dr§ dm{f©H$ [anmoQ>©> - Cotton Corporation of India · 2019-11-26 · 6 m.h.Z. C.C.I. 49th...

^m.H$.{Z.

C.C.I.

49 dr§ dm{f©H$ [anmoQ>©> 2018-1949TH ANNUAL REPORT 2018-19

^maVr¶ H$nmg {ZJ‘ {b[‘Q>oS>(^maV gaH$ma H$m CnH«$‘, dò ‘§Ìmb¶)

THE COTTON CORPORATION OF INDIA LTD.(Govt. of India Undertaking, Ministry of Textile)

AZwH«$‘{UH$m / INDEX

{ddaU/Particulars Page No

{ZXoeH$ ‘§S>bBoard of Directors 2

d[að> à~§YZ Q>r‘Senior Management Team 4

gyMZmNotice 6

AÜ¶j H$m A{^^mfUChairman's Speech 8

{ZXoeH$ [anmoQ>©Directors' Report 16

{ZXoeH$ [anmoQ>© H$m n[a{eï> AAnnexure A to Director's Report 41

{ZXoeH$ [anmoQ>© H$m n[a{eîQAddendum to Directors’ Report 48

‘hm boIm narjH$ H$s {Q>ßnUrComments of the CAG 50

ñdV§Ì boIm narjH$m| H$s [anmoQ>©Independent Auditor's Report 51

dm{f©H$ boIoAnnual Accounts 76

~¢H$m| H$s gyMrList of Banks 223

àm°³gr ’$m°‘©Proxy Form 224

AÜ¶j Ed§ à~§Y {ZXoeH$ S>m°. nr. A{„ amZrChairman-cum-Managing Director Dr. P. Alli Rani

{ZXoeH$ ({dnUZ) lr àXrn Hw$‘ma AJ«dmbDirector (Marketing) Shri Pradeep Kumar Agarwal

{ZXoeH$, dó ‘§Ìmb¶ lr Eg. Ama. Jm¶H$dmS>Director, Ministry of Textiles Shri S. R. Gaikwad

ñdV§Ì {ZXoeH$ lr‘Vr J«og qnQ>moIndependent Director Ms. Grace Pinto

ñdV§Ì {ZXoeH$ lr‘Vr am{OH$m Q>r. H$Mo[a¶mIndependent Director Ms. Rajika T. Kacheria

{ZXoeH$ ‘§S>b({XZm§H$ 30-08-2019 H$mo)

BOARD OF DIRECTORS(As on 30-08-2019)

boIm narjH$

~doOm E§S> H$m¡bgZXr boImnmb, ZB© {X„r

Or ~r gr E E§S> Agmo{gEQ> EbEbnr gZXr boImnmb, ‘w§~B©

AuditorsBaweja & Kaul

Chartered Accountants, New Delhi

G B C A & Associates LLPChartered Accountants, Mumbai

Registered OfficeKapas Bhavan,

Plot No 3A, Sector -10, C.B.D. BelapurNavi Mumbai - 400 614

website : www.cotcorp.org.in www.ministryoftextiles.gov.in

n§OrH¥$V H$m¶m©b¶H$nmg ^dZ,

ßbm°Q> Z§. 3 E, go³Q>a - 10, gr.~r.S>r. ~obmnwa, Zdr ‘w§~B© - 400 614

do~ gmB©Q> : www.cotcorp.org.in www.ministryoftextiles.gov.in

49th AnnuAL REPORT 2018-19 ThE COTTOn CORPORATIOn OF InDIA LImITED

^m.H$.{Z.

C.C.I.

2

3

S>m°. nr. A{„ amZrAÜ¶j Ed§ à~§Y {ZXoeH$

Dr. P. Alli RaniChairman-cum-Managing Director

lr àXrn Hw$‘ma AJ«dmb {ZXoeH$ ({dnUZ)

Shri Pradeep Kumar AgarwalDirector (Marketing)

lr‘Vr J«og qnQ>moñdV§Ì {ZXoeH$

ms. Grace PintoIndependent Director

lr Eg. Ama. Jm¶H$dmS>{ZXoeH$, dó ‘§Ìmb¶

Shri S. R. GaikwadDirector, Ministry of Textiles

lr‘Vr am{OH$m Q>r. H$Mo[a¶mñdV§Ì {ZXoeH$

ms. Rajika T. KacheriaIndependent Director

49dt dm{f©H$ [anmoQ>© 2018-19^maVr¶ H$nmg {ZJ‘ {b{‘Q>oS>

^m.H$.{Z.

C.C.I.

3

‘w»¶ gVH©$Vm A{YH$marChief Vigilance Officer

‘w»` ‘hm à~§YH$Chief General Manager

‘w»` ‘hm à~§YH$ ({dÎm/dm{UÁ`)/H§$nZr g{Md Chief General Manager (Fin./Comm.)/Company Secretary

‘w»` ‘hm à~§YH$ ({dnUZ)Chief General Manager (Marketing)

‘w»` ‘hm à~§YH$ (‘mg§{d/{dÎm)Chief General Manager (HRD/Fin.)

lr ho‘ÝV Hw$‘ma Shri Hemant Kumar

lr ‘ZmoO ~OmOShri Manoj Bajaj

lr b{bV Hw$‘ma JwámShri Lalit Kumar Gupta

lr Eg. Ho$. nm{UJ«mhrShri S. K. Panigrahi

lr amOoÝÐ Hw$‘ma JwámShri Rajendra. Kumar Gupta

(1) lr Eg. Ho$. Xmg Shri S. K. Das (5) lr g§O` Hw$‘ma Shri Sanjay Kumar

(2) lr AVwb H$mbm Shri A tul Kala

(6) lr àm§Ob nr. Omoer Shri Pranjal P. Joshi

(3) lr E. Ho$. lrdmñVd Shri A. K. Srivastava

7) lr AO` Hw$‘ma Shri Ajay Kumar

(4) lr {demb Ho$ {gÝhm Shri Vishal K. Sinha

(1) lr Oo. ZmJoœa amd Shri J. Nageswara Rao

(2) lr amOoÝÐ emh Shri Rajendra Shah

(3) lr ‘mo{hV e‘m© Shri Mohit Sharma

(4) lr nr. A‘aZmW aoÈ>r Shri P. Amarnath Reddy

(5) lr‘Vr ^mdZm {~goZ Smt. Bhavna Bisen

(6) lr B. `w. B§Jbo Shri E. U. Ingle

(7) lr {dZmoX Hw$‘ma Shri Vinod Kumar

(8) lr H$‘b H$m§V Shri Kamal Kant

(9) lr‘Vr Or gamoOm Smt. G. Saroja

(10) lr. AOy©ZqgJ Eg. Xdo Shri Arjunsingh S. Dave

(11) lr. Ama. O¶mHw$‘ma Shri R. Jeyakumar

d[að> à~§YZ SEnIOR mAnAGEmEnT

‘hm à~§YH$General managers

Cn ‘hm à~§YH$Deputy General manager

4

49th AnnuAL REPORT 2018-19 ThE COTTOn CORPORATIOn OF InDIA LImITED

^m.H$.{Z.

C.C.I.

lr ho‘ÝV Hw$‘ma, Am¶Q>rEg‘w»¶ gVH©$Vm A{YH$mar

Shri hemant Kumar, ITSChief Vigilance Officer

lr ‘ZmoO ~OmO‘w»` ‘hm à~§YH$

Shri manoj BajajChief General Manager

lr Eg. Ho$. nm{UJ«mhr‘w»` ‘hm à~§YH$ ({dnUZ)Shri S. K. Panigrahi

Chief General Manager (Marketing)

lr b{bV Hw$‘ma Jwám>‘w.‘.à.({dÎm/dm{UÁ`)/H§$nZr g{Md

Shri Lalit Kumar GuptaC.G.M.(Fin./Comm.)/Company Secretary

lr amOoÝÐ Hw$‘ma Jwám‘w»` ‘hm à~§YH$ (‘mg§{d/{dÎm)

Shri Rajendra Kumar GuptaChief General Manager (HRD/Fin.)

5


^m.H$.{Z.

C.C.I.

6

^m.H$.{Z.

C.C.I.

49th AnnuAl RepoRt 2018-19 the cotton coRpoRAtion of indiA limited

gyMZmNOTICE

NOTICE is hereby given that the 49th Annual General Meeting of the members of THE COTTON CORPORATION OF INDIA LIMITED will be held as scheduled below:

DATE : 30Th AuGuST, 2019

DAY : FRIDAY

TIME : 12:00 NOON

VENUE : BOARD ROOm, 5Th FLOOR, “KAPAS BhAVAN”, PLOT NO. 3A, SECTOR-10, CBD BELAPuR, NAVI mumBAI - 400 614.

to transact the following business :

ORDINARY BuSINESS :

1. To receive, consider and adopt the Audited Financial Statement of the Company for the year ended 31st March, 2019, the Balance Sheet as at that date and Directors’ Report and Auditor’s Report along with other related documents and comments of Comptroller & Auditor General of India thereon in terms of Section 143(6) of the Companies Act, 2013.

2. To declare dividend for the financial year 2018-19.

By order of the Board of Directors,For ThE COTTON CORPORATION OF INDIA LImITED.

(Lalit Kumar Gupta) CGM (Fin/Comm.)/Company Secretary

Place : Navi MumbaiDate : 02.08.2019

EVXÛmam `h gy{MV {Ho$`m OmVm h¡ {H$ ^maVr` H$nmg {ZJ‘

{b{‘Q>oS> Ho$ gXñ`m| H$s 49dt dm{f©H$ gm‘mÝ` ~¡R>H$ ZrMo {XE

AZwgma Am`mo{OV H$s Om`oJr :

VmarI : 30 AJñV, 2019

{Xdg : ewH«$dma

g‘` : 12.00 ~Oo

ñWb : ~moS>© é‘, 5dr ‘§{Ob,

H$nmg ^dZ, ßbm°Q> Z§. 3E, goŠQ>a-10,

gr~rS>r ~obmnwa, Zdr ‘w§~B© - 400 614.

{ZåZ{bpIV H$m‘H$mO H$aZo Ho$ {bE :

gm‘mÝ` ì`dgm` :

1. 31 ‘mM©, 2019 H$mo g‘mßV df© Ho$ {bE H§$nZr H$s boIm nar{jV {dËVr` {ddaUr Am¡a Bg {XZm§H$ H$m VwbZ nÌ VWm {ZXoeH$m| H$s [anmoQ>© Ed§ boIm narjH$m| H$s [anmoQ>© Ho$ gmW-gmW AÝ` g§~§{YV {dda{U`m± VWm CZ na H§$nZrO A{Y{Z`‘ 2013 H$s Ymam 143(6) Ho$ AZwgma Am¡a {Z`§ÌH$ Ed§ ^maV Ho$ ‘hm boIm narjH$ H$s {Q>ßn{U`m± àmßV Am¡a ñdrH$ma H$aZm &

2. {dÎmr¶ df© 2018-19 Ho$ {bE bm^m§e Kmo{fV H$aZm&

{ZXoeH$ ‘§S>b Ho$ AmXoe go

H¥$Vo ^maVr` H$nmg {ZJ‘ {b{‘Q>oS>

(b{bV Hw$‘ma JwßVm)

‘w»` ‘hm à~§YH$ ({dËV/dm{U.)/H§$nZr g{Md

ñWmZ : Zdr ‘w§~B©

{XZm§H$ : 02.08.2019

7


^m.H$.{Z.

C.C.I.

NOTES:-

1. A MEMBER ENTITLED TO ATTEND AND VOTE AT THE MEETING IS ENTITED TO APPOINT A PROXY TO ATTEND AND VOTE ON POLL INSTEAD OF HIMSELF. SUCH PROXY NEED NOT BE A MEMBER OF THE COMPANY.

2. PROXIES IN ORDER TO BE EFFECTIVE MUST BE RECEIVED BY THE COMPANY NOT LESS THAN 48 HOURS BEFORE THE COMMENCEMENT OF THE MEETING. THE PROXY FORM IS ENCLOSED AT THE END OF NOTICE TO AGM.

By order of the Board of Directors,For ThE COTTON CORPORATION OF INDIA LImITED.

(Lalit Kumar Gupta) CGM (Fin/Comm.)/Company Secretary


To,

All Members, Directors & Auditors of the Company

ZmoQ²g : -

1. ~¡R>H$ ‘| CnpñWV ahZo VWm ‘VXmZ Ho$ hH$Xma A{YH$mar

gXñ` AnZo à{V{Z{Y Ho$ ê$n ‘| {H$gr AÝ` ì`{º$ H$mo

CnpñWV ahZo Am¡a AnZo ñWmZ na ‘VXmZ H$aZo H$m

A{YH$ma àXmZ H$a gH$Vo h¢ VWm Eogo à{V{Z{Y H$m

H§$nZr H$m gXñ` hmoZm Amdí`H$ Zht h¡ &

2. à^mdr hmoZo Ho$ {bE àm°Šgr nÌ ~¡R>H$ Ho$ àma§^ hmoZo go

48 K§Q>o nyd© H§$nZr Ho$ nmg àmßV hmo OmZm Mm{hE &

àm°Šgr ànÌ dm{f©H$ gm‘mÝ` ~¡R>H$ Ho$ Zmo{Q>g Ho$ A§V ‘|

{X`m J`m h¡&

{ZXoeH$ ‘§S>b Ho$ AmXoe goH¥$Vo ^maVr` H$nmg {ZJ‘ {b{‘Q>oS>

(b{bV Hw$‘ma JwßVm)

‘w»` ‘hm à~§YH$ ({dËV/dm{U.)/H§$nZr g{Md


{XZm§H$ : 02.08.2019

à{V,

H§$nZr Ho$ g^r gXñ`, {ZXoeH$ VWm gm§{d{YH$ boIm narjH$

8

^m.H$.{Z.

C.C.I.


49dr dm{f©H$ gm‘mÝ¶ ~¡R>H$AÜ¶j H$m g§Xoe

49Th ANNuAL GENERAL mEETINGChAIRmAN'S mESSAGE

Dear Shareholders,

Greetings to you on behalf of the CCI team.

It is once again my proud privilege to communicate with you through this annual report. At the outset, I would like to thank for your support in making this Corporation a reputed public sector trading organization in the country. The notice convening the meeting, the Director’s Report and the Annual Audited Accounts for the year ended 31st March 2019 have already been circulated and with your permission, I shall take them as read.

Your Corporation with its prudent policies, dedicated and experienced cadre of employees had been able to meet the challenges of Cotton season 2018-19 creating value for the organization and gaining further strength. The Company is moving on the path of long term sustainable growth. I would like to share with you brief highlights about the performance of your company during 2018-19 vis-à-vis cotton scenario in Domestic & International market.

COTTON SCENARIO : International situation :

World opening stock has increased by 2% to 18.78 million metric tons in comparison to opening stock of 18.48 million metric tons of last year, 2017-18. Acreage under cotton has decreased marginally to 32.94 million hectares as against 33.10 million hectares in 2017-18. As a result, world cotton production has decreased by 3% to 25.75 million metric tons as against 26.68 million metric tons during 2017-18.

{à¶ eo¶aYmaH$m|,

grgrAmB©AmB© Q>r‘ H$s Amoa go AmnH$mo Z‘ñH$ma &

Bg dm{f©H$ [anmoQ>© Ho$ ‘mÜ¶‘ go EH$ ~ma {’$a Amngo g§dmX H$aZo

H$m gm¡^m½¶ àmá hþAm h¡ & ewê$ ‘|, ‘¡ Bg {ZJ‘ H$mo Xoe ‘| EH$

à{V{ð>V gmd©O{ZH$ joÌ H$m ì¶mnm[aH$ g§ñWmZ ~ZmZo ‘| Amn

g^r Ho$ gh¶moJ Ho$ {bE Am^ma ì¶º$ H$aZm MmhVr hÿ± & Bg ~¡R>H$

H$s gyMZm H$s Zmo{Q>g, {ZXoeH$ [anmoQ>© Am¡a 31 ‘mM©, 2019

H$mo g‘má df© Ho$ {bE dm{f©H$ boIm nar{jV boIo Omo nhbo hr

n[aMm{bV {H$¶o Om MwHo$ h¢ & AmnH$s AZw‘{V go, ‘¢ Cgo n{R>V

‘mZVr hÿ± &

AmnHo$ {ZJ‘ Zo AnZr {ddoH$nyU© ¶moOZmAm|, H$‘©Mm[a¶m| Ho$ g‘{n©V

d AZw^dr g§JR>Z go H$nmg ‘m¡g‘ 2018-19 H$s MwZm¡{V¶m| H$m

gm‘Zm H$aVo hþE g§ñWmZ Ho$ {bE ‘hËdnyU© CnbpãY¶m± hm{gb

H$s & ‘wPo Amem h¡ {H$ H§$nZr AnZr XrK© YmaUr¶ d¥{Õ àmá H$aZo

Ho$ nW na AJo«ga h¡ & A~ ‘¢ AmnHo$ gmW df© 2018-19 Ho$

Xm¡amZ AmnH$s H§$nZr Ho$ H$m¶© {ZînmXZ Ho$ g‘j Xoer H$nmg

n[aÑí¶ d A§Vaamï´>r¶ ‘mH}$Q> Ho$ g§{já q~XþAm| H$mo gmPm H$aZm

Mmhÿ±Jr &

H$nmg n[aÑí¶ :A§Vaamï´>r¶ pñW{V :

{dœ Ama§{^H$ ñQ>m°H$ JV df© 2017-18 Ho$ Ama§{^H$ ñQ>m°H$ 18.48 {‘{b¶Z ‘¡{Q´>H$ Q>Ýg H$s VwbZm ‘| 2% H$s d¥{Õ Ûmam 18.78 {‘{b¶Z ‘¡{Q´>H$ Q>Ýg hþAm & H$nmg EH$aoO JV df© 2017-18 ‘| 33.10 {‘{b¶Z h¡ŠQ>a Ho$ gm‘Zo WmoS>r {JamdQ> H$s dOh 32.94 {‘{b¶Z h¡ŠQ>a ahm & {OgHo$ n[aUm‘ñdê$n {dœ H$m H$nmg CËnmXZ JV df© 2017-18 Ho$ Xm¡amZ 26.68 {‘{b¶Z ‘¡{Q´>H$ Q>Z Ho$ gm‘Zo 3% {JamdQ> H$s dOh go 25.75 {‘{b¶Z ‘¡{Q´>H$ Q>Ýg ahm & {dœ ì¶mnr ê$B© {‘b H$m BñVo‘mb

9


^m.H$.{Z.

C.C.I.

Global cotton mill use is expected to increase by 1% to 26.66 million metric tons and world ending stock at the end of world cotton season on 31st July 2019 is estimated to decrease by 5% to 17.87 million metric tons in comparison to 18.78 million metric tons of last year. (Source: ICAC Journal-Cotton this Month dated July 1, 2019)

During the International cotton season (starts from 1st

August and ends on 31st July), the international cotton prices, as measured by Cotlook A Index were ruling in the range from 75.00 US C/lb to 99.50 US C/lb. It reached the season’s highest level of 99.50 US C/lb in the month of August 2018. Thereafter, prices moved downward to 74.30 US C/lb in the second week of July 2019. The yearly average International price up to 2nd week of July 2019 was 84.49 US C/lb which was 4% lower as compared to average of around 88.02 US Cents per lb during the corresponding period last year, 2017-18.

Domestic situation :

Acreage under cotton in India increased marginally to 126.07 lakh hectares in comparison to 125.86 lakh hectares of previous year, while yield decreased by 9% to 454 kg/ha as against 500 kg/ha of previous year due to drought like situation, deficient and erratic rains, dry & hot weather and soil moisture stress conditions mainly in parts of Gujarat and Maharashtra. As a result, cotton production decreased by 9% to 337 lakh bales as against 370 lakh bales of 2017-18.(Source: Cotton Advisory Board Meeting)

With estimated carryover stock of 42.91 lakh bales, imports of 22 lakh bales, cotton consumption (including Mill, SSI and non-textile consumption) at 311.50 lakh bales and estimated exports of 50 lakh bales, the closing stock at the end of the cotton season 2018-19 has been estimated at 40.41 lakh bales.(Source: Cotton Advisory Board).

The opening prices of lint cotton (major cotton varieties) in the current cotton season were higher by around 12% to 18% as compared to the opening prices of previous year.

1% d¥{Õ go 26.66 {‘{b¶Z ‘¡{Q´>H$ Q>Ýg Ano{jV Wm VWm 31 OwbmB© 2019 H$mo {dœ H$nmg ‘m¡g‘ H$s g‘m{á na {dœ ñQ>m°H$ JV df© 18.78 {‘{b¶Z Q>Ýg H$s VwbZm ‘| 5% H$‘r Ho$ gmW 17.87 {‘{b¶Z ‘¡{Q´>H$ Q>Ýg H$m AZw‘mZ bJm¶m J¶m h¡ (òmoV : AmB©grEgr OZ©b - H$m°Q>Z {Xg ‘ÝW {XZm§H$ 01 OwbmB© 2019)

A§Vam©ï´>r¶ H$nmg ‘m¡g‘ Ho$ Xm¡amZ (01 AJñV VWm 31 OwbmB©

VH$) H$m°Q>bwH$ E gyMH$m§H$ Ho$ AZwgma A§Vaamï´>r¶ ê$B© ‘yë¶

75.00 ¶y Eg g|Q> / à{V Eb ~r go 99.50 ¶y Eg g|Q> /à{V

Eb ~r H$s a|O ‘| aho & AJñV 2018 Ho$ ‘Ü¶ ‘| ¶o ‘m¡g‘ Ho$

CƒV‘ ñVa ¶m{Z 99.50 ¶y Eg g|Q> /à{V Eb ~r VH$ nhþ±M

JE & VËnümV OwbmB© 2019 Ho$ Xþgao gßVmh ‘| 74.30 ¶y Eg

g|Q> / à{V Eb ~r VH$ ZrMo {Jam & OwbmB© 2019 Ho$ Xÿgao gámh

VH$ dm{f©H$ Am¡gV A§Vaamï´>r¶ ‘yë¶ 84.49 ¶y Eg g|Q> / à{V

Eb ~r Wm Omo {nN>bo df© 2017-18 Ho$ Xm¡amZ bJ^J 88.02

à{V ¶y Eg goÝQ> à{V Eb ~r H$s VwbZm ‘| 4% H$‘ Wm &

Xoer pñW{V :

Xoe ‘| H$nmg Ho$ A§VJ©V joÌ’$b {nN>bo df© H$s VwbZm ‘| 125.86 bmI h¡ŠQ>a go WmoS>r d¥{Õ Ho$ gmW 126.07 bmI h¡ŠQ>a ahm & O~{H$ ‘w»¶ ê$n go JwOamV Am¡a ‘hmamï´> ‘| gyIo O¡gr pñW{V, H$‘ Am¡a A{Z{üV ~m[ae, ewîH$ Am¡a J‘© ‘m¡g‘ Am¡a {‘Å>r H$s Z‘r VZmd H$s pñW{V hmoZo Ho$ H$maU, CËnmXZ {nN>bo df© 500 {H$bmoJ«m‘/à{V h¡ŠQ>g© Ho$ {dê$Õ 9% {JamdQ> go 454 {H$bmoJ«m‘/à{V h¡ŠQ>a ahm & n[aUm‘ñdê$n 2017-18 Ho$ 370 bmI Jm§R> Ho$ ‘wH$m~bo H$nmg H$m CËnmXZ 9% go KQ>H$a 337 bmI Jm§R> hmo J¶m & (ómoV: ê$B© gbmhH$ma ~moS>©

g{‘{V)

42.91 bmI Jm°R>m| Ho$ AZw‘m{ZV Adeof ñQ>m°H$, 22 bmI Jm°R>m|

Ho$ Am¶mV, 311.50 bmI Jm°R>m| H$m Cn^moJ d 50 bmI Jm°R>m|

Ho$ AZw‘m{ZV {Z¶m©V Ho$ gmW A§{V‘ ñQ>m°H$ df© 2018-19

H$m°Q>Z grOZ H$s g‘m{á na 40.41 bmI Jm±R>m| H$m AZw‘mZ

bJm¶m J¶m h¡ (òmoV: grE~r ~¡R>H$)

dV©‘mZ H$m°Q>Z grOZ ‘| qbQ> H$m°Q>Z (‘w»¶ ê$B© H$s {H$ñ‘|) Ho$

Ama§{^H$ ‘yë¶ {nN>bo df© Ho$ Ama§{^H$ ‘yë¶ H$s VwbZm ‘| bJ^J

12% go 18% Á¶mXm Wo &

10

^m.H$.{Z.

