Fec1 and Sigma Factor
-
Upload
sanjana-dube -
Category
Documents
-
view
26 -
download
1
description
Transcript of Fec1 and Sigma Factor
![Page 1: Fec1 and Sigma Factor](https://reader036.fdocuments.us/reader036/viewer/2022081908/553f7cba4a7959e1118b4785/html5/thumbnails/1.jpg)
Regulation of the FecI-type ECF sigma factor bytransmembrane signallingVolkmar Braun�, Susanne Mahren and Monica Ogierman
Induction of the ferric citrate transport genes of Escherichia coli
K-12 involves a signalling cascade that starts at the cell surface
and proceeds to the cytoplasm. Three specific proteins are
involved: FecA in the outer membrane, FecR in the cytoplasmic
membrane, and FecI in the cytoplasm. The binding of dinuclear
ferric citrate to FecA causes substantial structural changes in
FecA, triggering the signal cascade. The amino-proximal end of
FecA interacts with the carboxy-proximal end of FecR in the
periplasm. FecR then transmits the signal across the
cytoplasmic membrane into the cytoplasm and activates the
FecI sigma factor, which binds to the RNA polymerase core
enzyme and directs the RNA polymerase to the promoter
upstream of the fecABCDE transport genes to initiate
transcription. Transcription of the fecIR regulatory genes and the
fec transport genes is repressed by the Fur protein loaded with
Fe2þ. Therefore, transcription of the fec transport genes is
subjected to double control: cells first detect iron deficiency and
respond by synthesis of the regulatory proteins FecI and FecR,
which initiate transcription of the fec transport genes, provided
ferric citrate is available. FecI belongs to the extracytoplasmic
function sigma factors, which are widespread among bacteria.
With the recent sequencing of complete microbial genomes, it
has become apparent that the FecIRA cascade is now a
paradigm for the regulatory control of FecI family sigmas in
Gram-negative bacteria.
AddressesMikrobiologie/Membranphysiologie, Universtat Tuebingen, Auf der
Morgenstelle 28, 72076 Tuebingen, Germany�Correspondence: V Braun;
e-mail: [email protected]
Current Opinion in Microbiology 2003, 6:173–180
This review comes from a themed issue on
Cell regulation
Edited by Andree Lazdunksi and Carol Gross
1369-5274/03/$ – see front matter
� 2003 Elsevier Science Ltd. All rights reserved.
DOI 10.1016/S1369-5274(03)00022-5
AbbreviationsECF extracytoplasmic function
Fec ferric citrate
IntroductionIn 1994, Lonetto et al. [1] recognised that a group of
transcription regulatory proteins were in fact sigma (s)
factors which regulate genes that determine cell envelope
functions and for this reason were designated extracyto-
plasmic function (ECF) s factors; Fec I was among this
group. With genome sequencing has come the realisation
that not all of the ECF sigma factors regulate extracyto-
plasmic functions. Hence, Helmann has proposed renam-
ing these as the ‘group-4 sigmas’. The group-4 sigma FecI
regulates the ferric citrate (Fec) transport system of
Escherichia coli K-12 In turn, FecI is regulated by FecA
and FecR. FecA is an outer membrane protein that
receives the signal at the cell surface and transmits the
signal across the outer membrane into the periplasm. The
amino-terminal extension of FecA, which is not found in
other active outer membrane transport proteins of E. coliK-12, is essential for signalling to FecR. FecR is a
cytoplasmic membrane protein that transmits the signal
across the cytoplasmic membrane and regulates the activ-
ity of FecI. The complete signalling cascade including
the signal, the signal receptor, transfer of the signal across
the outer membrane and the cytoplasmic membrane, and
the receiver in the cytoplasm has only been fully eluci-
dated in the E. coli Fec transport gene regulation system.
The activity of outer membrane transport proteins
requires energy that is derived from the proton motive
force of the cytoplasmic membrane. The coupling device
between the outer membrane and the cytoplasmic mem-
brane consists of a protein complex composed of TonB,
ExbB and ExbD. TonB contacts the transport proteins
and converts them into active transporters. FecA requires
TonB not only for transport of ferric citrate across the
outer membrane but also for transmitting the regulatory
signal across the outer membrane, contacting TonB
through its TonB box, a heptapeptide at the carboxy-
terminal border of its amino-terminal external extension.
A BLAST search reveals that FecI, together with other sfactors, form a subgroup of ECF s factors with a score of
more than 123 (see the lower branch in Figure 1). Only sfactors of Gram-negative bacteria — Pseudomonas spe-
cies, Bordetella species and Xanthomonas campestris, all of
which are potential pathogens for humans, animals and
plants — belong to the group. The upper branch of
Figure 1 includes mainly Pseudomonas species but also
Agrobacterium tumefaciens, Bordetella bronchiseptica and
Caulobacter crescentus. ECF s factors of streptomycetes
and mycobacteria (which are not included in Figure 1 and
will not be discussed here) are also in the BLAST score
window (51–91).
