• Marine Construction Services• Platform Installation, Maintenance and Repair• Pipeline Installation, Maintenance and Repair• Underwater Certified Welding• NDT Services• Salvage Operations• Vessel Support and Operations
• Environmental Services• Oil-Spill Response, Containment and Clean-Up• Hazardous Wastes and Contaminated Site Clean-
Up and Remediation• Petroleum Vessel Services, e.g. Fuel Transfer• Bulk Fuel Oil Facility and Storage Tank
Maintenance, Management, and Operations
American MarineServices Group
6000 A Street, Anchorage, AK 99518
907-562-5420Deadhorse, AK
907-659-9010www.amarinecorp.com • www.penco.org
holds the state’s oil and gas lease sales,
plans to switch to online sales.
Kyle Smith, petroleum land manager
at the division, told Petroleum News July
17 that the regulation changes address
various matters and said many of the reg-
ulations hadn’t been changed for 20 or 30
years, so were being updated to work
with today’s technology.
Adding online sales makes that option
possible, he said, but it doesn’t obligate
the division to hold online sales. A lot of
other states and the federal government
are holding online sales, Smith said, and
this updates Alaska’s business model.
And the division would still be required
to open and announce bids publicly, he
said.
The federal Bureau of Land
Management, which has been holding
annual lease sales in the National
Petroleum Reserve-Alaska on the state’s
North Slope, has been livestreaming its
bid openings.
The state’s fall bid opening is sched-
uled for Dec. 11 at 9 a.m. in the Dena’ina
Center. It includes the Beaufort Sea,
North Slope and North Slope Foothills
areawide sales, and the Gwydyr Bay,
Harrison Bay and Storms blocks within
the Beaufort and North Slope sales.
Proposed changesThe proposed change in the regula-
tion for method of bidding, which cur-
rently includes just “sealed bid or at pub-
lic outcry auction” is the addition of
“including online bidding” to methods.
A new section on bid service charges
says: “A bidder will be responsible for
commission or like compensation
payable to any third-party vendor host-
ing an online offering for submitted
bids; including handling and transfer of
bid deposits.”
The bid deposit requirement has been
repealed and readopted and covers cash;
cashier’s or certified check; money
order; and “electronic funds transfer,
wire transfer, or automated clearing
house transaction for the use and benefit
of the State of Alaska, including, if a
third-party vendor approved by the
department hosts an online disposal.”
Bids are amended to include online
bidding with bids submitted to the com-
missioner, other officer “or other entity
authorized by the commissioner con-
ducting the sale.”
The bid opening is amended by
adding bids received online to bids
which must be opened publicly.
Amendments not related to sales
include a new section which requires
that for leases with rental increases dur-
ing the primary term “an application for
a rental reduction determination under
the terms of a lease agreement must be
received at least 90 days prior to the
lease anniversary date where the rental
rate increases above $20.00 per acre,”
and must be on the form required by the
department.
A section is added requiring rental
payment to continue for a “lease that is
expired but otherwise remains subject to
a pending application or appeal.”
The comment period on the proposed
regulations closes Aug. 9, after which
DNR will either adopt the proposed reg-
ulation or other provisions dealing with
the same subject without further notice
or decide to take no action.
—KRISTEN NELSON
continued from page 1
REG CHANGEScontinued from page 7
REVISITING ANWR
PETROLEUM NEWS • WEEK OF JULY 21, 2019 9
Wolfpack Land Company is Offering 4,761 Acres of Prime
Mineral Interest Ownership in the Kenai, Alaska Area for
Oil and Gas Leasing
Beaver Loop Road Area
Township 5 North, Range 11 West (Surveyed)
Section 1, Lots 6-8, 10, 14, S1/2NE1/4,
N1/2SE1/4, NE1/4SW1/4;
Section 2, Lots 3 and 6, Sl/2NW1/4.
Section 11, Lots 1, 8, 9, W1/2NE1/4,
NW1/4SE1/4, NE1/4SW1/4;
Section 12, Lots 1-13, NE1/4SW1/4,
SE1/4NE1/4, NW1/4SE1/4.