C.C.I.


During the season, average lint cotton prices were ruling in the range of Rs.42,000 per candy to Rs.47,000 per candy from October to March 2019.Thereafter,cotton prices are almost steady in the range of Rs.48,000 per candy to Rs.48,500 per candy due to US China-Trade war, reduced crop size for cotton season 2018-19, late onset of monsoon and delay in kapas arrivals for ensuing cotton season 2019-20.

PERFORmANCE hIGhLIGhTS :Procurement Operations :

For Cotton Season 2018-19, Govt. of India increased the Minimum Support Price (MSP) rates for cotton by Rs.1130/- i.e. around 28% as compared to previous cotton season. Being a nodal agency to undertake MSP operations on behalf of Govt. of India when the prices of Fair Average Quality (FAQ) grade seed cotton fall below the MSP level, your Corporation remains ready to procure FAQ grade kapas offered by the cotton farmers in various APMC yards at MSP rates.

Since beginning of Cotton Season 2018-19, prices of FAQ grade kapas were ruling above the MSP levels except in some centres in Southern and Central States wherein seed cotton prices were hovering at MSP levels. As a result, CCI started procurement under MSP Operations w.e.f. 1st October 2018 wherever the seed cotton prices fell below MSP level. The Corporation has procured 10.78 lakh bales under MSP operations.

In addition to the procurement of cotton under MSP operation, your Corporation started simultaneous purchases of kapas as well as ready bales under commercial operations wherever viable so as to utilize part of MSP infrastructure and recover part of overhead expenses. Thus, the Corporation has procured 0.25 lakh bales under commercial operations.

Thus, during F.Y. 2018-19, total procurement by CCI was 11.03 lakh bales (i.e. 10.78 lakh bales under

grOZ Ho$ Xm¡amZ, ê$B© H$s Am¡gV H$s‘V| AŠQy>~a go ‘mM©

2019 VH$ à{V H¢$S>r 42000 ê$nE go 47000 ê$nE à{V

H¢$S>r H$s gr‘m ‘| Mb aho Wo & BgHo$ ~mX A‘o[aH$s MrZ ì¶mnma

¶wÕ, H$m°Q>Z grOZ 2018-19 ‘| H$nmg H$s ’$gb Ho$ AmH$ma

‘| H$‘r, ‘mZgyZ H$s Xoar go ewê$AmV H$s dOh Am¡a H$nmg

H$s AmdH$ ‘| Xoar Ho$ H$maU ê$B© H$s H$s‘V| bJ^J 48,000

ê$n¶o à{V H¢$S>r go boH$a 48,500 à{V H¢$S>r VH$ pñWa aht &

H$m¶©-{ZînmXZ Ho$ ‘w»¶ q~Xþ : IarXr n[aMmbZ :

H$m°Q>Z grOZ 2018-19 Ho$ {bE ^maV gaH$ma Ûmam JV df©

H$s VwbZm ‘| bJ^J 28% d¥{Õ Ho$ gmW Ý¶yZV‘ g‘W©Z ‘yë¶

‘| 1130/- ê$. go ~‹T>moVar H$s JB© & ^maV gaH$ma H$s Amoa

go Ý¶yZV‘ g‘W©Z ‘yë¶ g§MmbZ Ho$ {bE EH$ ZmoS>b EO|gr hmoZo

Ho$ ZmVo O~ H$^r ^r C{MV Am¡gV JwUdÎmm (E’$EŠ¶y) H$nmg

Ho$ ‘yë¶ Ý¶yZV‘ g‘W©Z ‘yë¶ ñVa go ZrMo {Ja OmVo h¢ Vmo

AmnH$m {ZJ‘ {d{^Þ EnrE‘gr ¶mS>©g ‘| H$nmg CËnmXH$m| Ho$

Ûmam àñVm{dV E’$EŠ¶y J«oS> H$nmg H$s E‘Egnr Xam| na g§nyU©

‘mÌm H$s IarX H$aVm h¡ &

X{jU Ed§ ‘Ü¶ amÁ¶m| Ho$ Hw$N> H|$Ðmo H$mo N>moS>H$a Ohm± H$nmg H$s

H$s‘Vo Ý¶yZV‘ g‘W©Z ‘yë¶ Ho$ Amgnmg pñWa Wr, H$nmg df©

2018-19 Ho$ ewê$AmV go hr E’$EŠ¶y {H$ñ‘ H$s H$nmg H$s

H$s‘V| Ý¶yZV‘ g‘W©Z ‘yë¶ go D$na ahr & {OgHo$ n[aUm‘ñdê$n

{ZJ‘ Zo 01 AŠQy>~a, 2018 go hr Ohm± Ohm± H$nmg H$s H$s‘Vo

Ý¶yZV‘ g‘W©Z ‘yë¶ go H$‘ Wr dhm± dhm± Ý¶yZV‘ g‘W©Z ‘yë¶

Ho$ A§VJ©V IarXr ewê$ H$s JB© & {ZJ‘ Zo Ý¶yZV‘ g‘W©Z ‘yë¶

Ho$ A§VJ©V 10.78 bmI Jm±R>m| H$s IarX H$s &

Ý¶yZV‘ g‘W©Z ‘yë¶ n[aMmbZ Ho$ AYrZ H$nmg H$s IarXr Ho$

A{V[aº$ AmnHo$ {ZJ‘ Zo Ohm± g§^d hþAm dm{UÁ¶ n[aMmbZ Ho$

AYrZ V¡¶ma Jm±R>m| Ho$ gmW-gmW H$nmg H$s IarXr H$aZm Ama§^

{H$¶m Vm{H$ E‘Egnr g§aMZm Ho$ ^mJ H$m Cn¶moJ H$aVo hþE Hw$N>

D$nar IM© Ho$ ^mJ H$mo dgyb {H$¶m Om gHo$ & AV: {ZJ‘ Zo

dm{UÁ¶ n[aMmbZ Ho$ AYrZ 0.25 bmI Jm±R>m| H$s IarXr H$s &

AV: {dÎmr¶ df© 2018-19 Ho$ A§V VH$ grgrAmB© H$s Hw$b IarXr 11.03 bmI Jm±R>| Wr (Ý¶yZV‘ g‘W©Z ‘yë¶ Ho$ AYrZ 10.78

11


^m.H$.{Z.

C.C.I.

MSP + 0.25 lakh bales under commercial operations).

Domestic Sales :

During the year under review, your Corporation has liquidated around 0.14 lakh bales up to 31st March, 2019 of crop year 2018-19 to domestic textile industry including MSMEs to cover their current requirement of quality cotton. As on 12thJuly, 2019, the Corporation has liquidated total 1.48 lakh bales. The Corporation continued to pursue the policy of pragmatic sales by supplying quality cotton and better pre and post sales services to the customers.

Warehousing :

Your Corporation has leased out the storage space of its warehousing complex at Kalamboli for commercial utilization at competitive rates and generated revenue to the tune of around Rs. 2.62 crores. In order to increase utilization and revenues, the Corporation has given the complex on operation, maintenance & management basis to M/s. UltraTech Cement Ltd. w.e.f. 9th May 2019 after following the open tender process. This will initially generate additional revenue to the tune of Rs.7.70 crore per annum to the Corporation.

Financial Results :

With the dynamic approach of the Corporation, during the year under review, your Corporation has achieved a turnover of Rs.2832.45 crore as against the previous year’s turnover of Rs.1173.53 crore. Profit after tax (PAT) in current year has been Rs. 50.99 crore as against profit of Rs. 4.17 crores in the previous year.

During the year under report, your Corporation’s short term debt is rated ACUITE A1+i.e. the highest credit rating assigned in this category for short term bank borrowings of Rs.25,000/- crore which signifies very strong degree of safety, lowest credit risk.

bmI Jm±R>|+dm{UpÁ¶H$ n[aMmbZ Ho$ AYrZ 0.25 bmI Jm±R>|) &

Xoer {~H«$s :

g‘rjmYrZ df© Ho$ Xm¡amZ AmnHo$ {ZJ‘ Zo H$nmg Ho$ dV©‘mZ

Amdí¶H$Vm H$mo H$da H$aZo Ho$ {bE E‘EgE‘B© H$mo em{‘b H$aHo$

Xoer dó CÚmoJ Ho$ {bE 31 ‘mM©, 2019 ¶m{Z ’$gb df©

2018-19 VH$ bJ^J 0.14 bmI Jm±R>m| H$m n[ag‘mnZ {H$¶m&

{ZJ‘ Zo 12 OwbmB©, 2019 VH$ Hw$b 1.48 bmI Jm§R>m| H$m

n[ag‘mnZ {H$¶m & {ZJ‘ Zo J«mhH$m| H$mo {~H«$s go nyU© VWm CgHo$

nümV ~ohVa godmE°§ XoZo VWm AÀN>r JwUdÎmmdmbr H$nmg H$s

Amny{V© Ûmam Cn^moº$m {‘bm| go grYo ì¶dhm[aH$ {~H«$s H$s ¶moOZm

H$mo {Za§Va Omar aIm &

^§S>maJ¥h n[aga :

AmnHo$ {ZJ‘ Zo H$b§~mobr ^§S>maU n[aga H$m nyam ñQ>moaoO ñnog

dm{UÁ¶H$ Cn¶moJ hoVw à{VñnYm© Xam| na brO na {X¶m VWm

bJ^J 2.62 H$amo‹S> ê$. H$m amOñd A{O©V {H$¶m & ^§S>maU

n[aga H$s Cn¶mo{JVm d amOñd ‘| d¥{Õ H$aZo Ho$ {bE {ZJ‘

n[aMmbZ, aIaImd Ed§ à~§YZ Ho$ AmYma na {Z{dXm H$s à{H«$¶m

H$mo nyam H$aVo hþE ‘ogg© AëQ´>m Q>oH$ {g‘|Q> {b{‘Q>oS> H$mo 09 ‘B©,

2019 go {X¶m h¡ & {OgHo$ H$maU {ZJ‘ H$mo àma§{^H$ Vm¡a na

dm{f©H$ 7.70 H$amo‹S> ê$. go A{V[aº$ H$m amOñd A{O©V hmoJm &

{dÎmr¶ n[aUm‘ :

g‘rjmYrZ df© Ho$ Xm¡amZ AmnHo$ {ZJ‘ H$s J{Verb Ñ{ï>H$moU Ho$

gmW 2832.45 H$amo‹S> ê$n¶o H$m H$mamo~ma (Q>Z©Amoda) hþAm &

O~{H$ {nN>bo df© 1173.53 H$amo‹S> H$mamo~ma (Q>Z©Amoda) {H$¶m

Wm & dV©‘mZ df© ‘| H$a (nrEQ>r) Ho$ ~mX 50.99 H$amo‹S> ê$n¶o

bm^ àmá hþAm h¡ & O~{H$ {nN>bo df© Ho$ {dê$Õ 4.17 H$amo‹S>

H$m bm^ àmá hþAm &

[anmoQ>© df© Ho$ Xm¡amZ AmnHo$ {ZJ‘ H$mo Aënmd{Y F$U E³¶yQ>o

E+1 go aoqQ>J {H$¶m J¶m h¡, Omo {H$ 25000 H$amoS> én¶o Ho$

Aënmd{Y F$U H$s loUr ‘| CƒV‘ aoqQ>J h¡, Omo {H$ gwajm hoVw

~hþV hr ‘O~yV j‘Vm Ed§ Ý¶yZV‘ Ho«${S>Q> Omo{I‘ H$mo Xem©{V h¡ &

12

^m.H$.{Z.

C.C.I.


Progressive use of hindi:

Your Corporation has received National award, Rajbhasha Kirti Puraskar for the 26th time on 14th

September, 2018 from Hon`ble Vice President of India for Rajbhasha Hindi implementation.

TEChNOLOGY & STANDARDIZATION:

Your Corporation believes that in today's dynamic business environment for achieving long term sustainable growth, it is essential to harness the power of Information Technology (IT) systems. The Corporation is committed to digital transformation to leverage our IT capabilities to achieve competitive advantage. Some of the initiatives taken by your Corporation which are working smoothly include ERP systems, sale of cotton bales & cotton seeds through e-Auction platform, video conferencing for optimum utilization of time and prompt decisions, web application for Internal Audit, public grievance lodging monitoring system, cashless transactions through NEFT/RTGS etc.

Besides this, your Corporation has successfully developed a farmer- friendly Mobile Application “Cott-Ally” in order to have direct interaction and outreach with the cotton farmers and to keep the cotton farmers informed about various information related to Minimum Support Price operations, tracking of payments status etc. I would like to congratulate you all that these efforts of your corporation has been recognized with the following awards:

i) “Best Government initiative by a PSU” by Anthronik’s 1st edition of India Concord Summit & Awards 2018-Connecting people to PSUs.

ii) SCOPE corporate Communication Excellence Awards in category “Effective use of Digital Media”

CORPORATE SOCIAL RESPONSIBILITY (CSR)

Your Corporation has always been a responsible organization committed to fulfilling its CSR obligations. The thrust areas identified for this purpose include

amO^mfm qhXr H$m àJm‘r à¶moJ :

AmnHo$ {ZJ‘ H$mo amO^mfm qhXr Ho$ CËH¥$ï> H$m¶m©Ýd¶Z Ho$ {bE

14 {gV§~a, 2018 H$mo maV Ho$ ‘hm‘{h‘ Cn amï´>n{V go 26dt

~ma amï´>r¶ ñVa H$m amO^mfm H$s{V© nwañH$ma àmá hþAm &

VH$ZrH$s d ‘mZH$sH$aU :

AmnHo$ {ZJ‘ H$m ‘mZZm h¡ {H$ AmO Ho$ J{Verb ì¶mnm[aH$

dmVmdaU ‘| XrKm©d{Y {dH$mg H$mo àmá H$aZo hoVw ¶h Amdí¶H$

h¡ {H$ gyMZm àm¡Úmo{JH$s nÕ{V H$s e{º$¶m| H$mo AnZm¶m OmE &

{ZJ‘ à{VñnYm©Ë‘H$ bm^ àmá H$aZo Ho$ CÔoí¶ go AnZr gyMZm

àm¡Úmo{JH$s j‘VmAm| Ho$ ¶mo½¶ Cn¶moJ go {S>OrQ>b Q´>m§g’$m°a‘oeZ

hoVw dMZ~Õ h¡ & AmnHo$ {ZJ‘ Ûmam Bggo g§~§{YV Hw$N> Eogo

H$X‘ CR>m¶o J¶o h¡ Omo gwMmê$ ê$n go H$m¶© H$a aho h¢ O¡go

B©Amanr {gñQ>‘, B© Am°ŠeZ Ûmam ê$B© Ho$ Jm±R>m| d {~Zm¡bm {~H«$s,

g‘¶ H$s Cn¶mo{JVm Ho$ {bE dr{S>¶mo H$m°Z’«|$qgJ d Vwa§V {ZU©¶

boZm, Ambon hoVw do~ EßbrHo$eZ, bmoH$ {eH$m¶V EZB©E’$Q>r/

AmaQ>rOrEg Ûmam H¡$ebog boZXoZ BË¶m{X &

BgHo$ Abmdm, AmnHo$ {ZJ‘ Zo H$nmg {H$gmZm| Ho$ gmW grYr

~mVMrV Am¡a AmCQ>arM H$aZo Am¡a H$nmg {H$gmZm| H$mo Ý¶yZV‘

g‘W©Z ‘yë¶ n[aMmbZ go g§~§{YV {d{^Þ gyMZmAm|, ^wJVmZ

pñW{V Am{X go g§~§{YV OmZH$mar Ho$ ~mao ‘| gy{MV H$aZo Ho$ {bE

EH$ {H$gmZ AZwHy$b ‘mo~mBb EpßbHo$eZ "'H$m°Q> A{„'' {dH${gV

{H$¶m & ‘¢ Amn g^r H$mo ~YmB© XoZm MmhVr hÿ± {H$ AmnHo$ à¶mgm|

go {ZJ‘ H$mo {ZåZ{bpIV nwañH$mam| go gå‘m{ZV {H$¶m J¶m h¡ &

i) "'nrEg¶y Ûmam gd©loð> gaH$mar nhb'' E§W«mo{ZŠg

Ûmam ^maV gå‘obZ {eIa gå‘obZ Am¡a nwañH$ma

2018 Ho$ àW‘ g§ñH$aU - bmoJm| H$mo gmd©O{ZH$

CnH«$‘m| go Omo‹S>Zm &

ii) "'{S>{OQ>b ‘r{S>¶m Ho$ à^mdr Cn¶moJ'' loUr ‘|

ñH$mon H$m°nmoaoQ> g§Mma CËH¥$ï>Vm nwañH$ma

{ZJ{‘V gm‘m{OH$ Xm{¶Ëd (grEgAma) :

^mH${Z EH$ Eogm {dœñV g§JR>Z h¡, Omo gX¡d AnZr {ZJ{‘V gm‘m{OH$ Xm{¶Ëd H$s Am¡nMm[aH$VmAm| H$mo nyU© H$aZo Ho$ {bE dMZ~Õ h¡ & Bg bú¶ Ho$ à{VnmXZ ‘| {ZJ‘ Zo {H$gmZ H$ë¶mU,

13


^m.H$.{Z.

C.C.I.

health and medical care, sanitation, education/literacy enhancement, conservation of natural resources, rural development etc. CSR activities undertaken during the year were:

i) Construction of Girls Toilets with running water facility in Govt. Schools in four aspirational districts namely Asifabad & Bhooplapalliin the State of Telangana and Raichur & Yadgir in the state of Karnataka;

ii) Contribution to Swachh Bharat Kosh, Clean Ganga fund and Armed Forces Flag Day Fund;

iii) Contribution for environmental sustainability under the jurisdiction of CCI Branch office Coimbatore by tree plantation in the Anna University, Coimbatore campus.

iv) Empower the cotton farmers with appropriate technology & tools of preventive health measures by distributing 212 nos. hand-held kapas plucker machine in seven Aspirational Districts viz, Asifabad, & Bhooplapalli in the state of Telangana, Raichur & Yadgir in the state of Karnataka, Rayagada, Kalahandi & Balangir in the state of Odisha,

v) Promoting education under joy of giving by providing desktop computer along with UPS and Printer to Govt. schools in 4 Aspirational Districts viz, Asifabad, & Bhooplapalli in the state of Telangana, Raichur & Yadgir in the state of Karnataka.

During the year, your company has spent Rs. 37.79 lakhs towards CSR activities.

humAN RESOuRCE mANAGEmENT :

Human Resource Management in your Corporation has been structured in such a way that it motivates the employees to maximize their performance and encourages employee empowerment for generation of innovative ideas and fair distribution of rewards.

H$nmg H$s JwUdÎmm ‘| d¥{Õ, ñdmñÏ¶ ‘o{S>H$b Ho$¶a, g¡ZrQ>oeZ, {ejU/gmjaVm {dH$mg, àmH¥${VH$ òmoV H$m g§ajU, J«m‘rU {dH$mg BË¶m{X joÌm| ‘| gh¶moJ {H$¶m h¡ & Bg df© Ho$ Xm¡amZ H$s

JB© grEgAma J{V{d{Y¶m± Bg àH$ma h¢ :

i) Vob§JmZm amÁ¶ ‘| Am{g’$m~mX E§S> ^ynbmn{„Z VWm H$Zm©Q>H$ amÁ¶ ‘| am¶Mya E§S> ¶mXJra AmH$m§jr {Obm| Ho$ gaH$mar nmR>embmAm| ‘| aqZJ dm°Q>a H$s gw{dYm g{hV ~m{bH$mAmo Ho$ {bE em¡Mmb¶ H$m {Z‘m©U H$admZm&

ii) ñdÀN> ^maV H$mof, ñdÀN> J§Jm {Z{Y VWm geó

~b ÜdO {Xdg {Z{Y ‘| A§eXmZ H$aZm &

iii) grgrAmB© Ho$ H$mo¶å~Vya emIm Ho$ joÌm{YH$ma ‘|

n¶m©daU pñWaVm Ho$ {bE AÞm {dœ{dÚmb¶ H¢$ng

‘| d¥jmamonU hoVw A§eXmZ {H$¶m J¶m &

iv) {ZdmaH$ ñdmñÏ¶ XoI^mb g{hV ñdmñÏ¶ XoI^mb H$mo ~‹T>mdm XoZo hoVw H$nmg {H$gmZm| H$mo àm¡Úmo{JH$s Am¡a ñdmñÏ¶ {ZdmaH$ Cnm¶m| Ho$ CnH$aU 212 Z§~a H$s h¢S> ßbH$a ‘erZ gmV AmH$m§jmË‘H$ {Obm| O¡go Vob§JmZm amÁ¶ ‘| Am{g’$m~mX Am¡a ^ynmbn„r, H$Zm©Q>H$m amÁ¶ ‘| am¶Mya Am¡a ¶mXJra Amo{‹S>gm amÁ¶ ‘| am¶J‹S>m, H$mbmh§S>r Am¡a ~mbm§Jra ‘| {dVarV H$s JB© &

v) àmoÞ{V {ejm H$mo ~T>mdm XoZo Ho$ CÔoí¶ go Vob§JmZm

amÁ¶ ‘| Am{g’$m~mX E§S> ^ynbmn{„Z VWm H$Zm©Q>H$

amÁ¶ ‘| am¶Mya E§S> ¶mXJra 4 AmH$m§jr {Obm| ‘|

gaH$mar nmR>embmAm| ‘| S>oŠgQ>mn H§$ß¶yQ>a Ho$ gmW

¶ynrEg VWm qàQ>a àXmZ {H$E &

df© Ho$ Xm¡amZ grEgAma JVr{d{Y¶m|o ‘| AmnHo$ {ZJ‘ Zo 37.79

bmI ê$n¶o H$m ì¶¶ {H$¶m &

‘mZd g§gmYZ {dH$mg :

AmnHo$ {ZJ‘ ‘| ‘mZd g§gmYZ à~§YZ H$s Eogr ì¶dñWm H$s JB© h¡ {Ogo H$‘©Mm[a¶m| H$mo AnZr A{YH$V‘ H$m¶©{ZînmXZ XoZo H$s àoaUm {‘bZo Ho$ gmW gmW H$‘©Mm[a¶m| H$mo AnZr Z¶r ¶moOZmAm| na H$m¶© H$aZo d nwañH$mam| Ho$ C{MV {dVaU H$mo àmoËgm{hV H$aVm h¡ &

14

^m.H$.{Z.