In this review, we discuss signal transduction from the cell
surface to the cytoplasm which ultimately results in an
active FecI ECF that initiates transcription of the ferric
173
www.current-opinion.com Current Opinion in Microbiology 2003, 6:173–180
![Page 2: Fec1 and Sigma Factor](https://reader036.fdocuments.us/reader036/viewer/2022081908/553f7cba4a7959e1118b4785/html5/thumbnails/2.jpg)
citrate transport genes of E. coli K-12. This system has been
characterised in the most detail and exhibits properties that
will be typical for the whole class of FecI-type ECFs.
Evidence for an extracytoplasmic regulationmechanismAdding 1 mM of ferric citrate to growth medium induces
the formation of the ferric citrate transport system [2].
Both the fact that citrate accumulated intracellularly (in
an icd mutant devoid of isocitrate dehydrogenase activity)
does not induce the Fec transport system [2] and that
transport studies reveal it is iron, and not citrate, that is
transported into the cytoplasm of cells clearly show that,
for induction, ferric citrate is not taken up into the
cytoplasm but acts from outside the cell.
The FecI systemFecI regulates transcription of the fecABCDE transport
genes for ferric citrate in E. coli. The fecIR regulatory
genes are located upstream of the fecABCDE genes and
form a separate transcriptional unit (Figure 2) [2]. fecAencodes an outer-membrane transport protein and
fecBCDE an ABC transport complex of the cytoplasmic
membrane (Figure 2) [3]. Both fecIR and fecABCDE
Figure 1
PA4896P. aeruginosa
FecIE. coli
FecIX. campestris
PA2468 P. aeruginosa
PA1912 P. aeruginosa
RhuI B. avium
PupIP. putida
PA0472P. aeruginosa
FiuIP. aeruginosa
PrhIR. solanacearum
PA2050P. aeruginosa
PA2093P. aeruginosa
PfrIP. aeruginosa
PvdSP. aeruginosa
PbrAP. fluorescens
PsbS P. B10
PvdS P. fluorescens
ATU5309A. tumefaciens
PA2896P. aeruginosa PA3410
P. aeruginosa
CC2707C. crescentus
PAO149P. aeruginosa
PA1300P. aeruginosa
PA2387P. aeruginosa
ATU3692A. tumefaciens
BupIB. bronchisepticum
CC0981C. crescentus
HurI B. pertussis
PA3899P. aeruginosa
Current Opinion in Microbiology
Phylogenetic tree demonstrating the degree of sequence identities among ECF sigma factors related to the E. coli K-12 fecI gene, as revealed by
analysis with Clustal W.
174 Cell regulation
Current Opinion in Microbiology 2003, 6:173–180 www.current-opinion.com
![Page 3: Fec1 and Sigma Factor](https://reader036.fdocuments.us/reader036/viewer/2022081908/553f7cba4a7959e1118b4785/html5/thumbnails/3.jpg)
Figure 2
Cytoplasmicmembrane
Fe+2ADP+PiADP+Pi
ATPATP
fecABCDEPFur PfecAfecIR
160160
C2
C1
Outermembrane
FecA unloaded FecA loaded
L8L7
TonBbox
TonBfragment
FecI
RNAPcoreenzyme
FecB
N N N
N
N
C
C
N
(Fe3+citrate)2
PFur PecI
Fur
FurFe2+FurFe2+
Fe2+
Exb
D
TonB
2
N
Exb
B
TonB
1σ2
σ3
σ4
Fec
R
C
LLLV
Fec
D
Fec
C
FecE FecE
Current Opinion in Microbiology
Model of the ferric citrate transport and regulatory systems. The large structural changes in loops 7 (L7) and 8 (L8) that occur upon binding of dinuclear
ferric citrate are shown. The movement of these loops closes off the cavity containing dinuclear ferric citrate from the external environment. The
unknown conformation of the amino-proximal region of FecA, marked N, is shown to interact with region 160 of TonB. The figure shows the crystal
structure of the TonB fragment. This is a dimer, although evidence exists to show that complete TonB forms a monomer [21]. The transmembranetopology of the energy transducing the TonB–ExbB–ExbD protein complex is shown, but the model does not reflect the unknown stoichiometry of the
complex. A 7:2:1 ratio of ExbB : ExbD : TonB has been determined in cells but not in an isolated complex [22]. Interactions between FecA and the
heptad leucine-zipper-like motif (marked LLLV) of FecR, between the amino-terminal region of FecR and region 4 of FecI [23], and between FecI and
the RNA polymerase (RNAP) core enzyme (S Mahren and V Braun, unpublished data) are shown by arrows. The FecI–RNAP (RNA polymerase)
holoenzyme binds to the promoter of fecA. The Fur protein loaded with Fe2þ (Fur Fe2þ) binds to the Fur boxes (PFur) upstream of fecI and fecA and
represses fecIR and fecABCDE transcription. The ferric citrate transport system (ABC transporter) is shown on the left-hand side of the figure.