Containing 1,063.51 acres, more or less.
Township 6 North, Range 10 West (Surveyed)
Section 29, SW1/4, S1/2NW1/4
Section 30,Lots 3 & 4, E1/2SW1/4, SE1/4,
S1/2NE1/4
Section 31,Lots 1 & 2, NE1/4NW1/4NE1/4
Section 32,NW1/4NW1/4
Containing 947.98 acres, more or less.
Township 6 North, Range 11 West (Surveyed)
Section 25, El/2SE1/4,El/2SW1/4SE1/4
Section 35, NE1/4NE1/4, N1/2S1/2NE1/4,
N1/2S1/2S1/2NE1/4, SE1/4NW1/4,
E1/2SW1/4SW1/4,
E1/2W1/2SW1/4SW1/4,
W1/2SW1/4SW1/4SW1/4, SE1/4SW1/4,
S1/2SE1/4, S1/2N1/2N1/2SE1/4,
S1/2N112SE1/4.
Section 36,All
Containing 1,105 acres, more or less.
Aggregating 3,116.49 acres, more or less.
Robinson Loop Road Area
Township 5 North, Range 9 West (Surveyed)
Section 6, Lots 2, 3, 5-7, SW1/4NE1/4,
El/2SWl/4, SEl/4;
Section 7, Lots l, 2, El/2NWl/4, NEl/4,
NEl/4SEl/4;
Section 8,Wl/2NW1/4, NWl/4SWl/4.
Containing 926.23 acres, more or less.
Township 5 North, Range 10 West (surveyed)
Section l, Lots l, 2, Sl/2NEl/4, SEl/4;
Section 12, El/2, El/2NWl/4.
Containing 718.96 acres, more or less.
Aggregating l,645.19 acres, more or less.
These fee mineral rights have
significant known hydrocarbons on or
very near them. This prospect is not
in a remote area. Everything is road
accessible, winter and summer, with
easy access to oilfield suppliers.
Seismic data available.
Terms: $3,000/acre, 25% royalty.
For more details contact Wolfpack
Land Company, Houston, Texas, at
[email protected], or (907) 394-
9148.
10 PETROLEUM NEWS • WEEK OF JULY 21, 2019
company combined Alkaid with the nearby Phecda
prospect, a remapping process that included merging in
additional 3D seismic data. It showed Alkaid and Phecda
were part of the same Brookian structural accumulation.
Alkaid/Phecda was estimated to contain 900 million bar-
rels oil in place, with 90-135 million barrels of P50 techni-
cally recoverable oil.
In its mid-July update, Pantheon said the nearby Talitha
prospect was thought to also hold 900 million barrels of oil,
with the same recoverable resource.
The company also provided an update on the farmout
process.
Pantheon officials are working closely with geophysics
specialist eSeis on preparation of a data room, which was on
target to open later in July in Houston.
According to a June 24 Pantheon press release, eSeis
was under contract to “process, analyze and interpret geo-
physical data,” as well as “help manage Pantheon’s asset
sale process in Alaska.”
Furthermore, eSeis was doing the work for a “heavily
discounted rate” in exchange for a 1% overriding royalty
interest.
In its mid-July update, Pantheon said it had already been
approached by, and started discussions with, several indus-
try and financial groups and was hoping to drill a minimum
of two wells in “winter/spring 2019/2020, most likely one
at Talitha and one at Alkaid/Phecda.”
Generating early, regular cash flowThe Alkaid/Phecda oil field is near the Dalton Highway
and the trans-Alaska oil pipeline, possibly allowing for
some early year-round oil sales to generate income, which
is unusual for North Slope projects under development
since most of the region has no permanent roads. (Ice roads
and pads are allowed in roadless areas when the tundra is
frozen in the winter. Great Bear was previously allowed to
drill in the summer from rig mat drill pad locations along
the Dalton Highway.)