C.C.I.


Cordial and harmonious industrial relations are maintained in your Corporation and no man days were lost due to any industrial unrest. During the year under report, total strength of your Corporation was 737 consisting of 90 officers and 647 unionized staff. Out of the total strength, there are 87 women employees comprising 15 women officers and 72 unionized staff.

Your Corporation continued to follow the policy guidelines of the Govt. of India in respect of the reservation of SC/ST/OBC/PH categories both in recruitment as well as promotion. Your Corporation effected rotational transfer of field staff and officers periodically.

CORPORATE GOVERNANCE

Your Corporation believes that for a company to be successful, it must maintain global standards of corporate conduct towards all its stakeholders. Your Company believes that the principles of fairness, transparency and accountability are the cornerstones for good governance. It is Company’s endeavor to continue to achieve the highest levels of governance and to benchmark itself with the best governed companies in the similar trade.

VISION FOR FuTuRE

Your Corporation aims to achieve a significant market share by achieving excellence in all its activities. The focus is on existing core competency. With the help of a committed workforce, your Corporation is fully equipped to move swiftly forward by delivering exceptional outcomes to its stakeholders in its overall aim of building a strong and robust future. Although the competition in the cotton economy of the country has increased due to entry of multinational companies and other factors, the Corporation is fully prepared to face such challenges in the coming years by adopting prudent business policies and innovative methods.

ACKNOWLEDGEmENTS

I take this opportunity to express my deep appreciation

{ZJ‘ ‘| Am¡Úmo{JH$ g§~§Y gm¡hmX©nyU© ah| Am¡a {H$gr ‘mZd {Xdg

H$s hm{Z Zht hþB©& df© Ho$ Xm¡amZ, [anmoQ>© Ho$ AYrZ AmnHo$ {ZJ‘

Ho$ H$‘©Mm[a¶m| H$s Hw$b g§»¶m 737 Wr, {Og‘| 90 A{YH$mar

VWm 647 ¶y{Z¶ZmB©ÁS> H$‘©Mmar em{‘b h¡ & H$‘©Mm[a¶m| H$s

Hw$b g§»¶m ‘| 87 ‘{hbm H$‘©Mmar em{‘b h¡, {Og‘| 15 ‘{hbm

A{YH$mar d 72 ¶y{Z¶ZmB©ÁS> ñQ>m°’$ h¢ &

AmnH$m {ZJ‘ ^Vu d nXmoÞ{V XmoZm| Ho$ ‘m‘bm| ‘| AZw.Om/

AZw.O.Om{V/AÝ¶ {nN>‹S>o dJ©/em.{d. Ho$ AmajU Ho$ ~mao ‘|

^maV gaH$ma Ho$ Zr{V ‘mJ©Xe©Z H$m nmbZ H$a ahm h¡ & AmnHo$

{ZJ‘ Zo ’$sëS> H$‘©Mm[a¶m| VWm A{YH$m[a¶m| Ho$ g‘¶-g‘¶ na

amoQ>oeZb ñWmZm§VaU ^r {H$¶o h¢ &

{ZJ{‘V emgZ :

AmnHo$ {ZJ‘ H$mo {dœmg h¡ {H$ EH$ H§$nZr H$mo g’$b hmoZo Ho$

{bE Bgo AnZo g^r ñQ>oH$ hmoëS>g© Ho$ à{V {ZJ{‘V AmMaU Ho$

d¡{œH$ ‘mZH$ ~ZmE aIZm Mm{hE & AmnHo$ {ZJ‘ H$m ‘mZZm h¡ {H$

{ZînjVm, nmaX{e©Vm VWm CÎmaXm{¶Ëd Ho$ {gÕm§V AÀN>o emgZ

Ho$ ‘hÎdnyU© gmonmZ h¢ & H§$nZr H$m ¶h à¶mg h¡ {H$ emgZ Ho$

CƒV‘ ñVa H$mo Omar aIm OmE° VWm Bgr Vah Ho$ Q´>oS> H$s gd©loð>

H§$n{Z¶m| ‘| AnZm EH$ ~|M‘mH©$ ~ZmE aIm OmE &

^mdr n[aÑí¶ :

AmnHo$ {ZJ‘ H$m CÔoí¶ g^r J{V{d{Y¶m| ‘| CËH¥$ï>Vm àmá H$aHo$

EH$ ‘hÎdnyU© ~mOma {hñgoXmar hm{gb H$aZm h¡ & nyam Ü¶mZ

‘m¡OyXm H$moa ¶mo½¶Vm na h¡ & EH$ à{V~Õ H$m¶©~b H$s ghm¶Vm

go AmnH$m {ZJ‘ EH$ ‘O~yV Am¡a geº$ ^{dî¶ Ho$ {Z‘m©U ‘|

AnZo g§nyU© bú¶ Ho$ AgmYmaU n[aUm‘ àXmZ H$aHo$ VoOr go

AmJo ~‹T>Zo Ho$ {bE nyar Vah gwgp‚mV h¡& hmbm§{H$ ~hþamï´>r¶

H§$n{Z¶m| Am¡a AÝ¶ H$maH$m| Ho$ àdoe Ho$ H$maU Xoe H$s H$nmg

H$s AW©ì¶dñWm H$s à{VñnYm© ‘| d¥{Õ hþB© h¡, {ZJ‘ {ddoH$nyU©

ì¶dgm{¶H$ Zr{V¶m| H$mo AnZmH$a AmZodmbo dfm] ‘| Eogr MwZm¡{V¶m|

H$m gm‘Zm H$aZo Ho$ {bE nyar Vah V¡¶ma h¡ &

Am^ma

‘¢ Bg Adga na {ZXoeH$ ‘§S>b Ho$ gXñ¶m| Ûmam g‘¶-g‘¶

15


^m.H$.{Z.

C.C.I.

for the valuable support given by the members of the Board from time to time.

I also wish to place on record my sincere gratitude for the guidance and cooperation extended by Hon’ble Minister of Textiles, Officials of the Ministry of Textiles, Ministry of Finance, Ministry of Agriculture and the various State Governments.

I am also grateful for the valuable guidance by the Statutory Auditors, Member Audit Board, Mumbai and officials of Government Audit in the course of audit of the Corporation for the year under review.

Sincere thanks are also due to the National Textile Corporation, Cooperative Spinning Mills and various mills in the private sector, who have covered their cotton requirements from the Corporation in cotton season 2018-19, thus, placing their faith in the quality, price competitiveness and services being rendered by the Corporation. Our sincere thanks are also due to the Confederation of Indian Textile Industries (CITI), Cotton Association of India (CAI), Central Warehousing Corporation (CWC), State Warehousing Corporations (SWC) for the cooperation extended to the Corporation.

I would also like to express my sincere and deep appreciation for the dedication, devotion and commitment with which the staff and officers of the Corporation have worked during the period.

Thanking you,

Sd/-(DR. P. ALLI RANI)

CHAIRMAN-CUM-MANAGING DIRECTOR


na {XE JE Cn¶moJr Ed§ ~hþ‘yë¶ gh¶moJ Ho$ {bE Am^ma àH$Q>

H$aZm MmhVr hÿ± &

‘¢ ‘mZZr¶ dó ‘§Ìr, dó ‘§Ìmb¶ Ho$ A{YH$marJU, {dÎm

‘§Ìmb¶, H¥${f ‘§Ìmb¶ Am¡a {d{^Þ amÁ¶ gaH$mam| Ho$ à{V ^r

CZHo$ Ûmam {XE JE gh¶moJ VWm ‘mJ©Xe©Z Ho$ {bE ^r Am^mar

hÿ± &

g‘rjmJV df© Ho$ {bE {ZJ‘ Ho$ boIm| H$s narjm H$aVo g‘¶

{ZJ‘ Ho$ gXñ¶ boIm-narjm ~moS>©, ‘w§~B© Ûmam VWm gaH$mar

boIm narjm A{YH$m[a¶m| VWm gm§{d{YH$ boIm narjH$m| Ûmam

{XE JE A‘yë¶ ‘mJ©Xe©Z Ho$ {bE ^r, ‘¢ CZH$s Am^mar hÿ± &

‘¢, amï´>r¶ dó {ZJ‘, ghH$mar pñnqZJ {‘bm| VWm {ZOr joÌ

H$s {‘b| {OÝhm|Zo H$nmg ‘m¡g‘ df© 2018-2019 Ho$ Xm¡amZ

AnZr Amdí¶H$Vm AZwgma ê$B© H$s IarX H$s h¡ VWm Bg

àH$ma JwUdÎmm, ‘yë¶-à{VñnYm© Am¡a {ZJ‘ Ûmam Xr OmZodmbr

godmAm| na {dœmg ~Zm¶o aIm h¡& ^maVr¶ dó CÚmoJ g§JR>Z

(grAm¶Q>rAm¶), H$m°Q>Z Egmo{gEeZ Am°’$ B§{S>¶m (grEAmB©),

Ho$ÝÐr¶ ^§S>ma {ZJ‘ (grS>ãë¶ygr), amÁ¶ ^§S>ma {ZJ‘

(EgS>ãë¶ygr) Ûmam {ZJ‘ H$mo {XE JE gh¶moJ Ho$ à{V ^r, ‘¢

hm{X©H$ Am^mar hÿ± &

Bg Ad{Y Ho$ Xm¡amZ {ZJ‘ Ho$ A{YH$m[a¶m| Ed§ H$‘©Mm[a¶m|

Ûmam {X¶o J¶o g‘n©U, {Zð>m Am¡a dMZ~ÕVm Ho$ {bE ^r, ‘¢

hm{X©H$ Am^mar hÿ±&

gYÝ¶dmX,

hñVm/- (S>m°. nr. A„r amZr)

AÜ¶j Ed§ à~§Y {ZXoeH$


{XZm§H$ : 30.08.2019

16

^m.H$.{Z.

C.C.I.


df© 2018-19 Ho$ {bE {ZXoeH$ [anmoQ>©

DIRECTORS’ REPORT FOR ThE YEAR 2018-19

To,The Members,The Cotton Corporation of India Limited

Your Directors have immense pleasure in presenting the 49th Annual Report on the working of your Corporation together with the Annual Accounts for the year ended 31st March, 2019, as approved by the Board of Directors and certified by the Auditors along with their report thereon.

1. COTTON SITuATION

1.1 The highlights of the cotton season 2018-19 (i.e. Oct-18 to Sept-19) are as under:

• Cotton season 2018-19 commenced with a carryover stock of 42.91 lakh bales, which was just enough to meet around 2 month’s mill consumption.

• The area under cotton cultivation has increased marginally to 126.07 lakh hectares against previous years’ area of 125.86 lakh hectares.

• Thereafter, due to drought like situation, deficient and erratic rains, dry & hot weather and soil moisture stress conditions mainly in parts of Gujarat and Maharashtra, the cotton production in the country is estimated at 337 lakh bales i.e. less by 9% against previous years’ production of 370 lakh bales.

1.2 For cotton season 2018-19, the Government of India has increased the Minimum Support Prices (MSPs) by Rs.1130/- i.e. around 28% in comparison to previous year. In medium staple group (24.5mm to 25.5mm staple length with

{à¶,

gXñ¶JU,

^maVr¶ H$nmg {ZJ‘ {b{‘Q>oS>

AmnHo$ {ZXoeH$JU 31 ‘mM©, 2019 H$mo g‘má df© Ho$ {bE

dm{f©H$ boIm| Ho$ gmW AmnHo$ {ZJ‘ Ho$ H$m¶©-g§MmbZ na 49dt

dm{f©H$ [anmoQ>© ghf© àñVwV H$aVo h¢, Omo {ZXoeH$ ‘§S>b Ûmam

AZw‘mo{XV h¡ VWm boIm narjH$m| Ûmam CZH$s [anmoQ>© Ho$ gmW

à‘m{UV h¡ &

1. H$nmg pñW{V

1.1 H$nmg ‘m¡g‘ 2018-19 (A³Qy>~a, 18 go {gV§~a, 19) H$s ‘w»¶-‘w»¶ ~mV| ZrMo {X¶o AZwgma h¢ :

· H$nmg ‘m¡g‘ 2018-19 H$m Ama§^ 42.91 bmI

Jm±R>m| Ho$ H¡$ar Amoda ñQ>m°H$ Ho$ gmW hþAm, Omo {‘b

H$s bJ^J Xmo ‘mh H$s InV Ho$ {bE hr H$m’$s Wr&

· H$nmg IoVr H$m joÌ {nN>bo df© Ho$ 125.86

bmI hoŠQ>o¶a H$s VwbZm ‘| Wmo‹S>r d¥Õr Ho$ gmW

126.07 bmI hoŠQ>o¶a hmo J¶m &

· {’$a ‘w»¶ ê$n go JwOamV Am¡a ‘hmamï´> ‘| gyIo

O¡gr pñW{V, ~m[ae H$s H$‘r Ed§ A{Z{üVVm,

ewîH$ Am¡a J‘© ‘m¡g‘ Am¡a {‘Å>r H$s Z‘r VZmd H$s

pñW{V hmoZo Ho$ H$maU, CËnmXZ {nN>bo df© 370

bmI Jm§R> Ho$ ‘wH$m~bo éB© H$m CËnmXZ 9% KQ>H$a

337 bmI Jm§R> hmo J¶m &

1.2 H$nmg ‘m¡g‘ 2018-19 Ho$ {bE ^maV gaH$ma Ûmam

Ý¶yZV‘ g‘W©Z ‘yë¶ ‘| 1130/- ê$. H$s d¥Õr H$s

JB© Omo JV df© H$s VwbZm ‘| bJ^J 28% h¡ & ‘r{S>¶‘

ñQ>onb J«wn (24.5 E‘E‘ go 25.5 E‘E‘ ñQ>onb b|W

17


^m.H$.{Z.

C.C.I.

mic 4.3 to 5.1), the MSP has been increased to Rs.5150/- per quintal from Rs.4020/- per quintal and in the case of long staple group (29.5mm to 30.5mm with mic. 3.5 to 4.3), the same has been increased to Rs.5450/- per quintal as against Rs.4320/- per quintal during previous year.

2. FINANCIAL RESuLTS

2.1 During the year under review, your Corporation has achieved a turnover of Rs.2832.45 crore as against the previous year’s turnover of Rs.1173.53 crores.

2.2 The highlights of the financial results during the financial year under review were as follows:

Particulars FY 2018-19 FY 2017-18

Purchase (Bales in lakh) 11.03 10.78

Sales (Bales in lakh) 08.35 02.81

Turnover (Rs.in crores) 2832.45 1173.53

Profit after tax (Rs.in crore) 50.99 4.17

2.3 During the year under report, your Corporation’s short term debt is rated ACUITE A1+i.e. the highest credit rating assigned in this category for short term bank borrowings of Rs.25,000/- crores which signifies very strong degree of safety, lowest credit risk.

2.4 DIVIDEND:

Your directors recommend dividend of Rs.15.30 crore, for the financial year 2018-19. The dividend shall be paid after seeking approval of the shareholder at the Annual General Meeting (AGM) of the Company.

4.3 go 5.1 ‘mB©H«$moZo¶a) ‘| E‘Egnr 4020/- ê$. à{V q¹$Q>b go 5150/-ê$. à{V q¹$Q>b VH$ H$s d¥pÜX hþB© VWm bm±J ñQ>onb J«wn (29.5 E‘E‘ go 30.5 E‘E‘ 3.5 go 4.3 ‘mB©H«$moZo¶a) ‘| {nN>bo df© ‘| 4320/-ê$. à{V q¹$Q>b Ho$ gm‘Zo 5450/- à{V q¹$Q>b VH$

d¥pÜX H$s JB© &

2. {dÎmr¶ n[aUm‘

2.1 g‘rjmYrZ df© Ho$ Xm¡amZ AmnHo$ {ZJ‘ Zo {nN>bo df©

Ho$ 1173.53 H$amo‹S> ê$. Ho$ Q>Z©-Amoda Ho$ {dê$ÜX

2832.45 H$amo‹S> ê$. H$m Q>Z©-Amoda àmá {H$¶m h¡ &

2.2 g‘rjmJV {dÎmr¶ df© Ho$ Xm¡amZ {dÎmr¶ n[aUm‘m| H$s ‘w»¶ ~mV| ZrMo {X¶o AZwgma h¡:

{ddaU{dÎmr¶ df© 2018-19

{dÎmr¶ df© 2017-18

IarX (bmI Jm±R>m| ‘|)

11.03 10.78

{~H«$s(bmI Jm±R>m| ‘|)

08.35 02.81

Q>Z©-Amoda (H$amo‹S> ê$n¶m| ‘|)

2832.45 1173.53

H$a Ho$ (hm{Z) (H$amo‹S> ê$n¶o ‘|) 50.99 4.17

2.3 [anmoQ>© Ho$ AYrZ df© ‘| AmnHo$ {ZJ‘ H$m Aënmd{Y F$U

E³¶yQ>o E1+ ahm h¡ ¶m{Z 25,000 H$amo‹S> ê$. H$s Aën

Ad{Y ~¢H$ CYma Ho$ {bE Bg loUr ‘| Xr J¶r CƒV‘

H«o${S>Q> aoqQ>J h¡, Omo Aënmd{Y F$U Xo¶Vm na g‘¶ na

^wJVmZ Ho$ {bE Ñ‹T> j‘Vm {XImVr h¡ Am¡a Ý¶yZV‘ F$U

OmopI‘ aIVr h¡ &

2.4 bm^m§e :

AmnHo$ {ZXoeH$m| Zo {dÎmr¶ df© 2018-19 Ho$ Xm¡amZ

15.30 H$amo‹S> ê$. Ho$ bm^m§e H$s {g’$m[ae H$s h¡&

bm^m§e H$m ^wJVmZ H§$nZr H$s dm{f©H$ gm‘mÝ¶ ~¡R>H$

(EOrE‘) ‘| eo¶aYmaH$m| Ho$ AZw‘moXZ àmá H$aZo Ho$ nümV

{H$¶m OmEJm&

18

^m.H$.{Z.

C.C.I.


3. COTTON PRODuCTION AND CONSum-PTION DuRING 2018-19

With cotton production of 337 lakh bales, carryover stock of 42.91 lakh bales and estimated imports of 22 lakh bales, the total availability in cotton season 2018-19 is estimated at 401.91 lakh bales as against 429.56 lakh bales in previous year. (Source: Cotton Advisory Board (CAB) meeting dated 18th June 2019)

With total estimated cotton consumption in the country (including mill, small scale units and non-textile consumption) at 311.50 lakh bales and estimated exports of 50.00 lakh bales, total demand in cotton season 2018-19 has been estimated at 361.50 lakh bales as against 386.65lakh bales in previous year. Thus, the carry over stock at the end of the cotton season 2018-19 i.e. on 30th September 2019, is estimated at 40.41 lakh bales as against 42.91 lakh bales in previous year. The cotton balance sheet as drawn by CAB is as follows:

Quantity in lakh bales of 170 kgs.

PARTICuLARSCROP YEAR (Oct. to Sept.)

2018-19 2017-18SuPPLYOpening stock 42.91 43.76Crop (Production) 337.00 370.00Imports 22.00 15.80TOTAL SuPPLY 401.91 429.56DEmANDMill consumption 274.50 280.11S.S.I consumption 25.00 26.18Non Textile consumption 12.00 12.77

Total consumption 311.50 319.06Exports 50.00 67.59

TOTAL DEmAND 361.50 386.65

CARRY FORWARD 40.41 42.91

Source : Cotton Advisory Board (CAB) meeting dated 18.06.2019

3. df© 2018-19 Ho$ Xm¡amZ éB© CËnmXZ VWm Cn^moJ :

337 bmI Jm±R> H$nmg CËnmXZ, 42.91 bmI Jm±R>o Adeof ñQ>m°H$ VWm 22 bmI Jm±R>| AZw‘m{ZV Am¶mV go H$nmg ‘m¡g‘ 2018-19 ‘| Hw$b CnbãYVm 401.91 bmI Jm±R>| AZw‘m{ZV H$s JB© O~{H$ {nN>bo df© ¶h 429.56 bmI Jm±R>| Wr & (òmoV: {XZm§H$ 18 OyZ, 2019 H$mo Am¶mo{OV H$m°Q>Z gbmhH$ma g{‘{V H$s ~¡R>H$ (grE~r))

Xoe ‘| Hw$b H$m°Q>Z Cn^moJ ({‘b, N>moQ>r {‘b VWm {‘boVa Cn^moJ em{‘b h¡) H$m AZw‘mZ 311.50 bmI Jm°R>| bJm¶m J¶m h¡ Am¡a 50.00 bmI Jm±R>m| Ho$ AZw‘m{ZV éB© {Z¶m©V Ho$ gmW H$m°Q>Z ‘m¡g‘ 2018-19 ‘| éB© H$s Hw$b ‘m±J 361.50 bmI Jm±R>| ~Vm¶r J¶r h¡, O~{H$ {nN>bo df© ¶h 386.65 bmI Jm±R>| Wr & Bg àH$ma H$nmg ‘m¡g‘ 2018-19 Ho$ A§V ‘| ¶m{Z 30 {gV§~a, 2019 H$mo Adeof ñQ>m°H$ H$m AZw‘mZ 40.41 bmI Jm±R>o bJm¶m J¶m h¡, O~{H$ {nN>bo df© ¶h 42.91 bmI Jm±R>| Wm & H$nmg gbmhH$ma ‘§S>b Zo {ZåZmZwgma VwbZ-nÌ àñVwV {H$¶m h¡ :

‘mÌm bmI Jm±R>m| ‘| 170 {H$.J«m.