Regulation of the FecI-type ECF sigma factor by transmembrane signalling Braun, Mahren and Ogierman 175
www.current-opinion.com Current Opinion in Microbiology 2003, 6:173–180
![Page 4: Fec1 and Sigma Factor](https://reader036.fdocuments.us/reader036/viewer/2022081908/553f7cba4a7959e1118b4785/html5/thumbnails/4.jpg)
transcription is repressed by the Fur protein loaded with
ferrous iron. Under iron-limiting growth conditions result-
ing in low intracellular iron concentrations, Fur is
unloaded and transcription of fecIR occurs. By contrast,
iron limitation is not sufficient to induce transcription of
the fecABCDE transport genes. Rather, both iron limita-
tion and the presence of ferric citrate are required for
fecABCDE transcription. FecA transports iron citrate and
interacts with FecR to allow FecI activation (see below).
High expression of fecA guarantees that a minimal level of
FecA is present in uninduced cells to respond to ferric
citrate and initiate the regulatory cascade. When an
intracellular iron surplus is reached, ferrous iron binds
to Fur, which represses transcription of the fecIR and
fecABCDE genes [2].
FecI incubated with purified RNA polymerase is suffi-
cient to bind to the fecA promoter and initiate transcrip-
tion [2]. The exclusive use of FecI in fec transport gene
regulation was shown in a study in which the seven E. colis-factors, s70, sN, sH, sF, sE, sS and purified FecI, were
incubated with the RNA polymerase core enzyme. Only
FecI RNA polymerase transcribed a DNA fragment con-
taining the fecA promoter [4].
Interaction of regulatory proteins in thesignalling cascade from cell surface tocytoplasmTranscription regulation of the fec transport genes is
accomplished by three regulatory proteins: FecA, FecR
and FecI. FecA serves two functions: induction of fectransport gene transcription, and transport of ferric citrate.
Various mutants indicate that these two functions can be
uncoupled. Binding of ferric citrate to FecA without
transport is sufficient to initiate the signalling cascade
that finally leads to transcription of the fec transport genes.
The crystal structure of the FecA protein reveals that the
ferric citrate form that binds to FecA is dinuclear ferric
citrate (Fe3þ citrate)2 [5��], thus definitely identifying the
inducing species. (Fe3þ citrate)2 binds to ten residues of
FecA, which are located in a cavity that lies well above the
outer boundary of the outer-membrane lipid bilayer.
Binding of (Fe3þ citrate)2 induces strong long-range
structural transitions in FecA. Surface loops 7 and 8 are
translated 11 A and 15 A, respectively, and cover the entry
of the surface cavity, presumably preventing the escape of
(Fe3þ citrate)2 back to the external milieu. In the FecA
region exposed to the periplasm, a short helix is unwound.
Smaller translations of 2 A and less are observed in several
other regions of FecA. The massive structural changes in
FecA presumably generate a signal that is transmitted
across the outer membrane. However, the structural
changes that occur upon binding of (Fe3þ citrate)2 to
FecA are not sufficient to initiate the transcription initi-
ating signalling cascade. Signalling is dependent on TonB
activity, as is (Fe3þ citrate)2 transport across the outer
membrane. It is assumed that additional structural
changes occur through interactions with TonB, or that
the structural changes induced by (Fe3þ citrate)2 binding
are modified by TonB.
Because the signal initiated in FecA needs to reach the
cytoplasm where transcription of the fec genes takes place,
the signal must cross the periplasmic space and the
cytoplasmic membrane. Crossing the periplasm is
achieved by interaction of the amino-terminal end of
FecA with the carboxy-terminal end of FecR; both of
which are localised in the periplasm (Figure 2) [6,7]. The
appealing concept that the amino-terminal end of FecA
interacts in the periplasm with the carboxy-proximal end
of FecR was demonstrated by a bacterial two-hybrid
system that revealed specific interaction of FecA1–79
(residues 1–79 of mature FecA) with FecR101–317 [8].
FecR contains a motif composed of repeating heptapep-
tides (residues 247–268) that are flanked by three leucine
residues and one valine residue (Figure 3). It resembles
leucine zipper motifs. The motif is highly conserved in
FecI-like ECF anti-s factors (Figure 3). Replacement of
the leucine and valine residues by proline results in
derivatives with a strongly decreased interaction with
FecA and a low fecA transcription in response to ferric
citrate (S Enz and V Braun, unpublished data). Either the
conformation of the repeat sequence and/or the leucine
residues are important for interaction with FecA.