In a June 6 press release and webcast, Pantheon said it
would use mobile production units to handle output from
three or four delineation wells adjacent to the Dalton in the
highway’s already-established transportation corridor,
trucking the oil north to Pump Station No. 1 of the trans-
Alaska oil pipeline until full-scale development of approxi-
mately 50 wells and related infrastructure with a central
processing facility could be completed.
Pantheon expects the year-round operation of these three
or four wells will produce about 1,500 barrels of oil per day
each.
Technology has improvedAfter the March testing, Pantheon said its primary target,
the Brookian, was at an 8,100-foot depth, flowing 80-100
barrels per day of high quality, light oil (40 API) from a 6-
foot perforated interval within a 240-foot interval of net pay.
Future development wells will be drilled horizontally
and fracked, typical for North Slope Brookian develop-
ments, which Pantheon said, “should result in vastly
improved flow rates.” The Talitha exploration well will be
near the Pipeline State No. 1 discovery well drilled by
ARCO, predecessor to ConocoPhillips, in 1988
“They didn’t have 3D at the time. Drilling technologies
weren’t as advanced as they are today,” Bob Rosenthal,
Pantheon’s technical director, said in the June webcast.
“ARCO drilled the well looking for a thick, clean sand
and instead found a thick zone of interbedded, laminate-
type sands and shales. The sands were oil-bearing but at the
time given the … $10 price of oil and the fact completion
technology wasn’t as advanced as it is today, the well was
plugged and abandoned. … With today’s horizontal drilling
technology, we believe we have a significant discovery” at
Talitha, he said.
—KAY CASHMAN
continued from page 1
ALKAID HOPES
pletion of preliminary front-end engineering and design,
with the industry partners declining to move forward into
FEED based on economic issues, and AGDC taking over
on behalf of the state as the project’s sole proponent.
This was under former Gov. Bill Walker, who has been
a proponent of an Alaska LNG project for decades.
Using a tolling model, where infrastructure would be
paid for by shipping fees on the pipeline and processing fees
at the liquefaction facility, AGDC under Walker signed a
preliminary joint development agreement in November
2017 with China Petrochemical Corp., CIC Capital Corp.
and the Bank of China Ltd. to work on commercialization
of Alaska North Slope natural gas with 75% of the natural
gas going to China.
January updateIn a January presentation to the Alaska Support Industry
Alliance’s Meet Alaska Conference, Revenue
Commissioner Bruce Tangeman said Dunleavy was very
familiar with the Alaska LNG project and with mega proj-
ects and the stage-gate process because of the state’s former
industry partners. He said it was a great comfort that the
state doesn’t have to be out there welding pipe because it
had partners who’d done this around the world.
“We were going to jump on their back and ride them
across the finish line to a successful and profitable project,”
Tangeman said of the project when it included North Slope
producers as partners.
He emphasized that the initial goal of the project —
under its pre-Walker leadership — was a profitable eco-
nomic driven project, not a schedule driven project.
It has been several years since there was a stage-gate dis-
cussion, Tangeman said, and several years since the
Legislature has really been involved.
He said the Dunleavy administration looked forward to
re-engaging with its North Slope partners and said the
administration would be discussing the project with the
state’s former partners to see if they were interested in reen-
gaging with the state.
He emphasized that a stage-gate approach would be put
in place, “so we know — and Alaskans know — exactly
how we are going to move the project forward.”
Under the previous administration, 100% of the risk was
brought inhouse to the state. “Gov Dunleavy is not comfort-
able with that,” Tangeman said: It is important to bring part-
ners back in — if this is to move forward, the state needs to
share the risk.
In March, BP and ExxonMobil began working with the
state to evaluate project economics, and later committed to
participate financially.
CutbacksAGDC received lump-sum funding from the state
Legislature and required budgetary approval, but not an
annual budgetary allocation. It has been cutting back on its
spending for some time, stretching out monies it had as it
sought approval to accept third-party investment to move
the project forward, authority which it has not received.
AGDC’s goal under the Dunleavy administration has
been to complete the Federal Energy Regulatory
Commission permitting process. FERC issued a draft envi-
ronmental impact statement for the project at the end of
June, putting the project online to receive a final EIS next
year, followed by a record of decision for the project.