{ddaU ’$gb df© (A³Qy>~a go {gV§~a)

2018-19 2017-18

Amny{V©

Ama§{^H$ ñQ>m°H$ 42.91 43.76

’$gb (CËnmXZ) 337.00 370.00

Am¶mV 22.00 15.80

Hw$b Amny{V© 401.91 429.56

‘m§J

{‘b Cn^moJ 274.50 280.11

Eg.Eg.AmB©. Cn^moJ 25.00 26.18

Zm°Z-Q>oŠgQ>mBb Cn^moJ

12.00 12.77

Hw$b Cn^moJ 311.50 319.06

{Z¶m©V 50.00 67.59

Hw$b ‘m§J 361.50 386.65

AmJo bm¶m J¶m 40.41 42.91òmoV : H$m°Q>Z gbmhH$ma ‘§S>b (grE~r) H$s {X. 18.06.2019

H$mo Am¶mo{OV ~¡R>H$

19


^m.H$.{Z.

C.C.I.

4. DOmESTIC PRICE TREND

Cotton prices in the global markets are largely influenced by the demand-supply situation in major producing and consuming countries like China, US etc. The opening prices of lint cotton (major cotton varieties) in the current cotton season were higher by around 12% to 18% as compared to the opening prices of previous year.

Since beginning of current cotton season, cotton prices in India have been higher in comparison to previous year due to probable low availability of good quality cotton because of deficient &erratic rains, dry & hot weather and soil moisture stress conditions mainly in parts of Gujarat and Maharashtra and also the US-China trade war.

During the season, average lint cotton prices were ruling in the range of Rs.42,000 per candy to Rs.47,000 per candy from October to March 2019. Thereafter, cotton prices are almost steady in the range of Rs.48,000 per candy to Rs.48,500 per candy due to US China-Trade war, reduced crop size for cotton season 2018-19, late onset of monsoon and delay in kapas arrivals for ensuing cotton season 2019-20.

The movements of cotton lint prices (monthly average) for important varieties are as follows:

Monthly Average Lint Prices in Rs. per candy spot

month J-34 h-4 S-6 Bunny Brahma

October, 2018 43820 44104 46196 46232

November, 2018 43652 43957 45441 46496

December, 2018 42376 42864 44020 45188

January, 2019 42669 43031 42846 44346

February, 2019 42213 42608 41850 43179

4. Xoer ‘yë¶ àd¥{Îm :

{dœ ~mOma ‘| éB© ‘yë¶m| na à‘wI CËnmXZ d InV

H$aZodmbo Xoe O¡go MrZ, ¶y.Eg BË¶m{X ‘| ‘m±J Amny{V©

H$s pñW{V H$m H$m’$s à^md n‹S>m & dV©‘mZ H$nmg ‘m¡g‘

‘| ê$B© Ho$ Ama§{^H$ ‘yë¶ (‘w»¶ ê$B© {H$ñ‘|) {nN>bo df©

Ho$ Ama§{^H$ ‘yë¶ H$s VwbZm ‘| bJ^J 12% go 18%

A{YH$ Wo &

dV©‘mZ H$m°Q>Z grOZ Ho$ ‘m¡g‘ H$s ewê$AmV Ho$ ~mX go ^maV ‘| éB© H$s H$s‘V| {nN>bo gmb H$s VwbZm ‘| A{YH$ ahr h¢, Š¶m|{H$ AÀN>r JwUdÎmm dmbo H$nmg H$s g§^m{dV H$‘ CnbãYVm, H$‘ Am¡a A{Z¶{‘V ~m[ae, ewîH$ Am¡a J‘© ‘m¡g‘ Am¡a {‘Å>r H$s Z‘r Ho$ VZmd H$s pñW{V ‘w»¶ ê$n go JwOamV Am¡a ‘hmamï´> amÁ¶ ‘| h¡ VWm A‘o[aH$m - MrZ ì¶mnm[aH$ ¶wÕ BgHo$ H$maU h¡ &

grOZ Ho$ Xm¡amZ, Am¡gV éB© H$s H$s‘Vo AŠQy>~a go ‘mM© 2019 VH$ à{V H¢$S>r 42,000 ê$nE go 47,000 ê$nE à{V H¢$S>r H$s gr‘m ‘| Mb aho Wo & BgHo$ ~mX A‘o[aH$s MrZ ì¶mnma ¶wÕ Ho$ H$maU éB© H$s H$s‘V| bJ^J 48,000 ê$n¶o à{V H¢$S>r go boH$a 48,500 à{V H¢$S>r VH$ pñWa aht, H$nmg ‘m¡g‘ 2018-19 ‘| H$nmg Ho$ ‘m¡g‘ ‘| H$nmg H$s ’$gb H$m AmH$ma H$‘ hmo J¶m h¡, H$nmg AmJm‘r grOZ 2019-20 ‘| go ‘mZgyZ H$s Xoa go ewê$AmV Ho$ H$maU H$nmg H$s AmdH$ Xoar go hmoJr &

‘hÎdnyU© {H$ñ‘m| Ho$ {bE ê$B© ‘yë¶ (‘m{gH$ Am¡gV) H$s J{V ZrMo {XE AZwgma h¡ :

‘m{gH$ Am¡gV ê$B© ‘yë¶ -ê$. à{V H¢$S>r ñnm°Q>

‘mh Oo-34 EM-4 Eg-6 ~Þr ~«÷m

A³Qy>~a,2018 43820 44104 46196 46232

Zd§~a, 2018 43652 43957 45441 46496

{Xg§~a, 2018 42376 42864 44020 45188

OZdar, 2019 42669 43031 42846 44346

’$adar, 2019 42213 42608 41850 43179

20

^m.H$.{Z.

C.C.I.


March, 2019 43617 43821 43179 44363

April, 2019 46935 47152 46039 47517May, 2019 46469 46612 45244 47408June, 2019* 46505 46705 45635 47725

Source : Cotton Association of India, Mumbai

*Position upto 24th June 2019

5. OPERATIONS OF ThE CORPORATION :

5.1 Role assigned to CCI:

• To undertake price support operations, whenever the market prices of kapas falls below the minimum support prices (MSP) announced by Govt. of India, without any quantitative limit.

• To undertake commercial operations.

5.2 As and when the prevailing kapas prices of Fair Average Quality (FAQ) grade falls below the Minimum Support Price (MSP) level, your Corporation undertakes MSP operations as per the guidelines of Government of India and procures entire quantity of FAQ grade kapas offered by the cotton farmers in various Agricultural Produce Market Committee (APMC) yards and other notified areas at MSP rates.

Since beginning of current cotton season 2018-19, prices of Fair Average Quality (FAQ) grade kapas are ruling above the MSP levels except in some centres in Southern and Central States wherein seed cotton prices are hovering at MSP levels. As a result, CCI started procurement under MSP Operations w.e.f. 1stOctober 2018 wherever the seed cotton prices gone below MSP level.

To increase in the market share in the prevailing domestic & International market scenario, a volume based strategy has been adopted during the cotton season 2018-19 and in addition to the procurement of cotton under MSP operation, the Corporation started

‘mM©, 2019 43617 43821 43179 44363

Aà¡b, 2019 46935 47152 46039 47517

‘B©, 2019 46469 46612 45244 47408

OyZ, 2019* 46505 46705 45635 47725

òmoV : H$m°Q>Z Egmo{gEeZ Am°’$ B§{S>¶m (grEAmB©), ‘w§~B©

*24 OyZ, 2019 VH$ H$s pñW{V

5. {ZJ‘ Ho$ H$m¶© - H$bmn :

5.1 ^mH${Z H$s ^y{‘H$m :

· O~ H$^r H$nmg Ho$ ‘yë¶ ^maV gaH$ma Ûmam Kmo{fV g‘W©Z ‘yë¶ (E‘Egnr) H$mo Ny>Zo bJ|, V~ {H$gr ^r ‘mÌmË‘H$ gr‘m Ho$ {~Zm g‘W©Z ‘yë¶ na H$m¶© H$aZm &

· dm{UpÁ¶H$ IarX H$m¶© H$aZm &

5.2 O~ H$^r C{MV Am¡gV JwUdÎmm (E’$EŠ¶y) H$nmg

Ho$ àM{bV ‘yë¶ Ý¶yZV‘ g‘W©Z ‘yë¶ ñVa go ZrMo

{Ja OmVo h¢ V~ AmnH$m {ZJ‘ ^maV gaH$ma Ho$ {ZX}

em| Ho$ AZwgma {d{^Þ (EnrE‘gr) ¶mS>©g VWm AÝ¶

A{Ygy{MV joÌm| ‘| H$nmg CËnmXH$m| Ûmam àñVm{dV

E’$EŠ¶y J«oS> H$s g§nyU© ‘mÌm H$s IarXr H$aVm h¡&

X{jU Ed§ ‘Ü¶ amÁ¶m| Ho$ Hw$N> H|$Ð N>mo‹S>H$a Ohm± H$nmg H$s {H$‘Vo "Ý¶wZV‘ g‘W©Z ‘yë¶' Ho$ Amgnmg Mb ahr Wr, Mmby H$m°Q>Z grOZ 2018-19 Ho$ Ama§^ go hr "C{MV Am¡gV JwUdÎmm' (E’$E³¶y) {H$ñ‘H$s H$nmg H$s {H$‘Vo" Ý¶wZV‘ g‘W©Z ‘yë¶'go Cna Mb ahr Wr & n[aUm‘ñdê$n mH${Z Zo Ohm± H$ht H$m°Q>Z grS> H$s H$s‘V Ý¶yZV‘ g‘W©Z ‘yë¶ Ho$ ñVa go H$‘ hmo OmVr h¡ dhm± 1 AŠQy>~a, 2018 go Ý¶yZV‘ g‘W©Z ‘yë¶ Ho$ n[aMmbZ Ho$ A§VJ©V àm{á ewê$ H$s h¡ &

àM{bV Xoer d A§VaXoer¶ ‘mH}$Q> n[aÑí¶ ‘| ‘mH}$Q> eo¶a ~‹T>mZo Ho$ CÔoí¶ go H$nmg ‘m¡g‘ 2018-19 Ho$ Xm¡amZ {ZJ‘ Ûmam ‘mÌm AmYm[aV aUZr{V AnZmB© JB© VWm E‘Egnr n[aMmbZ Ho$ gmW gmW {ZJ‘ Zo Ohm° H$ht ^r g§^d hþAm V¡¶ma Jm±R>m| H$s IarXr Ho$ gmW dm{UpÁ¶H$ IarXr H$aZm Ama§^ {H$¶m Vm{H$ emImAm| Ûma E‘Egnr g§aMZm H$m Cn¶moJ H$aVo hþE Hw$N> D$nar

21


^m.H$.{Z.

C.C.I.

simultaneous purchase under commercial operation wherever viable in the branches so as to utilize the part of MSP infrastructure and to recover part of overhead expenses. During financial year 2018-19, the Corporation was able to procure 11.03 lakh bales (10.78 lakh bales under MSP + 0.25 lakh bales under Commercial Operation).

5.3 During the year under review, your Corporation has liquidated around 0.14 lakh bales up to 31st

March, 2019 of crop year 2018-19 to domestic textile industry including MSMEs to cover their daily requirement of quality cotton. As on 24th

June, 2019, the Corporation has liquidated total 1.43 lakh bales.

5.4 As a part of measures to boost cotton trade, the Government of India has liberalized raw cotton exports from the country and the same is under Open General License (OGL). Your Corporation has continued efforts by holding trade talks with major importing countries viz, Vietnam, Thailand, China, Bangladesh, Pakistan etc. to explore export possibilities.

6. INTERNATIONAL COTTON SITuATION

6.1 As per International Cotton Advisory Committee (ICAC) Journal “Cotton This Month” dated 3rd

June 2019, the world cotton acreage in 2018-19 is expected to be 32.88 million hectares as against 33.07 million hectares in previous year. The world average yield in 2018-19 is projected at 783 kgs/hectare as against 806 kgs/hectare in 2017-18.

• World cotton production has decreased by 3% to 25.75 million metric tons as against 26.66 million metric tons in 2017-18. Production is reduced in major cotton growing Countries viz, India, USA, Australia, Pakistan etc. due to lack of water availability, drought and reduced planted area.

IM© H$mo dgyb {H$¶m Om gHo$ & {OgHo$ n[aUm‘ñdê$n {ZJ‘ Zo dm{UpÁ¶H$ IarXr n[aMmbZ Ho$ A§VJ©V H$nmg IarXr Ûmam ‘mH}$Q> ‘| àdoe {H$¶m {Oggo H$nmg ‘yë¶ pñWa aho VWm g‘W©Z ‘yë¶ ñVa go D$na CR>o {OgHo$ n[aUm‘ñdê$n {H$gmZm| H$mo bm^ àmá hþAm& Mmby H$nmg ‘m¡g‘ 2018-19 Ho$ Xm¡amZ {ZJ‘ 11.03 bmI Jm±R>o IarX H$aZo ‘| g‘W© hþAm (E‘Egnr Ho$ A§VJ©V 10.78 bmI Jm±R>| d dm{UpÁ¶H$ IarXr n[aMmbZ Ho$ A§VJ©V +0.25 bmI Jm±R>o)

5.3 g‘rjmYrZ df© Ho$ Xm¡amZ AmnHo$ {ZJ‘ Zo E‘EgE‘B©

H$mo em{‘b H$aHo$ Xoer dó CÚmoJ H$mo JwUdÎmmdmbr éB©

H$s X¡{ZH$ Amdí¶H$Vm H$mo nyU© H$aZo Ho$ {bE 31 ‘mM©,

2019 Ho$ ’$gb df© 2018-19 VH$ bJ^J 0.14

bmI Jm§R>m| H$m n[ag‘mnZ {H$¶m & {X. 24 OyZ, 2019

H$mo {ZJ‘ Zo Hw$b 1.43 bmI Jm±R>m| H$m n[ag‘mnZ {H$¶m&

5.4 H$m°Q>Z Q´>oS> H$mo ~T>mdm XoZo Ho$ BamXo go ^maV gaH$ma Zo

Xoe go H$ƒo H$nmg Ho$ {Z¶m©V Ho$ {bE CXmarH$aU {H$¶m

VWm Cgo AmoOrEb Ho$ AYrZ aIm & AmnHo$ {ZJ‘ Zo

‘w»¶ Am¶mV H$aZo dmbo Xoem| O¡go {d¶VZm‘, WmBb¢S>,

MrZ, ~§JbmXoe, nm{H$ñVmZ BË¶m{X Xoem| go {Z¶m©V H$s

g§^mdZmE°§ ImoOZo Ho$ {bE ì¶mnm[aH$ ~mVMrV Ûmam à¶mg

Omar aI| h¡ &

6. A§Vaamï´>r¶ H$nmg pñW{V :

6.1 A§Vaamï´>r¶ H$m°Q>Z gbmhH$ma g{‘{V (AmB©grEgr) OZ©b,

H$m°Q>Z {Xg ‘§W {XZm§H$ 03 OwZ, 2019 Ho$ AZwgma df©

2018-19 ‘| {dœ H$nmg joÌ’$b {nN>bo df© 33.07

{‘{b¶Z h¡ŠQ>g© Ho$ gm‘Zo AZw‘m{ZV 32.88 {‘{b¶Z

h¡ŠQ>a ahm & df© 2018-19 Ho$ {bE {dœ Am¡gV CËnmXZ

JV df© 2017-18 ‘| 806 {H$bmo/h¡ŠQ>a H$s VwbZm ‘|

783 {H$bmo/h¡ŠQ>g© àjo{nV {H$¶m J¶m &

· {dœ H$nmg CËnmXZ ‘| JV df© ¶m{Z 2017-

18 ‘| 26.66 {‘{b¶Z Q>Ýg Ho$ gm‘Zo 25.75

{‘{b¶Z Q>Ýg ¶m{Z bJ^J 3% KQ>m¡{V hþB© &

H$nmg CJmZo dmbo Xoe O¡go ^maV, g§¶wº$ amÁ¶

A‘o[aH$m, Am°ñQ´>o{b¶m, nm{H$ñVmZ Am{X ‘| nmZr H$s

CnbãKVm H$s H$‘r, gyIo Am¡a H$‘ amo{nV joÌ Ho$

H$maU CËnmXZ H$s H$‘r XO© H$s JB© &

22

^m.H$.{Z.

C.C.I.


• World cotton consumption is projected to increase marginally by around 1% to 26.66 million metric tons as against 26.35 million tons in 2017-18.

• World trade is projected to increase by around 5% to 9.45 million tons as compared to 9.01 million metric tons during 2017-18.

- USA is expected to remain the largest exporter of cotton accounting for 3.21 million metric tons i.e. 34% of world expected shipments and Bangladesh is expected to remain the largest importer with import of 1.65 million metric tons of cotton accounting for 17% of world import of 9.45 million metric tons.

• World beginning stocks for current year was 18.77 million metric tons. As consumption is projected to exceed production in 2018-19, global ending stock level is expected to decrease from 18.77 million metric tons to 17.85 million metric tons by the end of this season.

• As China’s ending stocks are projected to be lower by 6% at 8.50 million metric tons as against 9.03 million metric tons in 2017-18, stocks held by the rest of the world have reduced by 4% to about 9.35 million metric tons.

· {dœ H$nmg Cn^moJ JV df© 2017-18 ‘| 26.35 {‘{b¶Z Q>Ýg H$s VwbZm ‘| 1% d¥{Õ Ho$ gmW 26.66 {‘{b¶Z Q>Ýg VH$ nhþ±MZo H$m AZw‘mZ {H$¶m J¶m h¡ &

· {dœ ì¶mnma ‘| df© 2017-18 Ho$ Xm¡amZ 9.01 {‘{b¶Z ‘¡{Q´>H$ Q>Ýg H$s VwbZm ‘| bJ^J 5% d¥{Õ Ho$ gmW 9.45 {‘{b¶Z Q>Ýg VH$ AZw‘m{ZV h¡ &

- g§¶wº$ amï´> A‘o[aH$m (¶yEgE) go 3.21 {‘{b¶Z ‘o{Q´>H$ Q>Ýg ¶m{Z 34% {dœ Ho$ Ano{jV {en‘|Q> Ho$ {bE éB© Ho$ boIm§H$Z H$m g~go ~‹S>m {Z¶m©VH$ ~Zo ahZo H$s Cå‘rX h¡, Am¡a ~m§½bmXoe go 1.65 {‘{b¶Z ‘o{Q´>H$ Q>Ýg ¶m{Z éB© Ho$ {dœ Ho$ 9.45 {‘{b¶Z Am¶mV Ho$ 17% Am¶mV Ho$ gmW ~‹S>m Am¶mVH$ ~Zo ahZo H$s Cå‘rX h¡ &

· dV©‘mZ df© Ho$ {bE {dœ H$m Ama§{^H$ ñQ>m°H$ 18.77 {‘{b¶Z ‘¡{Q´>H$ Q>Z Wm & My§{H$ InV 2018-19 ‘| CËnmXZ H$mo nma H$aZo H$m AZw‘mZ h¡, {dœ H$m A§{V‘ ñQ>m°H$ ñVa Bg grOZ Ho$ A§V VH$ 18.77 {‘{b¶Z ‘¡{Q´>H$ Q>Z go KQ>H$a 17.85 {‘{b¶Z ‘¡{Q´>H$ Q>Z hmoZo H$s Cå‘rX h¡ &

· MrZ H$m A§{V‘ ñQ>m°H$ 2017-18 ‘| 9.03 {‘{b¶Z ‘o{Q´>H$ Q>Z Ho$ g‘j 6% H$s {JamdQ> Ho$ gmW 8.50 {‘{b¶Z ‘o{Q´>H$ Q>Z AZw‘m{ZV {H$¶m J¶m & {dœ Ho$ eof Xoem| H$m ñQ>m°H$ 4% go KQ>H$a bJ^J 9.35 {‘{b¶Z ‘o{Q´>H$ Q>Z ahm &

23


^m.H$.{Z.

C.C.I.

• International Cotton balance sheet for the last three years are as under:

(Quantity in Million MT)

Particulars 2016-17 2017-18 2018-19*World beginning stock 20.30 18.48 18.76

World production 23.07 26.66 25.75

World consumption 24.78 26.35 26.66

Exports 8.19 9.04 9.45Imports 8.08 9.01 9.45World ending stocks 18.48 18.76 17.85

Source: ICAC-“Cotton this month” dated 3rd June, 2019* Projected

6.2 INTERNATIONAL PRICE TREND:-

International cotton season starts from 1st August and ends on 31stJuly. The opening International cotton prices, as measured by Cotlook A were ruling at 99.50 US C/lb (equivalent to Rs.53500/- per candy). It decreased to the level of 87.20 US C/lb (equivalent to Rs.50000 per candy) at the end of September 2018.

During October to December 2018, Cotlook A was ruling in the range of 80 USC/lb to 89 US C/lb (equivalent to Rs.44200 per candy to Rs.51600 per candy) and in the month of January-February 2019, the same was ruling in the range of 79 US C/lb to 84 US C/lb (equivalent to Rs. 43800 per candy to Rs.46700 per candy).

During the month of March-April 2019, Cotlook A was ruling in the range of 86.00 US C/lb to 89.00 US C/lb (equivalent to Rs.50,000/- per candy to Rs.52,000 per candy). The opening price of Cotlook A i.e; 99.50 US C/lb (equivalent to Rs.53,500/- per candy) is the highest level for Cotlook A so far in cotton season 2018-19.

· VrZ dfm] Ho$ {bE A§Vaamï´>r¶ H$m°Q>Z VwbZ nÌ Ho$ ã¶m¡ao ZrMo {XE AZwgma h¡ :

(‘mÌm {‘{b¶Z ‘o{Q´>H$ Q>Z ‘|)

{ddaU 2016-17 2017-18 2018-19*

{dœ H$m Ama§{^H$ ñQ>m°H$

20.30 18.48 18.76

{dœ CËnmXZ 23.07 26.66 25.75

{dœ Cn^moJ24.78 26.35 26.66

{Z¶m©V 8.19 9.04 9.45

Am¶mV 8.08 9.01 9.45

{dœ H$m A§{V‘ ñQ>m°H$

18.48 18.76 17.85

òmoV: Am¶grEgr - H$m°Q>Z {Xg ‘mh, 3 OyZ, 2019*

àjo{nV

6.2 A§Vaamï´>r¶ ‘yë¶ àd¥{Îm :-

A§Vaamï´>r¶ H$nmg ‘m¡g‘ 01 AJñV go ewê$ hmoH$a 31

OwbmB© H$mo IË‘ hmoVm h¡, H$m°Q>bwH$ E Ho$ AZwgma ê$B© H$s

H$s‘V| 99.50 ¶yEggr/Eb~r (53500/- à{V H¢$S>r

Ho$ g‘Vwë¶) Mb ahr Wr, Omo {gV§~a, 2018 Ho$ A§V

VH$ KQ>H$a 87.20 ¶yEggr/Eb~r (50000/- à{V

H¢$S>r g‘Vwë¶) Am J¶r &

H$m°Q>bwH$ E Ho$ AZwgma AŠQy>~a go {Xg§~a, 2018 Ho$

Xm¡amZ ê$B© H$s H$s‘V| 80 ¶yEggr/Eb~r (44200/-

à{V H¢$S>r go 51600/- à{V H¢$S>r Ho$ g‘Vwë¶) Wr,

Am¡a OZdar-’$adar, 2019 Ho$ Xm¡amZ ¶h 79 ¶yEggr/

Eb~r go 84 ¶yEggr/Eb~r (43800/- à{V H¢$S>r go

46700/- à{V H¢$S>r Ho$ g‘Vwë¶) Mb ahr h¡ &

H$m°Q>bwH$ E Ho$ AZwgma ‘mM© go Aà¡b, 2018 Ho$ Xm¡amZ ê$B©

H$s H$s‘V| 86.00 ¶yEggr/Eb~r go 89.00 ¶yEggr/

Eb~r (50,000/- à{V H¢$S>r go 52,000/- à{V

H¢$S>r Ho$ g‘Vwë¶) Wr, H$m°Q>bwH$ E Ho$ AZwgma Ama§{^H$

H$s‘V| Omo 99.50 ¶yEggr/Eb~r (53,500/- à{V

H¢$S>r Ho$ g‘Vwë¶) ’$gb grOZ 2018-19 Ho$ Xm¡amZ

H$m°Q>bwH$ E Ho$ CƒV‘ ñVa na Wr &

24

^m.H$.{Z.