Analogous in vivo experiments using the LexA system
demonstrate binding of FecI to FecR1–85, FecR1–58 and
FecR9–85 [8]. Residues 9–58 seem to be sufficient for the
binding of FecR to FecI. In vitro, FecR–(His)6 (six
histidine residues fused to the carboxy-terminal end of
FecR) bound to a Ni-agarose column binds FecI [8].
Signal transfer across the outer membrane by FecA,
interactions between FecA and FecR in the periplasm,
signal transfer across the cytoplasmic membrane by FecR,
and interactions between FecR and FecI in the cytoplasm
form a complete signalling cascade from the cell surface to
the cytoplasmic site of transcription initiation.
Sequence analysis and biochemical studies reveal that sfactors, including ECF s factors, are divided into struc-
turally and functionally conserved subregions (Figure 4).
A FecI deletion analysis using the LexA two-hybrid
system reveals that regions 4.1 and 4.2 of FecI interact
with FecR1–85 [9]. Additional mutagenesis and overex-
pression studies support this conclusion.
Mechanism of ferric citrate transcriptionregulationFecI recruits the RNA polymerase core enzyme and
directs it to the promoter of the fecA gene, which is the
major or only promoter of the fecABCDE transport gene
transcription. The activity of most ECF s factors seems to
be controlled by anti-s factors. In the absence of anti-s
176 Cell regulation
Current Opinion in Microbiology 2003, 6:173–180 www.current-opinion.com
![Page 5: Fec1 and Sigma Factor](https://reader036.fdocuments.us/reader036/viewer/2022081908/553f7cba4a7959e1118b4785/html5/thumbnails/5.jpg)
factors, the s factors initiate transcription without extra-
cytoplasmic signals.
There is no evidence that FecR acts as an anti-s factor. In
the absence of FecR, there is virtually no fecABCDEtranscription. By contrast, cells containing the cytoplas-
mic FecR1–85 and even fragments of FecR1–85 display a
high constitutive transcription of the fecABCDE genes.
Cells containing longer FecR derivatives — which extend
from residue 1 to 273 (out of a total of 317 residues) [2] —
that do not interact with FecA [8] also transcribe
fecABCDE constitutively, but to a lower level. Although
FecR is necessary for FecI activity, it cannot be ruled out
that FecR acts as an anti-s factor. If FecI is unstable,
spontaneously denatures, precipitates or is degraded by
proteases, binding to FecR could maintain FecI in a
stable conformation. When the signal from FecA occu-
pied by (Fe3þ citrate)2 arrives through FecR, FecR
undergoes a conformational change that may result in
the dissociation of FecI from FecR and immediate bind-
ing of FecI to the RNA polymerase core enzyme. In this
model, FecR acts as both a chaperone for FecI and as an
anti-s factor, given that FecI is kept in an active con-
formation or assumes an active conformation with FecR
but cannot exert activity while it is bound to FecR.
Transcription regulation of the Fec type inspecies other than E. coliPseudomonas putida WCS358 expresses an iron transport
system via the siderophore pseudobactin BN8, which
Figure 3
TMCytoplasmic domain Periplasmic domain
LLLVN C FecR
247 254 261 268FecR E.coli WTKDILSFSDKPLGEVIATLTRYRNGVLRCDPFecR X. campestris WERGQLIADELRLDAFVAELERYRPGLLRCDPPupR P. putida WSQGMLVAQGQPLAAFIEDLARYRRGHLACDPFiuR P. aeruginosa WAQGMLVVENARLADLVAELGRYSPALLQVDPPA0471 P. aeruginosa WAQGMLVVENARLADLVAELGRYSPALLQVDPPA1911 P. aeruginosa WTRGMLMADRMPLAEVLAELARYRRGVLRCDPPA2051 P. aeruginosa WLDGRLEVRDRPLGEVLEALRAYRRGIISVADPA3409 P. aeruginosa WRRGLLVFDEQPLGEVVARLNRYRPGHLLVAPContig312 P. fluorescens WDKGMLLASNMRLDELLGELSRYRRGVLRCHPContig259 P. fluorescens WVQGRLEVRDRPLSEVIDSLRSYRRGILHLSPFrag10708 P. putida WTEGVLSVQQMPLAEFASELGRYRPGLLRCAPFrag10749 P. putida WEHGMLLARDMRLADLLQELARYRPGVLRCHPFrag10715 P. putida WREGALRLDDRPLGELLHELRRYRPGVLRWAPFrag3802 P. syringae WTRGVLKVDDQPLSEVLQTLATYRHGLLRYDTContig812 B. pertussis WEDGLLVVHGWRLDRLAAQLARYRLGVIRVDPContig1034 B. pertussis WEDGLLVVHGWRLDRLAAQLARYRLGVIRVDPRhuR B. avium WLRGVLHVNAMPLAAFAAELGRYRRGLVRCAQ * . * .*. * *. ...