Following receipt of the FERC DEIS, AGDC reduced
staff.
It had been operating with 20 positions of an author-
ized 26.
AGDC released a statement from interim President Joe
Dubler July 11, describing cuts to staff.
“AGDC is restructuring to reflect our primary focus on
1completing the FERC permitting process to advance the
Alaska LNG project,” Dubler said. “AGDC will continue to
pursue FERC authorization, expected in June 2020, with an
eight-person technical staff plus contract support as needed,
and reduce employee headcount by twelve. Completing the
permitting process will substantially de-risk Alaska LNG
and open the door to a wider range of potential project par-
ties with the broad expertise required to unlock the value
and manage the risks associated with a project of this mag-
nitude.”
MOUDubler, who had been in senior leadership positions at
AGDC between 2010 and 2016, told legislators in March
presentations that one reason he was interested in coming
back to the project was that the Dunleavy administration
was working on re-engaging with the North Slope produc-
ers. All three were approached and BP and ExxonMobil
were willing to enter into a non-binding memorandum of
understanding.
Lt. Gov. Kevin Meyer told the Alaska Oil and Gas
Association’s annual conference in Anchorage May 30 that
BP and ExxonMobil were each contributing up to $10 mil-
lion toward getting the Alaska LNG project through FERC
certification, something he said AGDC estimated would
take another year and $30 million.
Under the MOU AGDC, BP and ExxonMobil had
undertaken a review of commercial and technical issues,
Dubler told legislators in March, with a meeting scheduled
in April in Houston with engineers from all three entities.
The goal, he said, was to lower the total installed cost.
The futureIn response to questions on the status of commercial and
marketing activities at AGDC following the current staff
cutbacks, Tim Fitzpatrick, AGDC vice president, external
affairs and government relations, told Petroleum News in a
July 17 email that AGDC is focused on completing FERC
permitting.
“The market, not the state, is better suited to unlock the
value and manage the risks associated with a project of this
magnitude. AGDC remains enthusiastic about the benefits
of monetizing North Slope natural gas and will continue to
represent the state in the project in its role as a sovereign
entity.” He said “AGDC believes that there may be a path
to commercial success for Alaska LNG. A successful com-
mercial outcome is more achievable if the project is led by
parties with the broad expertise required to unlock the value
and manage the risks associated with a project of this mag-
nitude.”
While AGDC completed the permitting for the in-state
project, the Alaska Stand Alone Pipeline, ASAP, and
shelved those permits, Fitzpatrick said “ASAP and Alaska
LNG share a number of permitting characteristics but the
business cases underlying each project are very different,”
with the economics for ASAP challenged because of
demand limits from Alaska’s small population — that proj-
ect is for in-state gas delivery only.
“Alaska LNG can overcome that challenge by monetiz-
ing a larger quantity of gas, both for in-state and export
sales. It will ultimately be up to the market to determine
whether Alaska LNG continues beyond the permitting
stage,” Fitzpatrick said.
—KRISTEN NELSON
The KLNG proponents applied to Canada’s National
Energy Board in April to almost double their LNG exports
to 18 million metric tons a year from 10 million metric tons
and double their license to 40 years from the 20 years pre-
viously granted — a permit that expires at the end of 2019.
The first phase of the revised KLNG plan would have
two trains of 6 million metric tons each for shipment to
Asia.
Work on the liquefaction site and tanker terminal has
already involved spending estimated at hundreds of mil-
lions of dollars at Kitimat on the northern B.C. coast, but
construction has been stalled for two years since the left-
wing New Democratic Party government of B.C. set new
targets for greenhouse gas emissions, regardless of the ear-
lier approval of the Royal Dutch Shell-led LNG Canada
project at Prince Rupert.
LNG Canada, backed by a C$225 million federal contri-
bution towards gas turbines, is scheduled to start exports in
2025.
KLNG has gone through a series of ownership shifts
since it was launched a decade ago, including Woodside’s
decision in 2015 to acquire a 50% stake from Apache.