C.C.I.


It started decreasing from 2nd week of May 2019 due to trade disputes between USA and China. Currently, Cotlook A is ruling in the range of 76.50 US C/lb (equivalent to Rs.41,700/- per candy) to 77.00 USC/lb (equivalent to Rs.42,000/- per candy).

As per ICAC price projection, Cotlook A Index may remain in the range of 84-91 USC/lb in 2018-19, mid-point being 87 USC/lb (equivalent to Rs.47,450/- per candy).

Month-wise, year-wise average Cotlook A for last two years and current year is given as follows:

Cotlook A in uS Cents per lbmonth 2016-17 2017-18 2018-19

August 80.04 79.31 94.55September 78.00 80.56 90.36October 78.52 78.68 86.80November 78.92 80.39 86.78December 79.46 85.58 86.00January 82.15 90.91 82.35February 85.13 88.27 81.15March 86.75 92.07 83.74April 86.87 92.13 87.30May 88.63 94.45 80.14June 84.76 97.71 77.87*July 84.09 96.18Yearly Avg. 82.78 88.02

Source : Cotlook*upto 24thJune 2019

7. WAREhOuSING COmPLEX :

Your Corporation is having warehousing complex at Kalamboli constructed for storage of bales meant for export purpose. During the year under review, looking to the opportunities for export of cotton by the Corporation from Navi Mumbai ports, some storage capacity has been kept for export purpose and for balance capacity, Kalamboli branch made all out efforts to lease out the same for commercial utilization at competitive rates and has generated revenue of Rs.2.62 crores during the year.

g§¶wº$ amÁ¶ A‘o[aH$m Am¡a MrZ Ho$ ~rM ì¶mnm[aH$ {ddmX Ho$ H$maU ¶h H$s‘Vo ‘B© 2019 Ho$ Xÿgao gámh go H$‘ hmoZm ewê$ hmo JB©, H$m°Q>bwH$ E Ho$ AZwgma Ama§{^H$ H$s‘V| Omo 76.50 ¶yEggr/Eb~r (41,700/- à{V H¢$S>r Ho$ g‘Vwë¶) go 77.00 ¶yEggr/Eb~r (42000/- à{V H¢$S>r Ho$ g‘Vwë¶) Am JB© &

AmBgrEgr Ho$ H$s‘V AZw‘mZ Ho$ AZwgma ‘rS>nm°B§Q> 87 ¶yEggr/Eb~r (47,450/- à{V H¢$S>r Ho$ g‘Vwë¶) hmoZo Ho$ H$maU 2018-19 ‘| H$m°Q> E gyMH$m§H$ Ho$ AZwgma 84-91 ¶yEggr/Eb~r ah gH$Vm h¡ &

{nN>bo Xmo dfm] VWm Mmby df© Ho$ {bE ‘mhdma, df©dma Am¡gV

H$m°Q>bwH$ E ZrMo {XE AZwgma h¡ :

¶yEg goÝQ²g à{V Eb~r ‘|

‘mh 2016-17 2017-18 2018-19

AJñV 80.04 79.31 94.55

{gV§~a 78.00 80.56 90.36

A³Qy>~a 78.52 78.68 86.80

Zd§~a 78.92 80.39 86.78

{Xg§~a 79.46 85.58 86.00

OZdar 82.15 90.91 82.35

’$adar 85.13 88.27 81.15

‘mM© 86.75 92.07 83.74

Aà¡b 86.87 92.13 87.30

‘B© 88.63 94.45 80.14

OyZ 84.76 97.71 77.87*

OwbmB© 84.09 96.18

df© Am¡gV 82.78 88.02

òmoV : H$m°Q>bwH$* 24 OyZ 2019 VH$

7. ^§S>maUJ¥h n[aga :

AmnHo$ {ZJ‘ Ho$ nmg {Z¶m©V à¶moOZ Ho$ {bE Jm±R>m| Ho$

^§S>maU hoVw H$b§~mobr ‘| {Z{‘©V EH$ ^§S>maU J¥h n[aga

h¡ & g‘rjmJV df© Ho$ Xm¡amZ {ZJ‘ Ûmam Zdr ‘w§~B© pñWV

nmoQ>© go ê$B© Ho$ {Z¶m©V H$mo XoIVo hþE EH$ JmoXm‘ H$s

^§S>maU j‘Vm H$mo, {Og‘| Xmo H§$nmQ>©‘oÝQ> h¡, {Z¶m©V

à¶moOZ Ho$ {bE A{^{MpÝhV H$a {X¶m h¡ & O~{H$ eof

j‘Vm à{VñnYu Xam| na dm{UpÁ¶H$ Cn¶moJ na brO na

XoZo Ho$ {bE à¶mg {H$E h¡ VWm 2.62 H$amo‹S> ê$. VH$

amOñd A{O©V {H$¶m h¡ &

25


^m.H$.{Z.

C.C.I.

The warehousing complex is consisting of railway siding, open plot and covered area. The railway siding was not in operation for more than a decade. To augment the revenue and in order to increase utilization and revenues, the Corporation has given the complex on operation, maintenance & management basis to M/s. UltraTech cement Ltd. w.e.f. 9th May 2019 after following the open tender process. This will initially generate additional revenue to the tune of Rs.7.70 crore per annum to the Corporation.

8. CORPORATE SOCIAL RESPONSIBILITY (CSR)

Your Corporation has undertaken following activities under CSR and spend total Rs.37.79 lakhs during F.Y. 2018-19 on the following activities:

• Promoting sanitation & preventive health care under Swachh Bharat Mission by:

- Contribution of Rs.1.00 lakhs to Swachh Bharat Kosh.

- Rs.12.00 lakhs for construction of Girls Toilets with running water facility in Government schools in close vicinity of cotton market yards.

• Promoting health care including preventive health care by spending Rs.16.51 lakh to empower the cotton farmers with appropriate technology & tools of preventive health measures by distributing 212 nos. hand-held kapas plucker machine in seven Aspirational Districts viz, Asifabad, & Bhooplapalli in the state of Telangana, Raichur & Yadgir in the state of Karnataka, Rayagada, Kalahandi & Balangir in the state of Odisha.

• Promoting education under joy of giving by spending Rs.4.03 lakh to provide desktop computer along with UPS and Printer to Govt. schools in four Aspirational Districts

^§S>maUJ¥h n[aga ‘| aobdo gmBqS>J Imbr ßbm°Q> Am¡a ‹T>H$m

hþAm joÌ em{‘b h¡ & dhm± na EH$ XeH$ go Á¶mXm g‘¶

go aobdo gmBqS>J àMbZ ‘| Zht h¡ g§gmYZm| H$m Cn¶moJ

Ed§ amOñd ‘| d¥{Õ H$aZo hoVw {ZJ‘ Zo ^§S>maU n[aga

H$s Cn¶mo{JVm d amOñd ‘| d¥{Õ H$aZo Ho$ {bE {ZJ‘

n[aMmbZ, aIaImd Ed§ à~§YZ Ho$ AmYma na {Z{dXm

H$s à{H«$¶m H$mo nyam H$aVo hþE ‘ogg© AëQ´>m Q>oH$ {g‘|Q>

{b{‘Q>oS> H$mo 09 ‘B©, 2019 go {X¶m h¡ & {OgHo$ H$maU

{ZJ‘ H$mo àma§{^H$ Vm¡a na dm{f©H$ 7.70 H$amo‹S> ê$. go

A{V[aº$ H$m amOñd A{O©V hmoJm &

8. {ZJ{‘V gm‘m{OH$ Xm{¶Ëd (grEgAma)

AmnHo$ {ZJ‘ Zo {dÎmr¶ df© 2018-19 Ho$ Xm¡amZ

grEgAma Ho$ A§VJ©V {ZåZ{bpIV J{V{d{Y¶m± H$s VWm

37.79 bmI ê$. ì¶¶ {H$¶m :

· ñdÀN> maV {‘eZ Ho$ VhV ñdÀN>Vm Am¡a {ZdmaH$ ñdmñÏ¶ XoI^mb H$mo ~‹T>mdm XoZm :

- ñdÀN> ^maV H$moe ‘| 1.00 bmI ê$. H$m

A§eXmZ {X¶m h¡ &

- H$m°Q>Z ‘mH}$Q> ¶mS>© Ho$ g{‘n pñWV gaH$mar nmR>embmAm| ‘| aqZJ dm°Q>a H$s gw{dYm g{hV ~m{bH$mAmo Ho$ {bE em¡Mmb¶ H$m {Z‘m©U H$admZo hoVw 12.00 bmI ê$. ì¶¶ {H$¶m &

· {ZdmaH$ ñdmñÏ¶ XoI^mb g{hV ñdmñÏ¶ XoI^mb

H$mo ~‹T>mdm XoZo hoVw H$nmg {H$gmZm| H$mo 16.51 bmI

ê$n¶o IM© H$aHo$ àm¡Úmo{JH$s Am¡a ñdmñÏ¶ {ZdmaH$

Cnm¶m| Ho$ CnH$aU Ho$ A§VJ©V 212 h¢S> ßbH$a

‘erZ| gmV AmH$m§jmË‘H$ {Obm| O¡go Vob§JmZm amÁ¶

‘| Am{g’$m~mX Am¡a ^ynmbn„r, H$Zm©Q>H$m amÁ¶

‘| am¶Mya Am¡a ¶mXJra Amo{‹S>gm amÁ¶ ‘| am¶J‹S>m,

H$mbmh§S>r Am¡a ~mbm§Jra ‘| {dV[aV H$s JB© &

· àmoÞ{V {ejm H$mo ~T>mdm XoZo Ho$ CÔoí¶ go é. 4.03

bmI IM© H$aHo$ Vob§JmZm amÁ¶ ‘| Am{g’$m~mX

E§S> ^ynbmn{„Z VWm H$Zm©Q>H$ amÁ¶ ‘| am¶Mya E§S>

¶mXJra 4 AmH$m§jr {Obm| ‘| gaH$mar nmR>embmAm|

26

^m.H$.{Z.

C.C.I.


viz, Asifabad, & Bhooplapalli in the state of Telangana, Raichur & Yadgir in the state of Karnataka.

• Promoting Preventive health care and environmental sustainability by:

- Contribution of Rs.2.25 lakh to Clean Ganga Fund.

- Contribution of Rs.1.00 lakh for environmental sustainability under the jurisdiction of CCI Branch office Coimbatore by tree plantation in the Anna University, Coimbatore campus.

• Contribution of Rs.1.00 lakh in Armed Forces Flag Day Fund for the benefit of armed forces veteran, war widows and the dependents.

9. humAN RESOuRCE DEVELOPmENT :

The total strength of your Corporation during the year under report was 737 as on 31st March 2019 consisting of 90 officers and 647 unionized staff as compared to the total strength of 787 employees during the last year. Out of the total strength of 737 employees, there are women employees comprising 15 women officers and 72 of unionized staff. Your Corporation continued to follow the policy guidelines of the Govt. of India in respect of the reservation of SC/ST/OBC/PH categories both in recruitment as well as promotion. As on 31st March 2019, out of the total strength, the strength of SC employees is 157 (21.30%), ST employees is 27 (3.66%), OBC employees is 149 (20.21%) and PwD employees is 18 (2.44%). The liaison officer for SC/ST/OBC/PH continued to function to safeguard the interest of SC/ST/OBC/PH employees of our Corporation. During the period under review your Corporation had appointed one Junior Assistant under compassionate ground. Your Corporation effected rotational transfer of field staff and officers periodically.

Your Corporation is observing the provisions of implementation of the Persons with Disabilities

‘| S>oŠgQ>mn H§$ß¶yQ>a Ho$ gmW ¶ynrEg VWm qàQ>a

àXmZ {H$E &

· n¶m©daUr¶ pñWaVm Ûmam {ZdmaH$ ñdmñÏ¶ XoI^mb H$mo ~T>mdm XoZo hoVw :

- ñdÀN> J§Jm {Z{Y ‘| 2.25 bmI ê$. H$m A§eXmZ

{X¶m h¡ &

- grgrAmB© Ho$ H$mo¶å~Vya emIm Ho$ joÌm{YH$ma

‘| n¶m©daU pñWaVm Ho$ {bE AÞm {dœ{dÚmb¶

H¢$ng ‘| d¥jmamonU hoVw 1.00 bmI ê$. H$m

A§eXmZ {H$¶m J¶m &

· geó g¡Ý¶ ~b Ho$ g¡{ZH$ ¶wÕ ‘| hþB© {dYdmAm| VWm CZHo$ Am{lVm| Ho$ {hVm| Ho$ {bE geó ~b ÜdO {Xdg {Z{Y ‘| 1.00 bmI ê$. H$m A§eXmZ {X¶m &

9. ‘mZd g§gmYZ {dH$mg :

[anmoQ>© Ho$ AYrZ df© ‘| AmnHo$ {ZJ‘ ‘| H$‘©Mm[a¶m| H$s Hw$b g§»¶m 31 ‘mM©, 2019 H$mo 737 Wr, {Og‘| 90 A{YH$mar VWm 647 ¶y{Z¶ZAmB©ÁS> H$‘©Mmar em{‘b h¡, O~{H$ {nN>bo df© Hw$b g§»¶m 787 Wr & 737 Hw$b H$‘©Mm[a¶m| ‘| go 15 ‘{hbm A{YH$mar, 72 ‘{hbm ¶y{Z¶Z H¡$S>a H$s h¡ & AmnH$m {ZJ‘ ^Vu Am¡a nXmoÞ{V XmoZm| Ho$ ‘m‘bm| ‘| AZw.Om./ AZw.O.Om./ AÝ¶ {nN>‹S>o dJ©/em.{d. Ho$ AmajU Ho$ ~mao ‘| ^maV gaH$ma Ho$ Zr{V ‘mJ©Xe©Z H$m AZwnmbZ H$a ahm h¡ & {X. 31.3.2019 H$mo Hw$b H$‘©Mm[a¶m| ‘| go AZw.Om. Ho$ 157 (21.30%) H$‘©Mmar, AZw. OZ.Om. Ho$ 27 (3.66%) H$‘©Mmar VWm AÝ¶ {nN>‹S>o dJ© Ho$ 149(20.21%) VWm nrS>ãë¶yS>r Ho$ 18 (2.44%) h¡ & AZw.Om./AZw.O.Om./AÝ¶ {nN>‹S>o dJ©/em.{d. Ho$ {bE g§nH©$ A{YH$mar AmnHo$ {ZJ‘ Ho$ AZw.Om./ AZw.O.Om./AÝ¶ {nN>‹S>o dJ©/ em.{d.Ho$ H$‘©Mm[a¶m| Ho$ {hV H$s ajm Ho$ {bE à~§YZ H$mo ghm¶Vm XoVo aho h¡ & g‘rjmYrZ Ad{Y ‘| AmnHo$ {ZJ‘ Zo 1 H${Zð> ghm¶H$ H$s AZwH§$nm Ho$ AmYma na {Z¶w{º$ H$s h¡& AmnHo$ {ZJ‘ Zo ’$sëS> H$‘©Mm[a¶m| VWm A{YH$m[a¶m| Ho$ amoQ>oeZb ñWmZm§VaU ^r {H$¶o h¢ &

AmnH$m {ZJ‘ {dH$bm§JVm A{Y{Z¶‘ 1995 Ho$ H$m¶m©Ýd¶Z

Ho$ àmdYmZ {deofV: {dH$bm§J ì¶{º$¶m| Ho$ {bE [a{º$¶m| Ho$

27


^m.H$.{Z.

C.C.I.

Act 1995, especially on implementation of Section 33 of reservation of vacancies for persons with disabilities. As the work of your Corporation involves a field operation–which requires a lot of physical exertion–the scope for employment of physically handicapped person is extremely limited. Despite such limitation your Corporation has presently strength of 18 physically handicapped persons.

The Scheme for workers participation in the Management introduced by your Corporation since 1975-76 continues to function smoothly, both at the corporate level and at the branches. The industrial relation in your Corporation continued to remain very cordial and there was no loss of man-days.

10. RIGhT TO INFORmATION ACT, 2005:

In accordance with the instructions received from the Ministry of Textiles, Government of India, New Delhi, based on the guidelines issued by the Ministry of Personnel, Public Grievances and Pensions, your Corporation has taken action regarding compilation/ publishing of manuals, appointments of Central Assistant Public Information Officers, framing the rules for giving effect to the provisions of the Act and internal procedures to streamline the channel for dealing with requests received by each Central Public Information Officer.

The Quarterly Report of RTI is uploaded regularly on the website of the Corporation and also uploaded on the website of Central Information Commission (CIC) as instructed by the Ministry of Textiles vide its letter dated 8th

June, 2011.

11. ChANGES IN ThE NATuRE OF BuSINESS :

There is no change in the nature of business in the year 2018-19, as compare to previous year.

AmajU H$s Ymam 33 Ho$ H$m¶m©Ýd¶Z H$m AZwnmbZ H$a

ahm h¡ & My§{H$ AmnHo$ {ZJ‘ Ho$ H$m¶©-H$bmnm| ‘| ’$sëS>

H$m¶©-H$bmn em{‘b h¢, {Og‘| emar[aH$ j‘Vm H$s ~hþV

Amdí¶H$Vm hmoVr h¡, emar[aH$ {dH$bm§J ì¶{º$¶m| Ho$ {bE

{Z¶w{º$ H$m joÌ ~hþV hr gr{‘V hmo OmVm h¡ & Bg àH$ma

H$s gr‘mAm| Ho$ ~mdOyX AmnHo$ {ZJ‘ ‘| dV©‘mZ ‘| 18

emar[aH$ {dH$bm§J ì¶{º$ H$m¶©aV h¢ &

AmnHo$ {ZJ‘ Ûmam df©, 1975-76 ‘| Ama§^ H$s JB©

à~§YZ ì¶dñWm ‘| H$‘©Mm[a¶m| H$s gh^m{JVm ¶moOZm

{ZJ{‘V Am¡a emIm XmoZm| ñVam| na ghO ê$n go Mb ahr

h¡ & {ZJ‘ ‘| Am¡Úmo{JH$ g§~§Y gm¡hmX©nyU© aho Am¡a {H$gr

‘mZd {Xdg H$s hm{Z Zht hþB© h¡ &

10. gyMZm A{YH$ma A{Y{Z¶‘, 2005 :

H$m{‘©H$, bmoH$ {eH$m¶V VWm noÝeZ ‘§Ìmb¶ Ûmam Omar

‘mJ©Xe©Zm| Ho$ AmYma na dó ‘§Ìmb¶, ^maV gaH$ma, ZB©

{X„r go àmá AZwXoem| Ho$ AZwgma AmnHo$ {ZJ‘ Zo ‘¡Ý¶wAb

g§J«hU/àH$meZ, Ho$ÝÐr¶ gmd©O{ZH$ gyMZm A{YH$mar

Am¡a Ho$ÝÐr¶ ghm. gmd©O{ZH$ gyMZm A{YH$m[a¶m| H$s

{Z¶w{º$, A{Y{Z¶‘ Ho$ àmdYmZm| H$mo bmJy H$aZo Ho$

{bE {Z¶‘ V¡¶ma H$aZo VWm àË¶oH$ bmoH$ àm{YH$mar go

àmá AZwamoYm| na H$ma©dmB© Ho$ {bE Am§V[aH$ nÜX{V H$mo

ñQ´>r‘bmB©Z H$aZo Ho$ ~mao ‘| H$ma©dmB© H$s h¡&

gyMZm A{YH$ma A{Y{Z¶‘ H$s {V‘mhr [anmoQ>© H$mo dó

‘§Ìmb¶ Ho$ {X. 08 OyZ, 2011 Ho$ nÌ Ho$ {ZXoe Ho$

AZwgma {ZJ‘ H$s do~gmB©Q> Ho$ gmW-gmW Ho$ÝÐr¶ gyMZm

Am¶moJ (grAmB©gr) H$s do~gmB©Q> na {Z¶{‘V ê$n go

AnbmoS> H$s OmVr h¡ &

11. ì¶mnma H$s àH¥${V ‘| n[adV©Z :

{nN>bo df© H$s VwbZm ‘| df© 2018 - 19 ‘| ì¶mnma H$s àH¥${V ‘| H$moB© ~Xbmd Zht hþAm h¡ &

28

^m.H$.{Z.

C.C.I.


12. PARTICuLARS OF LOANS, GuARANTEES OR INVESTmENTS mADE uNDER SECTION 186 OF ThE COmPANIES ACT:

No loan, guarantees or investments are made by the Corporation under Section 186 of the Companies Act, 2013 during the year 2018-19.

13. PARTICuLARS OF CONTRACTS OR ARRANGEmENTS mADE WITh RELATED PARTIES:

No contract or arrangements are made with related parties as defined under Section 188 of the Companies Act, 2013 during the year 2018-19.

14. STATEmENTS ON SuBSIDIARIES, JOINT VENTuRES AND ASSOCIATES COmPANIES:

The Corporation does not have any subsidiaries, joint ventures or associate companies during the year 2018-19 and hence no statement is required.

15. DEPOSITS:

The Company has neither accepted nor renewed any deposits during the year.

16. PARTICuLARS OF EmPLOYEES:

The particulars of covered employees in pursuance of Section 134 of the Companies Act, 2013 read with Companies (Appointment & Remuneration of Managerial Personnel) Rules, 2014 are “NIL”.

17. PARTICuLARS OF CONSERVATION OF ENERGY TEChNOLOGY ABSORPTION & FOREIGN EXChANGE EARNINGS AND OuTGO.

The Corporation has already installed Roof Top Grid Connected Solar Power Plant with capacity of around 15 KW at Corporate office. The solar generation is being utilized by the office itself. This has resulted into saving of Rs.2.00 lakh per annum.