Current Opinion in Microbiology
1 84 101 246 269 317
Sequence comparison of predicted FecR-like proteins in the region LLLV through which FecR interacts with FecA (S Enz and V Braun, unpublished
data). The conserved leucine residues (L), which form the flanking residues of four heptad repeats, are shown in grey. The asterisks represent identical
amino acids in all listed proteins; full stops (.) represent identical proteins in most of the listed proteins.
Figure 4
1.2N C FecI
Binding site of FecR9-59
2.1 2.2 2.42.3 4.13.1 3.2 4.21.2
1 9 84 113 173
-10 recognition -35 recognition
Current Opinion in Microbiology
Domain structure of the FecI s factor. Fecl lacks the 1.1 region of s70 factors. The regions through which Fecl binds to the �10 and �35 promoter
regions and to FecR9–59 (residues 9–59 of FecR) are shown.
Regulation of the FecI-type ECF sigma factor by transmembrane signalling Braun, Mahren and Ogierman 177
www.current-opinion.com Current Opinion in Microbiology 2003, 6:173–180
![Page 6: Fec1 and Sigma Factor](https://reader036.fdocuments.us/reader036/viewer/2022081908/553f7cba4a7959e1118b4785/html5/thumbnails/6.jpg)
induces synthesis of the PupB outer-membrane transpor-
ter [10]. Two genes, pupI and pupR, are located upstream
of pupB (Figure 5). Transcription induction of pupB by
pseudobactin BN8 requires pupI and pupR. pupI shows
42.8% and pupR 36.6% sequence identity to fecI and fecR,
respectively. Although regulation of pupB transcription
resembles regulation of fecABCDE transcription, PupR
might function only as an anti-s factor, given that PupI in
the absence of PupR induces pupB transcription consti-
tutively. In light of the data collected with the Fec
system, one may conclude that the structural change in
PupA upon binding of pseudobactin 358 is mediated
through the amino-terminal extension of PupB to PupR,
which then dissociates from PupI, releases PupI and acts
as a pupB-specific s factor.
In Pseudomonas aeruginosa, synthesis of the siderophore
pyoverdin and transport of ferric pyoverdin is controlled
by a FecIR-like regulatory device [11]. Pyoverdin (pre-
sumably after loading with Fe3þ) functions as an inducer
of the pyoverdin synthesis and Fe3þ pyoverdin transport
genes and induces formation of exotoxin A and an extra-
cellular endoproteinase. In this system, the FecR homo-
logue fpvR and the fpvA gene (equivalent to fecA) map
close to the pyoverdin synthesis operon, whereas the fecIhomologue pvdS lies some distance away (Figure 5). PvdS
is an ECF s factor and is required for the synthesis of
pyoverdin, exotoxin A and endoproteinase. Synthesis is
high in fpvR mutants; overexpressed fpvR inhibits synth-
esis, indicating that FpvR functions as an anti-PvdS sfactor. Furthermore, FpvA is required for the induction
by pyoverdin. Analogous to FecA, FpvA contains an
amino-terminal extension; deletion of the extension
abolishes induction of pyoverdin synthesis in response
to pyoverdin in the growth medium but retains pyoverdin
transport [12]. PvdS binds to the RNA polymerase core
enzyme in a 1:1 ratio and this complex binds to a DNA
promoter fragment of the pvdA pyoverdin biosynthesis
gene [13�]. The proposed transcription model is similar to
the Fec transcription model. Fe3þ pyoverdin binds to the
FpvA outer-membrane transport protein that interacts
with FpvR. The signal is transmitted across the cytoplas-
mic membrane via the predicted FecR transmembrane
segment, and then PvdS dissociates from FpvR and
functions as an ECF s factor. A second fecI homologue,
fpvI, maps adjacent to fpvR but is transcribed in the
opposite direction. FpvI also receives a transcription
initiation signal from FpvR.
In a study demonstrating interactions of FecI and FecR in
E. coli, two pairs of FecIR homologues of P. aeruginosawere included [9]. As demonstrated by the LexA two-
hybrid system, the FecI homologue PA2468 (Figure 1)
and its truncated form PA2468110–172 dimerise with the
related FecR1–85 homologue PA24671–90 but not with the
unrelated FecR1–85 homologue PA39001–85 [9]. PA39001–85
only dimerises with the related FecI homologue PA3899
(Figure 1) and the truncated PA3899105–170. The trun-
cated FecI-like fragments cover region 4, demonstrating
their involvement in the interaction with the FecR homo-
logues of P. aeruginosa. As with fecIR, the fecIR-like
Pseudomonas genes are preceded by Fur boxes. In addi-
tion, genome analysis of P. aeruginosa reveals 14 ECF sfactors of the fecI type, which are adjacent to fecR-type
regulatory genes. Ten of these fecIR-like genes are adja-
cent to fecA-like genes that encode proteins with amino-
terminal extensions like FecA [14��].