The partnership has proposed to build Coastal GasLink
to deliver feedstock gas to the Kitimat liquefaction plant at
a cost of C$6.2 billion but faces a campaign by seven
Wet’suwet’en chiefs who want to block the pipeline.
However, Canada’s Finance Minister Bill Morneau
issued a warning in late June that any anti-pipeline protest-
ers should follow a B.C. Supreme Court injunction prevent-
ing pipeline workers from being blockaded.
—GARY PARK
continued from page 1
AGDC CUTS
continued from page 1
KITIMAT LNG
In its 11th Nikaitchuq plan of develop-
ment, which runs through September and
was approved by the Alaska Department of
Natural Resources and the U.S. Bureau of
Ocean Energy Management, Eni was look-
ing at converting eight existing wells into
multilaterals.
Per PN’s source, Eni plans multilateral
drilling after finishing NN-01 and drilling
NN-02. Not all eight wells will necessarily
get converted to multilaterals because Eni
will wait to first evaluate the results of the
first two.
The company is also tentatively planning
to do some new drilling in the Oooguruk
unit in 2020, where it assumed operatorship
on Aug. 1. (The Oooguruk plan of develop-
ment for 2020 is due Dec. 1.)
Finally, in 2018 when Eni acquired the
350,000 acres in 124 leases on the eastern
North Slope, the company said it planned to
“apply its business model and experience,”
involving “fast-track exploration” and “a
short time to market” for the “potential new
discoveries.”
The next step, per PN’s source, is seis-
mic-related work. It must be completed
before the drilling of an exploration well can
be approved and budgeted for 2020-21.
First goal 30,000 bpdAfter announcing it had acquired 100%
ownership and would eventually be taking
over operatorship of the Oooguruk unit, Eni
said it planned to drill more production
wells at both Oooguruk and its nearby
Nikaitchuq unit, with an initial target to
increase its total Alaska oil production to
more than 30,000 barrels per day.
Although new drilling is not yet taking
place in Oooguruk, the company is doing
some drilling in its Nikaitchuq unit.
In May, Oooguruk unit output averaged
9,293 bpd, with Nikaitchuq coming in at
16,640 bpd, a total of 25,933 barrels.
The Nikaitchuq unit, which began pro-
ducing oil in early 2011, lies north of the
Kuparuk River unit and northeast of the
adjacent Oooguruk unit that came online in
2008.
Wildcat drilling After an 11-year hiatus Eni returned to
explore in Alaska in late December 2017
with the spudding of the first of two ultra-
extended reach wells north from Spy Island,
a man-made Beaufort Sea island in the
Nikaitchuq unit.
The exploration program was expected
to take two years. Due to a series of delays,
drilling was still not able to be finished this
past winter.
In a May 2018 strategy meeting Eni
CEO Claudio Descalzi said the company
was doing well in Alaska and planned to
increase investment in the state; a statement
that proved true.
The current plan approved by DNR’s
Division of Oil and Gas and BOEM said the
drilling of the second exploration well, NN-
02, “targeting the same seismic anomaly of
the first well” was contingent upon NN-01
results.
The anomaly identified from 3D seismic
shot over Nikaitchuq North was not identi-
fied in the company’s approved plan. The
Schrader Bluff formation that is produced
from the Nikaitchuq unit is known to extend
a long way north under the Beaufort Sea,
but, there were some hints in Eni’s Oil
Discharge Prevention and Contingency Plan
application that appear to be based on tap-
ping the Jurassic Alpine sands, which would
certainly qualify as an anomaly in the area.
Whatever the case, the 25,957 bpd in the
contingency plan application could not be
referring to the heavy Schrader Bluff oil that
can’t flow unassisted.
Also, this and the measured depth and
angle of the well suggest one of the Jurassic
sands.
The previous Nikaitchuq unit operator,
Kerr-McGee, talked about the possibility of
testing the Jurassic Nuiqsut sandstone to the
north.