12. H§$nZr Ho$ A{Y{Z¶‘ H$s Ymam 186 Ho$ VhV {H$E JE F$U, Jma§Q>r ¶m {Zdoe Ho$ {ddaU :

{ZJ‘ Ûmam df© 2018-19 Ho$ Xm¡amZ H§$nZr A{Y{Z¶‘, 2013 H$s Ymam 186 Ho$ VhV H§$nZr Ûmam H$moB© F$U Jma§Q>r ¶m {Zdoe Zht {H$¶m OmVm h¡ &

13. g§~§{YV njm| Ho$ gmW {H$E JE AZw~§Y ¶m ì¶dñWm Ho$ {ddaU

df© 2018-19 Ho$ Xm¡amZ H§$nZr A{Y{Z¶‘, 2013 H$s Ymam 188 Ho$ VhV g§~§{YV njm| Ho$ gmW H$moB© AZw~§Y ¶m ì¶dñWm Zht H$s JB© h¡ Am¡a Bg{bE {H$gr ^r ~¶mZ H$s Amdí¶H$Vm Zht h¡ &

14. ghm¶H$ H§$n{Z¶m|, g§¶wº$ CÚ‘m| Am¡a gh¶moJr H§$n{Z¶m| na ~¶mZ

{ZJ‘ Ho$ nmg df© 2018-19 Ho$ Xm¡amZ H$moB© ghm¶H$,

g§¶wº$ CÚ‘ ¶m gh¶moJr H§$nZr¶m± Zht h¢ Am¡a Bg{bE

{H$gr ^r {ddaU H$s Amdí¶H$Vm Zht h¡ &

15. O‘m

H§$nZr Zo df© Ho$ Xm¡amZ {H$gr ^r {S>nmo{OQ> H$mo Z Vmo ñdrH$ma {H$¶m h¡ Am¡a Z hr ZdrZrH¥$V {H$¶m h¡&

16. H$‘©Mm[a¶m| Ho$ {ddaU :

H§$nZr A{Y{Z¶‘, 2013 H$s Ymam 134 Ho$ AZwgaU

‘| H$da {H$E JE H$‘©Mm[a¶m| Ho$ {ddaU H$mo (à~§YH$s¶

ng©Zb H$m ‘yë¶m§H$Z Am¡a nm[al{‘H$) H§$nZr {Z¶‘,

2014 Ho$ gmW n‹T>m Om¶o, Omo {H$ "'eyÝ¶"' h¡ &

17. D$Om© àm¡Úmo{JH$s AdemofU Am¡a {dXoer ‘wÐm Am¶ Am¡a AmCQ>Jmo Ho$ g§ajU Ho$ g§ajH$ Ho$ {ddaU

{ZJ‘ Zo nhbo hr {ZJ{‘V H$m¶m©b¶ ‘| bJ^J 15

{H$bmodmQ> H$s j‘Vm Ho$ gmW ê$’$ Q>m°n {J«S> H$ZoŠQ>oS>

gmobma nmda ßbm§Q> ñWm{nV {H$¶m h¡ & Bggo à{V df©

2.00 bmI ê$n¶o H$s ~MV hþB© h¡ &

29


^m.H$.{Z.

C.C.I.

18. FOREIGN TOuR:

During the year under review Rs.7.66 lakh has been spent on foreign tour for the officials of your Corporation for visits to USA and Côte d'Ivoire on behalf of CCI as against Rs.1.73 lakhs in the previous year.

19. VIGILANCE SET-uP AND ACTIVITIES 2018-19:

19.1 The Vigilance Cell of the Corporation is headed by a Chief Vigilance Officer assisted by Dy. General Manager and Manager at the Head Office and Dy. General Manager/ Assistant General Managers in the Branches.

19.2 The Chief Vigilance Officer and other officials posted at Head Office/Branches conducted Surprise Checks/Inspections.

19.3. Complaints: The Vigilance cell in all received two complaints during the year. Seventeen complaints were brought forward from the previous year. Out of nineteen complaints, five cases were closed after investigation and balance fourteen cases are pending for investigation/final decision as on 31.03.2019.

19.4 Departmental Enquiries:

(i) Major Penalty Proceedings :

Four cases of major penalty proceedings were carried forward from previous year and eight cases instituted during the year 2018-19 were dealt with by the Vigilance Cell. During the year six cases were disposed off. Departmental proceedings/decision of Disciplinary Authority is in process in the remaining six cases as on 31.03.2019, hence, these six cases are carried forward for the next year.

(ii) Minor Penalty Proceedings :

Thirteen cases instituted during the year were dealt with by the Vigilance Cell. During the year nine cases were disposed off. Decision of Disciplinary Authority is in process on the remaining four cases as on

18. {dXoer Xm¡ao :

g‘rjmYrZ df© ‘| AmnHo$ {ZJ‘ Zo A{YH$m[a¶m| Ho$ {dXoe Xm¡ao na 7.66 bmI ê$ IM© {H$¶o, Omo g§¶wº$ amï´> A‘o[aH$m, Am¡a H$m°Q> S>rAmB©Amoao na Wo Omo {H$ JV df© 1.73 ê$. Wo &

19. gVH©$Vm g§aMZm VWm J{V{d{Y¶m± 2018-19 :

19.1 AmnHo$ {ZJ‘ Ho$ gVH©$Vm H$moð> Ho$ àYmZ, ‘w»¶ gVH©$Vm

A{YH$mar h¡ {OZHo$ gmW ‘w»¶mb¶ ‘| Cn ‘hm à~§YH$

VWm à~§YH$ ‘w»¶mb¶ ‘| Am¡a emIm H$m¶m©b¶m| ‘| Cn

‘hm à~§YH$/ghm¶H$ ‘hm à~§YH$ H$m¶©aV h¢ &

19.2 ‘w»¶ gVH©$Vm A{YH$mar VWm ‘w»¶mb¶/emImAm| ‘| V¡ZmV AÝ¶ A{YH$m[a¶m| Zo AmH$pñ‘H$ Om±M/{ZarjU {H$E &

19.3 {eH$m¶Vo : df© Ho$ Xm¡amZ gVH©$Vm gob ‘| 2 {eH$m¶V|

àmá hþB© & {nN>bo df© go 17 {eH$m¶V| AmJo bm¶r JB©&

31.03.19 H$mo 19 {eH$m¶Vm| ‘| go Om±M n‹S>Vmb Ho$

nümV 5 ‘m‘b| ~§X {H$E JE VWm 14 ‘m‘bo Om±M

n‹S>Vmb/A§{V‘ {ZU©¶ hoVw b§{~V h¢ &

19.4 {d^mJr¶ Om§M :

(i) ~‹S>o XÊS> H$s H$m¶©dm{h¶m± :

JV df© go ~‹S>o X§S> H$s H$ma©dmB© Ho$ 04 ‘m‘bo

AmJo bm¶o J¶o VWm df© 2018-19 Ho$ Xm¡amZ

gVH©$Vm H$moð> Ûmam 8 ‘m‘bo na H$ma©dmB© H$s

JB© & df© Ho$ Xm¡amZ 6 ‘m‘bo {ZnQ>mE JE & {X.

31.3.2019 H$mo eof 6 ‘m‘bm| ‘| {d^mJr¶

H$m¶©dmhr d AZwemg{ZH$ àm{YH$aU Ho$ {ZU©¶ H$s

H$ma©dmB© Omar h¡ & Bg{bE ¶h 6 ‘m‘bo AJbo df©

Ho$ {bE bmE JE &

(ii) N>moQ>o X§S> H$s H$m¶©dm{h¶m± :

gVH©$Vm H$moð> Ûmam 13 ‘m‘bo na H$ma©dmB© H$s

JB© & df© Ho$ Xm¡amZ 9 ‘m‘bo {ZnQ>mE JE & {X.

31.3.2019 H$mo eof 4 ‘m‘bm| ‘| {d^mJr¶

H$m¶©dmhr d AZwemg{ZH$ àm{YH$aU Ho$ {ZU©¶ H$s

30

^m.H$.{Z.

C.C.I.


31.03.2019, hence, these four cases are carried forward for the next year.

19.5. Suspension:

There is no suspension case pending as on 31.03.2019.

19.6. Cases detected by CBI:

Eleven cases registered by the CBI against twelve officials were carried forward from previous year. As on 31.03.2019, total eleven CBI cases against twelve officials were pending.

19.7. Preventive Vigilance and CVC Guidelines:

1. During the year “Dos and Don’ts Manual” for the employees of CCI with the help of other departments, as part of preventive vigilance activities and which will serve as a good ready reference for rules and regulations of the organization for them and help in effective and prompt discharge of their duties were circulated.

2. An online system for giving vigilance clearance is evolved with the help of IT for expeditious issue of vigilance clearance.

3. For further strengthening of Vigilance set-up and for safety and security of CCI’s stock, following actions were taken:-

i. Controlling / supervisory Officers were advised to enhance tours to Branch Office and its centers/godowns for improving the system by taking corrective steps wherever required.

ii. Branch/Centres were emphasized to do the procurement, processing, weighment etc. in fair and transparent manner and according to the CVC guidelines and H.O. instructions.

4. Procurement :

• Strict guidelines were issued for procurement through APMC/APMC declared yards only from farmers.

H$ma©dmB© Omar h¡ & Bg{bE ¶h 4 ‘m‘bo AJbo df©

Ho$ {bE bmE JE &

19.5 {Zb§~Z:

{X.31.03.2019 VH$ H$moB© {Zb§~ZmYrZ ‘m‘bm b§{~V (n|qS>J) Zht h¢ &

19.6 gr~rAmB© Ûmam ImoOo J¶o ‘m‘bo :

12 A{YH$m[a¶m| Ho$ {dê$Õ gr~rAmB© Ûmam 11 ‘m‘bo a{OñQ>S>© {H$E JE VWm JV df© go AmJo bmE JE & {XZm§H$ 31.03.2019 H$mo gr~rAmB© Ho$ nmg 12 A{YH$m[a¶m| Ho$ {dê$Õ 11 ‘m‘bo b§{~V h¡ &

19.7 {ZdmaH$ gVH©$Vm Am¡a Ho$.g.Am. Ho$ {Xem{ZX}e :

1. df© Ho$ Xm¡amZ {ZdmaH$ gVH©$Vm J{V{d{Y¶m| Ho$ EH$ {hñgo Ho$ ê$n ‘| AÝ¶ AZw^mJm| Ho$ gh¶moJ go "'Š¶m H$ao d Š¶m Z H$a|'' ‘¡Ý¶yAëg V¡¶ma {H$¶m J¶m & Omo {ZJ‘ Ho$ {Z¶‘ d {d{Z¶‘ Ho$ V¡¶ma g§X^© H$m EH$ AÀN>m gmonmZ hmoJm {Oggo do AnZo H$m¶m] H$mo erK« d à^mdembr T>§J go {Zdm©h H$aZo hoVw n[aMm{bV {H$¶m J¶m &

2. gVH©$Vm Šbr¶a§g erK« XoZo Ho$ {bE AmB© Q>r Ho$ gh¶moJ

go Am°ZbmBZ nÕ{V {dH${gV H$s JB© h¡ &

3. gVH©$Vm H$mo Am¡a A{YH$ gwÑ‹T> ~ZmZo Ho$ {bE grgrAmB© ñQ>m°H$ H$s gwajm Ho$ {bE {ZåZ gwYmamË‘H$ Cnm¶ {b¶o J¶o :-

i. {Z¶§ÌH$/gd}jH$ A{YH$m[a¶m| H$mo gbmh Xr J¶r

h¡ {H$ Ohm± Amdí¶H$ hmo gwYma Ho$ Cnm¶m| Ho$ Ûmam

H$m¶©-nÜX{V ‘| gwYma Ho$ {bE emIm H$m¶m©b¶m| VWm

Ho$ÝÐm| Ho$ Xm¡am| ‘| d¥pÜX H$s OmE&

ii. emIm/Ho$ÝÐm| H$mo Ho$ÝÐr¶ gVH©$Vm Am¶moJ Ho$

{Xem{ZX}e VWm ‘w»¶mb¶ Ho$ {Xem{ZX}e Ho$ AZwgma

IarX, g§gmYZ, Vm¡b Am{X H$m¶© C{MV Am¡a

nmaXeu ê$n go H$aZo Ho$ {bE H$hm J¶m &

4. IarXr :

· Ho$db {H$gmZm| go EnrE‘gr/EnrE‘gr Ûmam Kmo{fV ¶mS>©g Ho$ ‘mÜ¶‘ go IarX Ho$ {bE g»V {Xem{ZX}e Omar {H$E JE &

31


^m.H$.{Z.

C.C.I.

• Instructions for maintaining Quality of kapas as per prescribed parameters were issued.

20. PROGRESSIVE uSE OF hINDI:

Your Corporation has achieved all the targets of progressive use of Hindi laid down in annual programme for the year 2018-19 issued by Department of Official Language, Ministry of Home Affairs. The Corporation has been honored with the Rajbhasha KirtiPuraskar (second) on 14th September, 2018 in the field of Hindi implementation in "B" Region during the year 2017-18 by Hon`ble vice President of India. Your Corporation has got the honour of receiving this National award for 26th time.

In addition to this during the year 2017-18 Corporation has also been awarded Ashirwad Smruti Chinh by Ashirwad -socio- Cultural Organization in the competition of doing the Excellent work in Hindi among Public Sector (small) category.

During the year 2017-18 Head Office has received the 2nd prize. B.O. Aurangabad and B.O. Coimbatore received the 1st prize and B.O. Indore 3rd prize with appreciation certificate and B.O. Bathinda received the award of Best Office in Central Government Offices by their respective “Town Official Language Implementation Committee” (TOLIC) for excellent implementation in Hindi.

In addition to this, during the year 2017-18 Head Office has also been awarded with the 2nd prize and Certificate for The Best Publication of Hindi Magazine "Rajbhasha Rashmi" by Navi Mumbai Town Official Language Implementation Committee (TOLIC).

Bilingual computer programming is made available at Head Office as well as in all Branch Offices and Unicode facility is also made available. Web-site is available in bilingual form, since 2003 and it is being updated from

· {ZYm©[aV ‘mZX§S>mo Ho$ AZwgma H$nmg H$s JwUdÎmm Ho$

aIaImd Ho$ {bE AZwXoe Omar {H$E JE &

20. qhXr H$m àJm‘r à¶moJ :

amO^mfm Ho$ àJm‘r à¶moJ H$s {Xem ‘| AmnHo$ {ZJ‘ Zo

df© 2018-19 Ho$ {bE amO^mfm {d^mJ, J¥h ‘§Ìmb¶,

^maV gaH$ma Ûmam Omar dm{f©H$ H$m¶©H«$‘ ‘| {ZYm©[aV

g^r bú¶m| H$mo àmá {H$¶m h¡ & {ZJ‘ H$mo "'I'' joÌ ‘|

pñWV gmd©O{ZH$ CnH«$‘m| H$s loUr ‘| df© 2017-18 Ho$

Xm¡amZ qhXr Ho$ H$m¶m©Ýd¶Z ‘| H$s JB© àJ{V Ho$ {bE 14

{gV§~a, 2018 H$mo ‘mZZr¶ Cn amï´>n{V Ûmam amO^mfm

H$s{V© nwañH$ma ({ÛVr¶) go gå‘m{ZV {H$¶m J¶m & {ZJ‘

H$mo amï´>r¶ ñVa H$m ¶h nwañH$ma 26dt ~ma àmá H$aZo H$m

Jm¡ad {‘bm h¡ &

BgHo$ Abmdm {ZJ‘ H$mo df© 2017-18 Ho$ Xm¡amZ

gmd©O{ZH$ CnH«$‘m| (N>moQ>o CnH«$‘m|) H$s loUr ‘| gdm©{YH$

H$m‘H$mO qhXr ‘| H$aZo Ho$ {bE ‘w§~B© ‘hmZJa H$s gwà{gÕ

gm{hpË¶H$ Amerdm©X g§ñWm Ûmam Amerdm©X ñ‘¥{V {MÝh go

gå‘m{ZV {H$¶m J¶m &

df© 2017-18 Ho$ Xm¡amZ amO^mfm qhXr Ho$ loð> H$m¶m©Ýd¶Z Ho$ {bE g§~§{YV ZJa amO^mfm H$m¶m©Ýd¶Z g{‘{V (ZamH$mg) Ûmam {ZJ‘ Ho$ ‘w»¶mb¶ H$mo {ÛVr¶ nwañH$ma Am¡a em. H$m. Am¡a§Jm~mX d em.H$m. H$mo¶§~Îmya H$mo àW‘ nwañH$ma em.H$m. B§Xm¡a H$mo V¥Vr¶ Ed§ àepñV nÌ go gå‘m{ZV {H$¶m J¶m VWm emIm H$m¶m©b¶ ~qR>S>m H$mo Ho$ÝÐr¶ gaH$mar H$m¶m©b¶m| ‘| gd©loð> H$m¶m©b¶ H$s amO^mfm erëS> go gå‘m{ZV {H$¶m J¶m &

BgHo$ gmW hr df© 2017-18 Ho$ Xm¡amZ gd©loð> J¥h

n{ÌH$m amO^mfm apí‘ Ho$ àH$meZ Ho$ {bE Zdr ‘w§~B© ZJa

amO^mfm H$m¶m©Ýd¶Z g{‘{V (ZamH$mg) Ûmam {ZJ‘ Ho$

‘w»¶mb¶ H$mo {ÛVr¶ nwañH$ma VWm à‘mU nÌ àXmZ {H$¶m

J¶m &

{ZJ‘ Ho$ ‘w»¶mb¶ VWm {d{^Þ emIm H$m¶m©b¶m| ‘| g^r H§$ß¶yQ>am| na {Û^mfr àmoJ«mq‘J H$am¶r Om MwH$s h¡ VWm ¶y{ZH$moS> H$s gw{dYm ^r CnbãY H$am¶r JB© h¡ & df© 2003 go {ZJ‘ H$s do~gmB©Q> {Û^mfr ê$n ‘| CnbãY h¡ VWm Cgo g‘¶-g‘¶ na AÚVZ {H$¶m OmVm h¡ & {ZJ‘

32

^m.H$.{Z.

C.C.I.


time to time. ERP system of the Corporation is also available in bilingual. Corporation is also regularly publishing House Journal named "Rajbhasha Rashmi" since 1984. E-Journal "Rajbhasha Rashmi” is being exhibited on Corporation’s website since July, 2009.

Since 2016-17 our branch offices Ahmedabad, Rajkot, Bathinda, Indore and Sriganganagar have also published Half –Yearly E-magazine viz. Rajbhasha Garima, Somnath, Rajbhasha Parag, Kapas Garima and Ashadeep respectively.

Hindi correspondence in respect of Head Office and branches at “A”, “B” and “C” regions have been maintained above the target prescribed in the Annual Programmed issued by Rajbhasha Vibhag, Ministry of Home Affairs. The total percentage of originating correspondence issued in Hindi during the quarter ended 31st March, 2019 at Head Office has been maintained at 97.76%.

As per the orders of RajbhashaVibhag Head Office and its subordinate offices are attending half yearly meeting from time to time and actively participating in various activities under the aegis of Town Official Language Implementation Committee. Apart from this our Branch office Aurangabad and Adilabad are also heading the chairmanship of Town Official Language Implementation Committee (TOLIC).

21. PROGRESS IN ThE FIELD OF INFORmATION TEChNOLOGY:

During the Financial Year 2018-19, your Corporation has achieved a number of improvements in the field of Information Technology: -

21.1 ERP IMPLEMENTATION

• The Corporation has successfully implemented GST in its ERP application at all locations i.e. Branches and Head Office.

Ûmam V¡¶ma H$admB© JB© B©.Ama.nr. àUmbr ‘| ^r {Û^mfr ‘| H$m¶© H$aZo H$s gw{dYm CnbãY h¡ & df© 1984 go {ZJ‘ H$s J¥h n{ÌH$m amO^mfm apí‘ H$m {Z¶{‘V ê$n go àH$meZ {H$¶m Om ahm h¡ & OwbmB©, 2009 go "amO^mfm apí‘' B©-OZ©b n{ÌH$m {ZJ‘ H$s do~-gmBQ> na àX{e©V H$s Om ahr h¡ &

df© 2016-17 go {ZJ‘ H$s emIm H$m¶m©b¶ Ah‘Xm~mX,

amOH$moQ>, ~qR>S>m, B§Xm¡a VWm lrJ§JmZJa Ûmam ^r H«$‘e:

amO^mfm J[a‘m, gmo‘ZmW, amO^mfm namJ, H$nmg J[a‘m

Ed§ AmemXrn N>: ‘mhr B©-‘¡J{OZ H$m àH$m{eV H$s Om

ahr h¡ &

{ZJ‘ Ho$ ‘w»¶mb¶ VWm "H$', "I' Ed§ "J' joÌ ‘|

pñWV g^r emIm H$m¶m©b¶m| ‘| qhXr nÌmMma H$m

à{VeV amO^mfm {d^mJ, J¥h ‘§Ìmb¶ Ûmam Omar dm{f©H$

H$m¶©H«$‘ ‘| {ZYm©[aV {H$E JE bú¶m| go AmJo h¢ &

‘w»¶mb¶ ‘| 31 ‘mM©, 2019 H$mo g‘má {V‘mhr Ho$

‘yb nÌmMma ‘| Omar qhXr nÌm| H$m à{VeV 97.76%

h¡ &

amO^mfm {d^mJ Ho$ AmXoemZwgma {ZJ‘ Ho$ ‘w»¶mb¶

Ed§ AYrZñW H$m¶m©b¶m| Ûmam g§~§{YV ZJa amO^mfm

H$m¶m©Ýd¶Z g{‘{V¶m| Ho$ VËdmdYmZ ‘| Am¶mo{OV N>: ‘mhr

~¡R>H$m| VWm {d{^Þ J{V{d{Y¶m| ‘| g{H«$¶ ê$n go ^mJ

{b¶m OmVm h¡ & BgHo$ Abmdm {ZJ‘ Ho$ emIm H$m¶m©b¶

Am¡a§Jm~mX VWm Am{Xbm~mX g§~§{YV ZJa amO^mfm

H$m¶m©Ýd¶Z g{‘{V¶m| H$s AÜ¶jVm H$a aho h¢ &

21. gyMZm àm¡Úmo{JH$s Ho$ joÌ ‘| àJ{V :

{dÎmr¶ df© 2018-19 Ho$ Xm¡amZ, AmnHo$ {ZJ‘ Zo gyMZm àm¡Úmo{JH$s Ho$ joÌ ‘| H$B© gwYma H$aZo ‘| g’$bVm àmá H$s h¡ :-

21.1 B©Amanr H$m¶m©Ýd¶Z

· {ZJ‘ Zo AnZo ‘w»¶mb¶ d emIm H$m¶m©b¶m| ‘| B©Amanr EßbrHo$eZ ‘| OrEgQ>r H$m g’$bVmnyd©H$ H$m¶m©Ýd¶Z {H$¶m h¡ &

33


^m.H$.{Z.

C.C.I.

• The Corporation has successfully developed “Farmer Invoice Generation Module” in house software for purchasing of Kapas and the same has been deployed to Centre level.