Regulatory systems analogous to FecAIR have been
identified experimentally in Bordetella pertussis [15], Bor-detella bronchiseptica [16] and in Bordetella avium [17]
(Figure 5). They all regulate iron transport systems for
which the iron ligand responsible for induction or regula-
tion by iron has been shown. B. pertussis and B. bronch-iseptica encode the two regulatory genes hurI and hurRupstream of the heam transport gene cluster bhuRSTUV.
Synthesis of the BhuR outer-membrane transport protein
for haem is enhanced when cells are grown in a medium
supplemented with hemin [15]. In addition, synthesis of a
putative ferric siderophore outer-membrane transport
protein (BfrZ) of B. bronchiseptica is regulated by two
proteins, BupI and BupR, which are homologous to the
fecI and fecR gene products, respectively [16]. Overexpres-
sion of bupI induces bfrZ transcription and BfrZ is
observed in the outer-membrane fraction. B. avium con-
tains a haem utilisation system in which the synthesis of
the related outer-membrane transport protein BhuR is
induced by haem and requires RhuI (which is homolo-
gous to FecI). BhuR synthesis is enhanced in cells that
overexpress RhuI. Overexpression of RhuI reduces tran-
scription of a ss-dependent gene, suggesting competition
Figure 5
fpvI
fecA
bhuR
pupB
bhuR
bfrZ
prhA
fecB
bhuS
fecC
bhuT
fecD
bhuU
fecE
bhuV
fecI
hurI
rhuI
bupI
prhI
pupI
fecR
hurR
rhuR
bupR
prhR
pupR
fpvR fpvA pvdS
Current Opinion in Microbiology
Comparison of the arrangement of the fecIR and fecABCDE genes of E.
coli K-12 with similar transport and signalling systems. The arrows
indicate the transcription polarity of the genes. (See text for designation
of the genes.)
178 Cell regulation
Current Opinion in Microbiology 2003, 6:173–180 www.current-opinion.com
![Page 7: Fec1 and Sigma Factor](https://reader036.fdocuments.us/reader036/viewer/2022081908/553f7cba4a7959e1118b4785/html5/thumbnails/7.jpg)
between RhuI and ss for the RNA polymerase core
enzyme [17].
Ralstonia solanacearum elicits a hypersensitive response
on non-host plants. At the beginning of the regulatory
cascade that eventually induces the hrp hypersensitivity
genes stands a regulatory device of the Fec type
[18,19,20�]. In the R. solanacearum system, it is highly
interesting that the initial signal is generated by physical
contact between the bacteria and the plant cells, without
involvement of a diffusible substance. A signalling system
that starts at the bacterial cell surface is perfectly suited to
respond to cell–cell contact, as was previously predicted
[2]. For the expression of the prhJ regulatory gene, the
PrhA outer-membrane protein, PrhI (homologous to
FecI) and PrhR (homologous to FecR) are required. As
with the fecIR genes, the prhIR genes form a separate
regulatory unit (Figure 5) that does not require PrhA for
expression and is not autoregulated. In addition, cells
synthesising a truncated PrhR protein are fully patho-
genic on host plants and this is reminiscent of the con-
stitutive expression of the fec transport genes in cells
synthesising truncated FecR proteins.
ConclusionsSince its identification in 1994, the ECF s factor family
has rapidly grown. In the FecIR subgroup, all studied
systems except one regulate the synthesis of Fe3þ trans-
port systems. The reason might be found in the very low
Fe3þ availability, which requires intricate transport sys-
tems across the outer membrane, through the periplasm,
and across the cytoplasmic membrane. Control that starts
from the cell surface enables transcription initiation with-
out formation of the transport system in the cytoplasmic
membrane. It is economic to synthesise the iron-import
systems only when they are needed. Iron starvation alone
is not a sufficient signal for the formation of the transport
systems, since a single strain may express several iron
transport systems. For example, E. coli has up to eight
such systems, and only one system transports the source
of iron that may be available at a given time.