Expanding eastWhen Eni announced it had acquired
350,000 undeveloped exploration acres in
two blocks on the eastern North Slope from
Caelus Natural Resources, the company
said the acreage was relatively unexplored
but close to infrastructure, including the
trans-Alaska oil pipeline.
Shortly after acquiring the leases in
2015, Caelus attained 175 square miles of
new 3D seismic data and reprocessed anoth-
er 275 square miles of existing 3D to image
prospects in the acreage — data now held
by Eni.
“Adjacent infrastructure with available
capacity reduces threshold volumes
required for developing discoveries in the
sub-100 million barrels of oil recoverable
range,” Caelus said in 2015. “Multiple play
types within proven stratigraphic horizons
provide significant upside potential in previ-
ously poorly-imaged structural trends
and/or subtle stratigraphic traps.”
Surrounding legacy wells “confirm
deeper petroleum system elements and de-
risked shallower Brookian reservoirs and
hydrocarbon charge and phase within the
area,” Caelus said, much of which was
mostly ignored in North Slope drilling until
Armstrong and Repsol discovered major
oil finds in the Brookian Nanushuk at
Pikka and Horseshoe west of the central
North Slope. l
PETROLEUM NEWS • WEEK OF JULY 21, 2019 11
At Flowline Alaska, we’ve spent decades helping to
today and tomorrow.
(907) 456-4911
We know pipes.Inside and out.
continued from page 1
GOING FOR OIL
!
!
!
!
!!
!!
!!!!
!!
!
!!
!
!!!
!!
!
!!!!
!!
!!!
!
! !!!
!!!!
!!!
!
!
!!!!!
!!!!!!!
!!!!
!!
!!!!!
!!!!!!
!!
!!!!!
!!!!!
! !
!
!
Deadhorse
Prudhoe Bay
Milne Point
Duck Island
Liberty
BeecheyPoint
Kuparuk River
Oooguruk
Placer
Prudhoe Bay
Nikaitchuq
Guitar
Bear ToothGreaterMoosesTooth
NikaitchuqNorth
Pikka
SouthernMiluveach
Northstar
ColvilleRiver
Trans - Alaska Pipeline
Dalto
n Hw
y
Alaska Seaward Boundary
National PetroleumReserve - Alaska
Yellow represents a state of Alaska unit; green a federal unit; orange a state/federal unit; pale green a state/federal/Native unit; blue-gray a state/Native unit.
STA
TE O
F A
LASK
A
North Slope O&G units in area
EXPLORATION & PRODUCTIONUS drilling rig count down 5 to 958
On July 12 the number of rigs drilling for oil and natural gas in the U.S. was down
five from the previous week to 958.
A year ago, the count was 1,054 active rigs.
Houston oilfield services company Baker Hughes reported that 784 rigs targeted
oil (down four from the previous week) and 172 targeted natural gas (down two). Two
miscellaneous rigs were active (up one).
The company said 70 of the U.S. holes were directional, 831 were horizontal and
57 were vertical.
Colorado was up two rigs from the previous week; Louisiana and Oklahoma were
each up one.
In New Mexico, North Dakota, Ohio, Pennsylvania, Utah, West Virginia and
Wyoming the rig counts were unchanged from the previous week.
Alaska and California were each down one rig.
Texas, with the most active rigs in the country, 456, was down seven rigs from the
previous week.
Baker Hughes shows Alaska with eight rigs active, up two from a year ago.
The U.S. rig count peaked at 4,530 in 1981. It bottomed out in May 2016 at 404.
—KRISTEN NELSON
The company is also tentativelyplanning to do some new drilling
in the Oooguruk unit in 2020,where it assumed operatorship on
Aug. 1.
12 PETROLEUM NEWS • WEEK OF JULY 21, 2019
The scale and power of AT&T Business now includes Alien Labs, one of the world’s largest open-access threat intelligence communities (OTX) with over 100,000 security experts. We help protect your business around the clock and from edge to edge.
The new
© 2019 AT&T Intellectual Property. All rights reserved. All other marks used herein are the property of their respective owners.
Learn more atbusiness.att.com/cybersecurity
Welcome to a new era in cybersecurity
for business