• The Corporation has successfully completed the Statutory Audit and Govt. Audit in ERP from FY 2011-12 onwards using the ERP application in the Corporation at all locations i.e. Branches and Head Office.

• A few new forms and reports have been developed and incorporated in the ERP such as MSP Interest, CPF & Superannuation statements etc. for the ease of the users.

• The existing reports/forms of Finance, Marketing & HR /Payroll Modules have been modified as per users /business requirements.

• One ERP Help Desk is operational at Head Office for help in case of any difficulty in operation / running of ERP at branches.

21.2 MOBILE APPLICATION

• The Corporation has successfully developed Mobile Application “Cott-Ally”. The application is being used by Farmers.

21.3 WEB APPLICATION

• The Corporation has implemented web based application portal for ACR/APAR (Annual Confidential Report) filling by the employees online.

• The Corporation has a web based application for Internal Audit for submission of online monthly returns for Branches. User Id and password has been provided to all the internal auditors of the branch through which they will be able to fill in the information for review at Head Office level.

· {ZJ‘ Zo H$nmg H$s IarXr Ho$ {bE "'{H$gmZ BZdm°Bg OZaoeZ ‘m°S>çyb'' Zm‘H$ gm°âQ>doAa {Ogo BZhmD$g hr V¶ma {H$¶m J¶m h¡, {dH${gV {H$¶m h¡ Am¡a Bgo IarXr H|$Ð Ho$ ñVa na à¶moJ bm¶m OmVm h¡ &

· {ZJ‘ Zo AnZo ‘w»¶mb¶ d emIm H$m¶m©b¶m| ‘|

{dÎmr¶ df© 2011-12 go B©Amanr EßbrHo$eZ Ho$

Cn¶moJ go gm§{d{YH$ boIm narjm VWm gaH$mar

boIm narjm H$m g’$bVmnyd©H$ H$m¶© nyU© {H$¶m &

· Ý¶yZV‘ g‘W©Z ‘yë¶ na ã¶mO, A^{Z d A{Yd{f©Vm {ddaUr Am{X go g§~§{YV Hw$N> ZE ’$m‘©g d [anmoQ>© V¡¶ma H$s JB© h¡ VWm Cn¶moJH$Vm© H$s AmgmZr Ho$ {bE B© Ama nr ‘| em{‘b {H$¶m

J¶m h¡ &

· {dÎm, {dnUZ d ‘mg§{d /noamob ‘m°Sy>ëg H$s dV©‘mZ

[anmoQ>©g² /’$m‘©g H$mo Cn¶moJH$Vm©/ ì¶mnm[aH$

Amdí¶H$VmAm| Ho$ AZwgma gwYma {H$¶m h¡ &

· emImAm| na B©Amanr Ho$ H$m¶m©Ýd¶Z/aqZJ ‘| AmZo dmbr g‘ñ¶mAm| Ho$ g‘mYmZ Ho$ {bE ‘w»¶mb¶ ‘| EH$ hoën S>oñH$ ~Zm¶m J¶m h¡ &

21.2 ‘mo~mBb EßbrHo$eZ

· {ZJ‘ Zo "'H$m°Q>-A„r'' ‘mo~mBb EßbrHo$eZ g’$bVmnyd©H$ {dH${gV {H$¶m h¡ & {H$gmZmo Ûmam Bg EßbrHo$eZ H$m Cn¶moJ {H$¶m Om ahm h¡ &

21.3 do~ EßbrHo$eZ

· H$‘©Mm[a¶m| Ûmam (dm{f©H$ JmonZr¶ [anmoQ>©) Am°ZbmB©Z âZo Ho$ {bE EgrAma/EnrAma âZo Ho$ {bE do~ ~oñS> EßbrHo$eZ nmoQ>©b {H«$¶mpÝdV {H$¶m J¶m h¡ &

· {ZJ‘ ‘| emImAm| H$s Am°ZbmB©Z ‘m{gH$ [aQ>©Zg Ho$ àñVwVrH$aU Ho$ {bE Am§V[aH$ boIm narjm hoVw do~ ~oñS> EßbrHo$eZ CnbãY h¡ & emImAm| Ho$ g^r Ambon A{YH$m[a¶m| Ho$ {bE ¶yOa AmB©S>r d nmgdS>© CnbãY H$adm¶m J¶m h¡ {Oggo do ‘w»¶mb¶ ñVa na g‘rjm Ho$ {bE g§~§{YV OmZH$mar â gH$Vo h¡ &

34

^m.H$.{Z.

C.C.I.


21.4 WEBSITE

• The Corporation is having informative and user friendly website using the latest technology, keeping in mind the Guidelines of Indian Government Website (GIGW) & Web Contents Accessibility Guidelines (WCAG).

• Even a person even with disability is able to access the website with the help of assistive technologies. With these features, the guidelines of Ministry of Social Justice, Govt. of India is also implemented.

• The website is also available in Hindi, where all the items listed in English website is available in Hindi. Further, the dynamic moving items are also now available in Hindi, which was initially not implemented.

• The details of tenders and auctions floated by Branches are to be published on our website www.cotcorp.org.in and on Government Tenders portal www.eprocure.gov.in by HO and respective BOs at their own, the necessary authorization for the same is provided to each BOs.

21.5 EMAIL COMMUNICATION

• The email address to HO and Branches have been provided with single domain i.e. @cotcorp.com which is hosted on a single server. Further, all the employees have been provided with individual email IDs to ease and make the communication faster within the Corporation.

21.6 HARDWARE & SOFTWARE UPGRADATION

• Wherever found necessary on need basis, the upgradation of the existing hardware & software and installation of new hardware has been completed at corporate office and branches.

21.4 do~gmB©Q> :

· {ZJ‘ ‘| maVr¶ gaH$mar do~gmB©Q> (OrAmB©OrS>ãë¶y)

do~ H§$Q>oÝQ>g EŠgog{~{bQ>r (S>ãë¶ygrEOr)

‘mJ©Xe©Z H$mo Ü¶mZ ‘| aIH$a ZdrZV‘ VH$ZrH$s Ho$

gmW {ZJ‘ ‘| gyMZmË‘H$ d Cn¶moJH$Vm© Ho$ AZwHy$b

do~gmB©Q> CnbãY h¡ &

· H$moB© {dH$bm§J ì¶{º$ ^r ghm¶H$ VH$ZrH$s H$s

ghm¶Vm go do~gmB©Q> EŠgog H$a gH$Vm h¡& BZ

CÔoí¶m| Ho$ gmW gm‘m{OH$ Ý¶m¶ ‘§Ìmb¶, ^maV

gaH$ma Ho$ ‘mJ©Xe©Zm| H$m ^r H$m¶m©Ýd¶Z {H$¶m

J¶m h¡ &

· do~gmB©Q> qhXr ‘| ^r CnbãY h¡, do g^r dñVwE±

Omo A§J«oOr ‘| gyMr~ÜX h¡ do qhXr ‘| ^r CnbãY

h¡& AmJo S>m¶Zm{‘H$ ‘yqdJ AmB©Q>åg {OZH$m àma§^

‘| H$m¶m©Ýd¶Z Zht {H$¶m J¶m Wm, do ^r qhXr ‘|

CnbãY h¢ &

· emImAm| Ûmam Omar Q>|S>g© d Am°ŠeÝg Ho$ {ddaU

H$mo h‘mar do~gmB©Q> www.cotcorp.org.in VWm

www.eprocure.gov.in na ‘w»¶mb¶ Ed§ g§~§{YV

emImAm| Ûmam ñd¶§ àH$m{eV {H$¶m OmVm h¡& Bg

g§~§Y ‘| g^r emImAm| H$mo Amdí¶H$ àm{YH$aU

CnbãY H$adm¶m J¶m h¡ &

21.5 B©-‘ob nÌ ì¶dhma

· ‘w»¶mb¶ Am¡a emIm H$m¶m©b¶m| H$m B©-‘ob nVm

qgJb S>mo‘oZ ¶m{Z cotcorp.com {X¶m J¶m h¡,

Omo qgJb gd©a na àX{e©V h¡ & AmJo ‘w»¶mb¶ Ho$

A{YH$m[a¶m| Am¡a emIm àYmZm|, {dÎm àYmZ Am¡a

gV©H$Vm A{YH$m[a¶m| H$mo d¡¶{º$H$ B©-‘ob Am¶S>r

{X¶m J¶m h¡, Vm{H$ do {ZJ‘ Ho$ A§Xa ghOVm go nÌ

ì¶dhma H$a gHo$ &

21.6 hmS>©doAa Am¡a gm°âQ>doAa CƒrH$aU

· Ohm§ H$hr Amdí¶H$ Wm ‘w»¶mb¶ Am¡a emIm

H$m¶m©b¶m| ‘| dV©‘mZ hmS>©doAa Am¡a gm°âQ>doAa H$m

CƒrH$aU {H$¶m J¶m h¡ Am¡a Z¶m hmS>©doAa ñWm{nV

{H$¶m J¶m h¡&

35


^m.H$.{Z.

C.C.I.

• The Corporation has recently provided 350 nos. Laptops & Printers for Centre In-charges to make them fully equipped to undertake procurement operations.

21.7 CERT-IN GUIDELINES

• The guidelines received from Indian Computer Emergency Response Team (CERT-In), Department of Information Technology, Ministry of Communication and Information Technology, Government of India about IT/Data Security, Virus Alerts, related security measures and precautions etc. are being implemented in the Corporation from time to time.

21.8 IPv6 COMPLIANCE

• The guidelines received from Ministry of Textiles, Government of India and Department of Information Technology /Department of Telecommunication, Ministry of Communication and Information Technology, Government of India about IPv6 are implemented in the Corporation. Further, the Corporation started procuring only IPv6 compliant hardware and software in the Corporation.

22. CORPORATE GOVERNANCE:

Your Corporation believes that for a company to be successful, it must maintain global standards of corporate conduct towards all its stakeholders. Your Company believes that the principles of fairness, transparency and accountability are the cornerstones for good governance. It is Company’s endeavor to continue to achieve the highest levels of governance and to benchmark itself with the best governed companies in the similar trade.

23. DISCLOSuRE uNDER ThE SEXuAL hARASSmENT OF WOmEN AT WORKPLACE (PREVENTION, PROhIBITION AND REDRESSAL) ACT, 2013:

The company has in place a policy for prevention of sexual harassment in accordance with the

· {ZJ‘ Zo hmb hr ‘| H|$Ð à^m[a¶m| Ho$ {bE 350 ZJ

b¡nQ>m°n Am¡a qàQ>a àXmZ {H$E h¢ Vm{H$ CÝh| IarX

g§MmbZ ewê$ H$aZo Ho$ {bE nyar Vah go V¡¶ma {H$¶m

Om gHo$ &

21.7 grB©AmaQ>r-BZ {Xem {ZX}e

· {ZJ‘ ‘| gyMZm àm¡Úmo{JH$s S>mQ>m {gŠ¶yarQ>r,

dmB©ag AbQ>©, gwajm Cnm¶m| Am¡a gmdYm{Z¶m|

Ho$ ~mao ‘| grB©AmaQ>r - BZ, gyMZm àm¡Úmo{JH$s

{d^mJ, g§Mma Am¡a gyMZm àm¡Úmo{JH$s ‘§Ìmb¶,

^maV gaH$ma Ûmam Omar {Xem {ZX}e H$m AZwnmbZ

{H$¶m OmVm h¡ &

21.8 AmB©nrdr6 AZwnmbZ

· AmB©nrdr6 Ho$ ~mao ‘| dó ‘§Ìmb¶, ^maV gaH$ma

VWm gyMZm àm¡Úmo{JH$s {d^mJ, g§Mma Am¡a gyMZm

àm¡Úmo{JH$s ‘§Ìmb¶, ^maV gaH$ma go àmá {Xem

{ZX}e H$m {ZJ‘ ‘| bmJy {H$¶m J¶m h¡ & AmJo, {ZJ‘

Zo AmB©nrdr6 {eH$m¶V hmS>©do¶a VWm gm°âQ>do¶a

hr IarXZm Ama§^ {H$¶m J¶m h¡ &

22. {ZJ{‘V emgZ :

AmnH$m {ZJ‘ {dœmg H$aVm h¡ {H$ g’$b hmoZo Ho$ {bE EH$

H§$nZr Ho$ {bE ¶h Amdí¶H$ h¡ {H$ AnZo g^r ñQ>oH$hmoëS>g©

Ho$ {bE {ZJ{‘V AmMaU H$m {dœ ñVa ‘mZX§S> ~Zm¶o &

AmnH$s H§$nZr H$mo {dœmg h¡ {H$ Am¡{MË¶, nmaX{e©Vm Am¡a

CÎmaXm{¶Ëd Ho$ {gÜXm§V AÀN>o emgZ Ho$ {bE gmonmZ h¢ &

H§$nZr H$m ¶h CÚ‘ h¡ {H$ àemgZ H$m CƒV‘ ñVa àmá

H$a| Am¡a AnZo ì¶mnma joÌ ‘| CËH¥$ï> àemgr H§$n{Z¶m| Ho$

gmW AnZm ñWmZ ~Zm¶o &

23. H$m¶©ñWb na ‘{hbm ¶m¡Z CËnr‹S>Z Ho$ A§VJ©V àH$Q>rH$aU ({ZdmaU, {ZfoY, d Cnm¶) A{Y{Z¶‘ 2013

‘{hbmAm| Ho$ H$m¶©ñWb na ‘{hbm ¶m¡Z CËnr‹S>Z Ho$

A§VJ©V àH$Q>Z ({ZdmaU, {ZfoY, d Cnm¶) A{Y{Z¶‘

36

^m.H$.{Z.

C.C.I.


requirements of the Sexual Harassment of women at workplace (Prevention, Prohibition & Redressal) Act, 2013. Internal Complaints Committee has been set up to redress complaints received regarding sexual harassment. All employees (permanent, contractual, temporary, trainees) are covered under this policy. The Company has not received any complaint during the year 2018-19.

24. BOARD OF DIRECTORS:

There were no changes in the Board of Directors of your company during the year 2018-19 under review.

25. BOARD mEETINGS:

During the year ended 31st March, 2019, Six (6) board meetings were held i.e. on 11th May, 2018, 21st May, 2018, 23rd August, 2018, 26th November,2018, 2nd February, 2019 and 21st

March, 2019.

26. DIRECTORS’ RESPONSIBILITY STATEmENT:

Pursuant to the requirement under Section 134(3)(c) of the Companies Act, 2013 with respect to Directors’ Responsibilities Statement, the directors confirmed.

26.1 That in the preparation of the annual accounts for the financial year ended 31st March, 2019 the applicable accounting standards had been followed along with proper explanation relating to material departures;

26.2 That the directors had selected such accounting policies and applied them consistently and made judgements and estimates that are reasonable and prudent so as to give a true and fair view of the state of affairs of the Company at the end of the financial year and of the profit and loss of the company for that period;

26.3 That the directors had taken proper and sufficient care for the maintenance of adequate accounting records in accordance with the

2013 H$s Amdí¶H$VmAm| Ho$ AZwgma ¶m¡Z CËnr‹S>Z Ho$

{ZdmaU hoVw H$ånZr Zo EH$ ¶moOZm ~Zm¶r JB© h¡ & ¶m¡Z

CËnr‹S>Z H$s àmá {eH$m¶Vm| Ho$ amoH$Wm‘ Ho$ {bE Am§V[aH$

{eH$m¶V g{‘{V ñWm{nV H$s JB© h¡& Bg ¶moOZm Ho$

A§VJ©V g^r H$m¶m©b¶m| (ñWm¶r, g§{dXmJV, AñWm¶r,

à{ejUmWu) H$mo em{‘b {H$¶m J¶m h¡ & H§$nZr H$mo df©

2018-19 Ho$ Xm¡amZ H$moB© {eH$m¶V àmá Zht hþB© h¡ &

24. {ZXoeH$ ‘§S>b:

g‘rjmJV df© 2018-19 Ho$ Xm¡amZ AmnH$s H§$nZr Ho$

{ZXoeH$ ‘§S>b ‘| H$moB© ~Xbmd Zhr hþAm :

25. ‘§S>b H$s ~¡R>H|$ :

31 ‘mM©, 2019 H$mo g‘má df© Ho$ {bE ‘§S>b H$s 6

~¡R>H|$ 11 ‘B©, 2018, 21 ‘B©, 2018, 23 AJñV,

2018, 26 Zd§~a, 2018, 2 ’$adar, 2019 VWm 21

‘mM©, 2019 H$mo hþB© &

26. {ZXoeH$m| Ho$ Xm{¶Ëdm| H$s {ddaUr :

H§$nZrO A{Y{Z¶‘ 2013 H$s Ymam 134(3)(gr)

Ho$ AZwgaU ‘| {ZXoeH$m| Ho$ Xm{¶Ëdm| H$s EVX²dmam nw{ï>

H$aVo h¢ &

26.1 ¶h {H$ 31 ‘mM©, 2019 H$mo g‘má {dÎmr¶ df© Ho$ dm{f©H$

boIm| H$mo V¡¶ma H$aVo g‘¶, ‘Q>o[a¶b {dMbZ go g§~§{YV

C{MV ñnï>rH$aU Ho$ gmW-gmW bmJy boIm ‘mZH$m| H$m

AZwnmbZ {H$¶m J¶m h¡ &

26.2 ¶h {H$ {ZXoeH$m| Zo Bg àH$ma H$s boIm Zr{V¶m| H$m

M¶Z {H$¶m h¡ Am¡a Cgo H$‹S>mB© go bmJy {H$¶m h¡ VWm Eogo

Am¡{MË¶nyU© Ed§ ñnï> {ZU©¶ Ed§ AZw‘mZ bJm¶o h¢, Omo

{dÎmr¶ df© Ho$ A§V ‘| H§$nZr Ho$ H$m¶© - ì¶dhma H$m VWm

Cg df© Ho$ bm^-hm{Z ImVo H$m ghr {MÌU XoVo h¢&

26.3 ¶h {H$ {ZXoeH$m| Zo H§$nZr H$s n[ag§n{Îm¶m| H$s gwajm Ho$

{bE VWm OmbgmOr Ed§ AÝ¶ A{Z¶{‘VVmAm| H$mo nH$S>Zo

37


^m.H$.{Z.

C.C.I.

provisions of the Act, for safeguarding the assets of the Company and for preventing and detecting fraud and other irregularities. That the directors had prepared the annual accounts on a “going concern” basis;

26.4 That the directors had prepared the annual accounts on a going concern basis; and

26.5 That the directors had devised proper systems to ensure compliance with the provisions of all applicable laws and that such systems were adequate and operating effectively.

27. AuDIT COmmITTEE:

The Audit Committee was constituted in terms of compliance of Corporate Governance Guidelines issued by the Department of Public Enterprises (DPE), Government of India. During the year 2018-19 under review, six(6) meeting of Audit Committee were held on 11th May, 2018, 21st May, 2018, 23rd August, 2018, 26th November, 2018, 2nd February, 2019 and 21st March, 2019. The Composition of Audit Committee of your Corporation comprise of three Directors including two independent directors and one part-time director nominated by the Ministry of Textiles, Government of India.

28. STATuTORY AuDITORS:

M/s Baweja & Kaul, Chartered Accountants, New Delhi and M/s. G B C A & Associates LLP, Chartered Accountants, Mumbai were appointed as Joint Statutory Auditors of the Company for the year 2018-19.

29. mOu WITh ThE mINISTRY OF TEXTILES:

29.1 The achievement based on actual result vis-à-vis targets for the year 2017-18 is awaited from the Department of Public Enterprises.

29.2 The Memorandum of Understanding (MoU) between your Corporation and the Ministry of Textiles for the year 2018-19 was signed on 12/07/2018.

Am¡a amoH$Zo Ho$ {bE A{Y{Z¶‘, Ho$ àmdYmZm| Ho$ AZwgma

boIm| Ho$ aIaImd Ho$ {bE n¶m©á Ed§ C{MV gmdYmZr

~aVr h¡ & ¶h {H$ dm{f©H$ boIm| H$mo {ZXoeH$m| Zo 'JmoB§J

H$ÝgZ©' Ho$ AmYma na V¡¶ma {H$¶m h¡ &

26.4 ¶h {H$ dm{f©H$ boIm| H$mo {ZXoeH$m| Zo 'JmoB§J H$ÝgZ©' Ho$

AmYma na V¡¶ma {H$¶m h¡ ; VWm

26.5 ¶h {H$ {ZXoeH$m| Zo bmJy g^r H$mZyZm| Ho$ àmdYmZm| H$m

AZwnmbZ gw{Z{üV H$aZo Ho$ {bE C{MV nÜX{V AnZmB©

VWm ¶h nÜX{V n¶m©á Ed§ à^mdembr h¡ &

27. boIm narjm g{‘{V

bmoH$ CÚ‘ H$m¶m©b¶ S>rnrB© ^maV gaH$ma Ûmam Omar

{ZJ{‘V emgZ ‘mJ©Xe©Z Ho$ AZwnmbZ Ho$ AZwgma boIm

narjm g{‘{V g§ñWm{nV H$s JB© & g‘rjmYrZ df© Ho$

Xm¡amZ boIm g{‘{V H$s N>o(6) ~¡R>Ho$ {XZm§H$ 11 ‘B©,

2018, 21 ‘B©, 2018, 23 AJñV, 2018, 26

Zd§~a, 2018, 02 ’$adar, 2019 VWm 21 ‘mM©,

2019 H$mo Am¶mo{OV H$s JB© & AmnHo$ {ZJ‘ H$s boIm

narjm g{‘{V ‘| Xmo ñdV§Ì {ZXoeH$ H$mo em{‘b H$aVo hþE

VrZ {ZXoeH$ h¡ VWm dó ‘§Ìmb¶, ^maV gaH$ma Ûmam

Zm{‘V EH$ A§eH$mbrH$ {ZXoeH$ &

28. gm§{d{YH$ boIm narjH$:

df© 2018-19 Ho$ {bE H§$nZr Ho$ g§¶wº$ gm§{d{YH$ boIm narjH$ Ho$ ê$n ‘| ‘ogg© ~doOm E§S> H$m¡b, gZXr boImnmb, ZB© {X„r VWm ‘ogg© Or ~r gr E E§S> Egmo{gEQ²g EbEbnr, gZXr boImnmb ‘w§~B© H$mo {Z¶wº$

{H$¶m J¶m &

29. dó ‘§Ìmb¶ Ho$ gmW g‘Pm¡Vm kmnZ :

29.1 df© 2017-18 Ho$ {bE {ZYm©[aV bú¶m| H$mo àmá H$aZo Ho$ gmW-gmW dmñV{dH$ n[aUm‘ Ho$ AmYma na bmoH$ CÚ‘ {d^mJ go Ano{jV h¡ &

29.2 AmnHo$ {ZJ‘ VWm dó ‘§Ìmb¶ Ho$ ~rM df© 2018-

19 Ho$ {bE g‘Pm¡Vm kmnZ na (E‘Amo¶y) 12 OwbmB©,

2018 H$mo hñVmja {H$E JE &

38

^m.H$.{Z.