An additional regulatory system that confers specificity to
the available iron source limits the metabolic activity of
the cells to what is required. This is the case for the
regulation of the ferric citrate transport system. Iron
starvation induces synthesis of the regulatory proteins
FecI and FecR, of which only a few molecules are
synthesised. When ferric citrate is in the medium, synth-
esis of FecA is strongly increased from a basal level to
around 80,000 molecules per cell, making FecA one of the
most highly synthesised proteins of E. coli. The high
levels of FecA facilitate capture of the scarce (Fe3þ
citrate)2 molecules in the medium. Binding of (Fe3þ
citrate)2 to FecA at the cell surface initiates a signal that
eventually ends in the cytoplasm, where transcription of
the fec transport genes is initiated. FecR is required for
transmission of the signal through the periplasm and
across the cytoplasmic membrane to convert FecI to an
active s factor. As FecI shows virtually no activity in the
absence of FecR, FecR cannot function purely as an anti-sfactor. If FecR is an anti-s factor, which is likely in the
light of the regulation of other ECF s factors, FecR must
display an additional function — for example, to maintain
FecI in an active conformation.
The conformational change in FecR that results from the
signal received from FecA occupied with (Fe3þ citrate)2
might cause dissociation of FecI from FecR, which then
immediately binds to the RNA polymerase core enzyme
to avoid inactivation by proteolysis, denaturation or pre-
cipitation. FecR might also activate FecI by changing the
FecI conformation. There is no evidence for a chemical
modification of FecI, however. It is also difficult to
envisage that FecR catalyses chemical modification of
FecI, because the smallest fragment of FecR that acti-
vates FecI is FecR1–68 [2], which is unlikely to display
enzymatic activity. Without a signal, the cytoplasmic
fragment of FecR, which shows constitutive expression
of the fec transport genes in the absence of inducer, might
activate FecI by spontaneous dissociation from FecI or by
spontaneous induction of the active conformation in FecI.
The few studies on other ECF s factors of the FecI type
suggest a mechanism similar to the FecAIR signalling
cascade. Bacterial species living in environments of poor
and frequently changing nutrients such as soil and water
are particularly rich in ECF s factors. They are also rich in
TonB-dependent outer-membrane transport proteins that
indicate that scarce nutrients, other than iron, are taken up
by active-transport systems across the outer membrane.
These transport proteins might not only function as trans-
porters but also as signalling proteins for ECF s factors.
All the systems discussed in this review concern regula-
tion of virulence factors of pathogenic or potentially
pathogenic bacteria. Regulation of the genes that control
the hypersensitivity response in plants by R. solana-cearum, and exoproteinase and exotoxin synthesis in
P. aeruginosa, extends the signals and the functions that
are controlled by the FecIRA-type regulation beyond
regulation of iron-transport systems. Following the dis-
covery of signal generation by cell–cell contact in the
R. solanacearum–plant system, it will be of interest to see
if a similar regulatory device functions during infection of
animals or humans — for example, in the regulation of
the formation of type III and type IV secretion systems
that are induced upon contact of bacteria with eukaryotic
cells of their hosts.
AcknowledgementsThe authors’ work was supported by the Deutsche Forschungsgemeinschaft(Br 330/19-1), the Alexander von Humboldt Foundation (M Ogierman) andthe Fonds der Chemischen Industrie.
Regulation of the FecI-type ECF sigma factor by transmembrane signalling Braun, Mahren and Ogierman 179
www.current-opinion.com Current Opinion in Microbiology 2003, 6:173–180
![Page 8: Fec1 and Sigma Factor](https://reader036.fdocuments.us/reader036/viewer/2022081908/553f7cba4a7959e1118b4785/html5/thumbnails/8.jpg)
References and recommended readingPapers of particular interest, published within the annual period ofreview, have been highlighted as:
� of special interest��of outstanding interest
1. Lonetto MA, Brown KL, Rudd KE, Buttner MJ: Analysis of theStreptomyces coelicolor sigE gene reveals the existence of asubfamily of eubacterial RNA polymerase r factors involved inthe regulation of extracytoplasmic functions. Proc Natl Acad SciUSA 1994, 91:7573-7577.
2. Braun V: Surface signaling: novel transcription initiationmechanism starting from the cell surface. Arch Microbiol 1997,167:325-331.
3. Luck SN, Turner SA, Rajakumar K, Sakellaris H, Adler B: Ferricdicitrate transport system (FEC) of Shigella flexneri 2a YSH6000is encoded on a novel pathogenicity island carrying multipleantibiotic resistance genes. Infect Immun 2001, 69:6012-6021.
4. Maeda H, Jishage M, Nomura T, Fujita N, Ishihama A: Twoextracytoplasmic function sigma subunits rE and rFecI ofEscherichia coli: promoter selectivity and intracellular levels.J Bacteriol 2000, 182:1181-1184.
5.��
Ferguson AD, Chakraborty R, Smith BS, Esser L, van der Helm D,Deisenhofer J: Structural basis of gating by the outer membranetransporter FecA. Science 2002, 295:1715-1719.
This paper describes the crystal structure of FecA in the unloaded andferric-citrate-loaded conformation. It also reveals substrate gating, andforms the basis for the interpretation of the properties of FecA mutantproteins.
6. Kim I, Stiefel A, Plantor S, Angerer A, Braun V: Transcriptioninduction of the ferric citrate transport genes via the N-terminus of the FecA outer membrane protein, the Ton systemand the electrochemical potential of the cytoplasmicmembrane. Mol Microbiol 1997, 23:333-344.
7. Welz D, Braun V: Ferric citrate transport of Escherichia coli:functional regions of the FecR transmembrane regulatoryprotein. J Bacteriol 1998, 180:2387-2394.
8. Enz S, Mahren S, Stroeher UH, Braun V: Surface signaling in ferriccitrate transport gene induction: interaction of the FecA, FecRand FecI regulatory proteins. J Bacteriol 2000, 182:637-646.
9. Mahren S, Enz S, Braun V: Functional interaction of region 4 ofthe extracytoplasmic function sigma factor FecI with thecytoplasmic portion of the FecR transmembrane protein of theEscherichia coli ferric citrate transport system. J Bacteriol 2002,184:3704-3711.
10. Koster M, van Klompenburg W, Bitter W, Leong J, Weisbeek P:Role for the outer membrane ferric siderophore receptor PupBin signal transduction across the bacterial cell envelope.EMBO J 1994, 13:2805-2813.
11. Lamont IL, Beare PA, Ochsner U, Vasl AI, Vasil ML: Siderophore-mediated signaling regulates virulence factor production inPseudomonas aeruginosa. Proc Natl Acad Sci USA 2002,99:7072-7077.
12. Leoni L, Orsi N, De Lorenzo V, Visca P: Functional analysis ofPvdS, an iron starvation sigma factor of Pseudomonasaeruginosa. J Bacteriol 2000, 182:1481-1491.
13.�
Shen J, Meldrum A, Poole K: FpvA receptor involvement inpyoverdine biosynthesis in Pseudomonas aeruginosa.J Bacteriol 2002, 184:3268-3275.
This paper provides biochemical evidence that FpvA acts as a transcrip-tion regulatory protein and as an outer-membrane transporter.
14.��
Visca P, Leoni L, Wilson MJ, Lamont IL: Iron transport andregulation, cell signalling and genomics: lessons fromEscherichia coli and Pseudomonas. Mol Microbiol 2002,45:1177-1190.
This paper provides a comprehensive overview of regulatory devices ofthe FecIR type in P. aeruginosa.
15. Vanderpool CK, Armstrong SK: The Bordetella bhu locus isrequired for heme iron utilization. J Bacteriol 2001,183:4278-4287.
16. Pradel E, Locht C: Expression of the siderophore receptor genebfrZ is controlled by the extracytoplasmic-function sigmafactor BupI in Bordetella bronchiseptica. J Bacteriol 2001,183:2910-2917.
17. Kirby AE, Metzger DJ, Murphy ER, Connell TD: Heme utilization inBordetella avium is regulated by RhuI, a heme-responsiveextracytoplasmic function sigma factor. Infect Immun 2001,69:6951-6961.
18. Marenda M, Brito B, Callard D, Genin S, Barberis P, Boucher C,Ariat M: PrhA controls a novel regulatory pathway required forthe specific induction of Ralstonia solanacearum hrp genes inthe presence of plant cells. Mol Microbiol 1998, 27:437-453.
19. Aldon D, Brito B, Boucher C, Genin S: A bacterial sensor of plantcell contact controls the transcriptional induction of Ralstoniasolanacearum pathogenicity genes. EMBO J 2000,19:2304-2314.
20.�
Brito B, Aldon D, Barberis P, Boucher C, Genin S: A signal transfersystem through three compartments transduces the plant cellcontact-dependent signal controlling Ralstonia solanacearumhrp genes. Mol Plant Microbiol 2002, 15:109-119.
This paper shows that ECF sigma-factor-controlled transcription initiationoccurs at the start of a signal cascade that regulates the hypersensitivityresponse.
21. Moeck GS, Letellier L: Characterization of in vitro interactionsbetween a truncated TonB protein from Escherichia coli andthe outer membrane receptors FhuA and FepA. J Bacteriol 2001,183:2755-2764.
22. Higgs PI, Larsen RA, Postle K: Quantification of knowncomponents of the Escherichia coli TonB energy transductionsystem: TonB, ExbB, ExbD and FepA. Mol Micobiol 2002,44:271-281.
23. Stiefel A, Mahren S, Ochs M, Schindler PT, Enz S, Braun V: Controlof the ferric citrate transport system of Escherichia coli:mutations in region 2.1 of the FecI extracytoplasmic-functionsigma factor suppress mutations in the FecR transmembraneregulatory protein. J Bacteriol 2001, 183:162-170.
180 Cell regulation
Current Opinion in Microbiology 2003, 6:173–180 www.current-opinion.com