C.C.I.


30. PARTICuLARS OF EmPLOYEES:

Your Corporation being a Government Company is exempted to furnish information under Section 197 of the Companies Act, 2013 vide Ministry of Corporate Affairs (MCA) Notification dated 05/06/2015.

31. EXTRACT OF ANNuAL RETuRN:

In pursuant to section 134(3)(a), the extract of the Annual Return as provided under sub section (3) of section 92 under the Companies (Amendment) Act 2017 has been placed on the website of the Company and the web address / link is www.cotcorp.org.in/annual_report.aspx.

32. RISK mANAGEmENT POLICY:

Your Corporation has developed and adopted a Risk Management Policy, which inter alia covers identification of elements of risks.

Risk Management Committee has also been constituted comprising of senior officials of the Company. Risk Management Committee has been entrusted with the responsibility to assist the Board in:

(a) Overseeing and approving the Company’s enterprise wide risk management framework;

(b) Overseeing that all risks that the organization faces such as risks involved in cotton purchase operations, market/price fluctuation risks, logistics risks, strategic, financial, liquidity, foreign exchange, corporate accounting fraud, IT/systems risks, legal, human resource and other risks have been identified and assessed.

There is an adequate risk management mechanism in place which identifies the risks inherent in any business operations of the Corporation and provided guidelines to define,measure, report, control and mitigate the identified risks.

30. H$‘©Mm[a¶m| Ho$ ã¶m¡ao:

AmnH$m {ZJ‘ gaH$mar H§$nZr hmoZo Ho$ H$maU {ZJ{‘V H$m¶©

‘§Ìmb¶ H$s A{YgyMZm {XZm§H$ 05/06/2015 Ûmam

H§$nZr A{Y{Z¶‘ 2013 H$s Ymam 197 Ho$ AYrZ gyMZm

^oOZo H$s Ny>Q> h¡&

31. dm{f©H$ [aQ>Z© H$m {ZîH$f© :

Ymam 134 (3)(H$) Ho$ AZwnmbZ go Ymam 92 Ho$ Cn I§S>

(3) Ho$ VhV gm{~V {H$E JE dm{f©H$ [aQ>Z© H$m (g§emoYZ)

A{Y{Z¶‘ 2017 Ho$ VhV H§$nZr H$s do~gmBQ> Am¡a do~

nVm www.cotcorp.org.in/annual_report.aspx qbH$

na S>mb {X¶m J¶m h¡ &

32. OmopI‘ à~§YZ Zr{V :

AmnH$s H§$nZr Zo OmopI‘ ^ao VËdm| H$mo H$da H$aZo Ho$

CÔoí¶ go OmopI‘ à~§YZ Zr{V {dH${gV H$s Am¡a AnZm¶r

h¡ &

H§$nZr Ho$ d[að> A{YH$m[a¶m| H$mo em{‘b H$aHo$ OmopI‘

à~§YZ g‘rVr H$m ^r JR>Z {H$¶m h¡& OmopI‘ à~§YZ

g‘rVr H$mo ~moS>© H$mo ghm¶Vm H$aZo H$m CÎmaXm{¶Ëd gm¢nm

J¶m h¡ O¡go;

H$) OmopI‘ à~§YZ ’«o$‘dH©$ Ûmam H§$nZr Ho$ CÔ‘ H$s

XoIaoI d AZw‘moXZ XoZm h¡ &

I) g§JR>Z Ho$ do g^r OmopI‘ h¡ O¡go H$nmg IarX n[aMmbZ ‘| em{‘b OmopI‘, ‘mH}$Q> ‘yë¶ ‘| CVma M‹T>md Ho$ OmopI‘, bm°{OpñQ>H$ OmopI‘, aUZr{V, {dÎmr¶, {b{¹${S>Q>r, {dXoer ‘wÐm, {ZJ{‘V boIm YmoImY‹S>r, gyMZm àm¡Úmo{JH$s/{gñQ>‘ OmopI‘, {d{Y, ‘mZd g§gmYZ VWm AÝ¶ OmopI‘m| H$s nhMmZ d ‘yë¶m§H$Z {H$¶m J¶m h¡ &

{ZJ‘ Ho$ {H$gr ^r ì¶mnm[aH$ n[aMmbZ ‘| A§Va{Z{hV OmopI‘m| H$mo nhMmZZo Ho$ {bE n¶m©á OmopI‘ à~§YZ àUmbr h¡ Omo {ZJ‘ Ho$ {H$gr ^r n[aMmbZ ‘| A§Va{Z{hV OmopI‘m| H$s nhMmZ H$aVr h¡ VWm Cggo n[a^m{fV H$aZo, AmH$bZ H$aZo, [anmoQ>© H$aZo, {Z¶§ÌU H$aZo Am¡a H$‘ H$aZo Ho$ {Xem{ZX}e àXmZ H$aVr h¡ &

39


^m.H$.{Z.

C.C.I.

33. AWARDS:

M/s. Anthronik in association with Make in India, supported by SCOPE has awarded 1st prize in the category of Best Government initiative by a PSU in their edition of ‘India Concord Summit & Awards 2018’.

The Standing Conference of Public Enterprises (SCOPE), an apex body of Public Enterprises, has announced the SCOPE Corporate Communication Excellence Awards 2019 on 13thJune 2019. Your Corporation has been awarded 2ndprize in the category of “Effective Use of Digital Media”.

34. ACKNOWLEDGEmENT:

34.1 The Directors wish to place on record their grateful thanks for the guidance and cooperation extended by the Hon’ble Minister of Textiles, Government of India. Thanks are also placed on record to Hon’ble Minister of State for Textiles, Government of India. The Directors also wish to thank the Secretary, Additional Secretary, Joint Secretaries and other officials of the Ministry of Textiles, officials of Ministry of Finance, Ministry of Agriculture and Textile Commissioner and his officials, but for which, to maintain trends that were set earlier in the recent past with regard to working of the Corporation, would not have been possible in the year under review.

34.2 Thanks are also due to Bank of Baroda and other member banks of the Consortium for extending timely help and support to the Corporation. The Directors further desire to place on record their sincere thanks to the Principal Director of Commercial Audit and Ex-Officio Member Audit Board – I for their co-operation.

34.3 Your Directors gratefully acknowledge valuable suggestions and guidance given by the Statutory Auditors M/s. Baweja & Kaul, Chartered Accountants, New Delhi and M/s. G B C A & Associates LLP, Chartered Accountants,

33. nwañH$ma :

‘oqH$J B§{S>¶m Ho$ gh¶moJ go Am¡a ñH$mon Ho$ g‘W©Z go

‘ogg© E§W«mo{ZH$ BZ Agmo{gEeZ H$mo "'B§{S>¶m H$m°ZH$m°S>©

g{‘{V Am¡a nwañH$ma 2018'' Ho$ g§ñH$aU ‘| bmoH$

CnH«$‘ Ûmam gdm}Îm‘ gaH$mar àmoËgmhZ H$s loUr ‘| àW‘

nwañH$ma àXmZ {H$¶m J¶m &

ñQ>¢qS>J H$m°’«|$g Am¡a npãbH$ B§Q>aàmBOog (ñH$mon) H$mo

Omo bmoH$ CÚ‘m| H$s erf© {ZH$m¶ h¡ & CgZo 13 OyZ,

2019 H$mo ñH$mon H$m°nm}aoQ> H$å¶y{ZHo$eZ nwañH$ma H$s

KmofUm H$s h¡& AmnHo$ {ZJ‘ H$mo"' B’o$pŠQ>d ¶yO Am°’$

{S>OrQ>b ‘r{S>¶m'' H$s loUr ‘| {ÛVr¶ nwañH$ma {X¶m J¶m

h¡ &

34. Am^ma :

34.1 AmnHo$ {ZXoeH$JU ‘mZZr¶ dó ‘§Ìr, ^maV gaH$ma Ûmam

{XE JE ‘mJ©Xe©Z Am¡a gh¶moJ Ho$ {bE Am^mar h¢ & ‘mZZr¶

amÁ¶ dó ‘§Ìr, ^maV gaH$ma Ho$ à{V ^r Am^mar h¢&

AmnHo$ {ZXoeH$ g{Md, g§¶wº$ g{Md VWm dó ‘§Ìmb¶

Ho$ AÝ¶ A{YH$m[a¶m|, {dÎm ‘§Ìmb¶ Ho$ A{YH$m[a¶m|,

H¥${f ‘§Ìmb¶ Am¡a dó Am¶wº$ Ho$ H$m¶m©b¶ Am¡a CZHo$

A{YH$m[a¶m| Ho$ à{V CZHo$ Ûmam {XE JE ‘mJ©Xe©Z Ho$ {bE

Am^mar h¢, {OgHo$ A^md ‘| AmnH$m {ZJ‘ g‘rjmJV df©

Ho$ Xm¡amZ {nN>bo df© H$s g’$bVm ~Zm¶o aIZo ‘| g’$b

Zht hmo nmVm &

34.2 AmnHo$ {ZXoeH$JU ~¢H$ Am°’$ ~‹S>m¡Xm Am¡a g§H$m¶ Ho$ AÝ¶

gXñ¶ ~¢H$m| Ûmam {ZJ‘ H$mo g‘¶ na {XE JE CZHo$ gh¶moJ

VWm ‘XX Ho$ à{V Am^mar h¢ & AmJo AmnHo$ {ZXoeH$JU

àYmZ {ZXoeH$ dm{UÁ¶ boIm narjm VWm nXoZ gXñ¶

boIm narjm ‘§S>b - I Am¡a CZHo$ H$‘©Mm[a¶m| Ûmam df© Ho$

Xm¡amZ {ZJ‘ H$mo {XE JE CZHo$ gh¶moJ Ho$ à{V Am^mar

h¢&

34.3 g‘rjmJV df© Ho$ {bE {ZJ‘ Ho$ boIm| H$s narjm H$aVo

g‘¶ {ZJ‘ Ho$ gm§{d{YH$ boIm narjH$ ‘¡gg© ~doOm

E§S> H$m¡b, gZXr boImnmb, ZB© {X„r Am¡a ‘¡gg© Or

~r gr E E§S> Agmo{gEQ²g EbEbnr, gZXr boImnmb,

40

^m.H$.{Z.

C.C.I.


Mumbai during the course of their audit of the accounts of the Corporation for the year under review.

34.4 Our grateful thanks are also due to the National Textile Corporation and its subsidiaries, the State Textile Corporations, Co-operative Spinning Mills and various Private Sector Mills who covered their cotton requirements from your Corporation during 2018-19 thus placing their faith in the quality, price competitiveness and service being rendered by the Corporation. Our sincere thanks are also due to the Confederation of Indian Textile Industry (CITI), Cotton Association of India (CAI), SWCs, CWC for the co-operation extended by these organization to the Corporation.

34.5 Your Directors thank all the officials and staff of the Corporation for their co-operation, concerted efforts and dedication at all levels.

For and on behalf of the Board of Directors

(Dr. P.Alli Rani)Chairman-cum-managing Director

Place : Navi Mumbai

Date : 28 June 2019

‘w§~B© Ûmam {XE JE ~hþ‘yë¶ gwPmd Am¡a ‘mJ©Xe©Z Ho$

{bE AmnHo$ {ZXoeH$ JU Am^mar h¢ &

34.4 AmnHo$ {ZXoeH$ ZoeZb Q>oŠgQ>mB©b H$mnm}aoeZ Am¡a

CZH$s ghm{¶H$mAm|, amÁ¶ dó {ZJ‘, ghH$mar pñnqZJ

{‘b| VWm {d{^Þ {ZOr {‘bm| Ho$ à{V ^r Am^mar h¢,

{OÝhm|Zo df©, 2018-19 Ho$ Xm¡amZ AnZr Amdí¶H$Vm

H$s A{YH$m§e H$nmg, {ZJ‘ go IarXr Am¡a Bg àH$ma

JwUdÎmm, ‘yë¶-à{VñnYm© Am¡a {ZJ‘ Ûmam Xr JB© godmAm|

na {dœmg ~Zm¶o aIm h¢& H$m°Z’o$S>aoeZ Am°’$ B§{S>¶Z

Q>oŠgQ>mBb B§S>ñQ´>r (grAm¶Q>rAm¶), H$m°Q>Z Agmo{gEeZ

Am°’$ B§{S>¶m, amÁ¶ ^§S>ma {ZJ‘ Am¡a Ho$ÝÐr¶ ^§S>ma {ZJ‘

Ûmam {ZJ‘ H$mo {XE JE gh¶moJ Ho$ à{V ^r h‘ Am^mar h¢&

34.5 AmnHo$ {ZXoeH$JU {ZJ‘ Ho$ g^r A{YH$m[a¶m| Ed§

H$‘©Mm[a¶m| Ho$ Am^mar h¢, {OÝhm|Zo g^r ñVam| na AnZm

gh¶moJ, gKZ à¶ËZ Am¡a H$V©ì¶{Zð>m ~Zm¶o aIr &

H¥$Vo Ed§ {ZXoeH$ ‘§S>b H$s Amoa go

(S>m±. nr A{„ amZr)



{XZm§H$ : 28 OyZ 2019

41


^m.H$.{Z.

C.C.I.

ANNuAL REPORT ON CORPORATE SOCIAL RESPONSIBILITY (CSR) ACTIVITIES

[Pursuant to Section 134 (3) (0) of the Companies Act, 2013 read with Rule 8(1) of the Companies (Corporate Social Responsibility) Rules, 2014]

1) Brief outline of the company’s CSR Policy including overview of projects or programme proposed to be undertaken and reference in web link to the CSR policy and projects or programme.

Brief about CCI:

The Cotton Corporation of India Limited (CCI) is a Public Sector Undertaking under the administrative control of Ministry of Textiles, Govt. of India. It is a Nodal Agency of Govt. of India to undertake Minimum Support Price (MSP) operations of cotton when the prices of Fair Average Quality (FAQ) grade seed cotton fall below the MSP level announced by Govt. of India.

Concept of CSR:

• The Department of Public Enterprises (DPE), vide their letter F.No.15(3)/2007-DPE(GM) dated 9th April 2010 has introduced Corporate Social Responsibility for Central Public Sector Enterprises. The CSR was included in MOU from the year 2010-11 onwards. As envisaged in the guidelines of CSR, the corporate performance needs to be matched in terms of economic impact, social impact and environmental impact; commonly called the “Triple Bottom Line”.

• The Ministry of Corporate Affairs (“MCA”) vide its notification dated February 27, 2014

[ZXoeH$ [anmoQ>© H$m n[a{eï> H$ANNEXuRE A TO DIRECTORS REPORT

{ZJ{‘V gm‘m{OH$ Xm{¶Ëd J{V{d{Y¶m| (grEgAma) na dm{f©H$ [anmoQ>©

H§$nZrO, A{Y{Z¶‘, 2013 H$s Ymam 134(3)(Amo) Ho$ AZwgaU ‘| H§$nZrO A{Y{Z¶‘ 2014 ({ZJ{‘V gm‘m{OH$ Xm{¶Ëd) Ho$ {Z¶‘ 8(1) Ho$ gmW nT>m Om¶o &

1) àñVm{dV àmoOoŠQ> AWdm àmoJ«m‘ na H$m¶© VWm grEgAma

Zr{V d àmoOoŠQ>g AWdm àmoJ«m‘ H$s do~ qbH$ ‘| C„oI

g{hV grEgAma Zr{V H$s g§{já ê$naoIm &

H§$nZr H$m g§{já n[aM¶:

^maVr¶ H$nmg {ZJ‘ (grgrAmB©), dó ‘§Ìmb¶, maV

gaH$ma Ho$ àemg{ZH$ {Z¶§ÌU Ho$ AYrZ gmd©O{ZH$

joÌ H$m CÚ‘ h¡ & O~ H$^r C{MV JwUdÎmm dmbo H$nmg

Ho$ ‘yë¶ ZrMo {JaZo bJVo h¢ V~ ^maV gaH$ma Ûmam

Kmo{fV Ý¶yZV‘ g‘W©Z ‘yë¶ ñVa na {ZJ‘ ^maV H$s

ZmoS>b EO|gr Ho$ ê$n ‘| n[aMmbZ H$m H$m¶© H$aVm h¡ &

grEgAma H$s g§H$ënZm:

· gmd©O{ZH$ CÚ‘ (S>rnrB© Zo AnZo {XZm§H$ 9 Aà¡b,

2010 Ho$ nÌ g§. 15(3)/2007 - S>rnrB© (OrE‘)

Ûmam {d{^Þ H|$Ðr¶ gmd©O{ZH$ CnH«$‘m| (grnrEgB©) ‘|

{ZJ{‘V gm‘m{OH$ CÎmaXm{¶Ëd H$m g§H$ën Ama§^ {H$¶m

h¡ & grEgAma H$mo df© 2010-11 go E‘Amo¶y ‘| em{‘b

{H$¶m J¶m & grEgAma Ho$ {Xem{ZX}em| ‘| ~Vm¶o AZwgma

{ZJ{‘V H$m¶©{ZînmXZ H$mo Am{W©H$ à^md, gm‘m{OH$

à^md VWm dmVmdaU à^md ¶m{Z gm‘mÝ¶ Vm¡a na

"'{Q´>nb ~m°Q>‘ bmB©Z'' go ‘¡M {H$¶m OmE &

· H$mnm}aoQ> H$m¶© ‘§Ìmb¶ Zo AnZr A{YgyMZm {X. 27

’$adar, 2014 Ûmam H§$nZr A{Y{Z¶‘ 2013 Ho$ eoS>çyb

42

^m.H$.{Z.

C.C.I.


has notified section 135 and Schedule VII of Companies Act, 2013 and Companies (Corporate Social Responsibility Policy) Rules, 2014. Pursuant to which Companies are required to make expenditure on “CORPORATE SOCIAL RESPONSIBILITY (CSR)” activities which we have already undertaken which is with the compliances of DPE Guidelines. The Companies (Corporate Social Responsibility Policy) Rules, 2014 have come into force from 1st April 2014.

• Taking into consideration of aforesaid CSR guidelines, CCI has been involved in various CSR activities to generate community goodwill, create social impact and visibility. The outline of CCI’s CSR policy is as under:

i) CSR Vision Statement:

• The Corporate Social Responsibility (CSR) is a planned set of activities for CCI which is targeted to have a significant positive impact in the long term taking into consideration the Corporation's capabilities, expectations of the communities living in and around the areas of its operation as well as where it has its presence.

• The aim is to play a catalytic role in the sustainable socio-economic development in the regions where it is located or where its interests lie, attempting to create an enabling working environment for CCI as well as sustained regional development.

ii) CSR Mission:

• To serve the interests of society by taking responsibility for the impact of Corporation’s activities on shareholders and environment in all aspects of its operations.

• Commitment to operate in an economically, socially and environmentally sustainable manner, while recognising the interests of its stakeholders.

VII VWm Ymam 135 VWm H§$nZr A{Y{Z¶{‘V H§$nZr

Xm{¶Ëd nm°{bgr {Z¶‘mdbr 2014 H$mo A{Ygy{MV

{H$¶m h¡ & {OgHo$ AZwgaU ‘| H§$nZrO H$mo ""{ZJ{‘V

gm‘m{OH$ Xm{¶Ëd (grEgAma)'' J{V{d{Y¶m| ‘| ì¶¶

H$aZm Amdí¶H$ h¡ & {OgH$m AZwnmbZ h‘ S>rnrB©

{Xem {ZX}em| Ho$ AZwgma nhbo go hr H$a aho h¡ & H§$nZr

{Z¶‘mdbr 2014 ({ZJ{‘V gm‘m{OH$ Xm{¶Ëd {ZVr)

{X. 01 Aà¡b, 2014 go bmJy hþAm h¡ &

· Cnamoº$ {Xem{ZX}em| H$mo Ü¶mZ ‘| aIVo hþE ^mH${Z

gm‘wXm{¶H$ gØmd, g‘mO na à^md H$m¶‘ aIZo Ed§

nmaX{e©Vm bmZo Ho$ {bE grEgAma J{V{d{Y¶m| H$m

Am¶moOZ H$aVm h¡ & {ZJ‘ H$s grEgAma Zr{V H$s

ê$naoIm {ZåZmZwgma h¡ &

i) grEgAma {dOZ ñQ>oQ>‘|Q> :

· grEgAma grgrAmB© Ho$ {bE EH$ ¶moOZm~Õ

J{V{d{Y¶m± h¡ Omo {ZJ‘ Ho$ g§MmbZ Ho$ joÌ VWm

Amgnmg Amdmgr¶ g‘wXm¶ H$s AnojmAm| H$mo b§~o

g‘¶ VH$ AnZo j‘VmZwgma gH$mamË‘H$ à^md

S>mbZo Ho$ bú¶ na {dMma H$aVm h¡ &

· mH${Z Ohm± pñWV h¡ AWdm Ohm± CZHo$ {hV

b{jV h¡ CZ ñWmZm| na gm‘m{OH$ Am{W©H$

{dH$mg H$mo àmoËgm{hV H$aZo ‘| àoaUmXm¶r ^y{‘H$m

{Z^mZm Vm{H$ mH${Z joÌr¶ {dH$mg H$mo àmoËgm{hV

H$aZo d H$m¶© H$aZo H$m dmVmdaU {Z{‘©V H$a gHo$&

ii) grEgAma {‘eZ :

· BgHo$ g§MmbZ Ho$ g^r nhbwAm| ‘| J«mhH$m|, H$‘©Mm[a¶m|, eo¶aYmaH$m| g‘wXm¶m| na {ZJ‘ H$s J{V{d{Y¶m| Ho$ à^md Am¡a dmVmdaU H$s {Oå‘oXmar boVo hþE g‘mO Ho$ {hV ‘| H$m¶© H$aZm &

· AnZo ñQ>oH$hmoëS>g© Ho$ {hVm| H$mo nhMmZVo hþE Am{W©H$ gm‘m{OH$ VWm AÀN>o dmVmdaU H$mo àmoËgm{hV ê$n go g§Mm{bV H$aZo H$s à{V~ÕVm H$aZm &

43


^m.H$.{Z.

C.C.I.

• To closely linked with the practice of sustainable development and extends beyond philanthropic activities and reaches out to the integration of socio-economic and business goals to secure sustainable competitive advantage.

• Ensure benefits to the smallest unit i.e. village, panchayat, block or district depending upon operations and resource capability of the Corporation.

• To be involved in CSR activities as long term sustainable socio-economic development and expenditure limit of 2% of the average net profits of the company made during the three immediately preceding financial years.

iii) Web link to CSR Policy:

i) Annual Report on CSR activities is also available at the website of the Corporation at www.cotcorp.org.in

2) Composition of the CSR Committee:

Name Designation Category

Dr. P. Alli Rani Chairman-cum-Managing Director Chairperson

Shri Pradeep Kr. Agarwal Director (Finance) Member

Ms. Grace Pinto

Independent Director Member

Ms. Rajika T. Kacheria

Independent Director Member

Shri L.K.Gupta, CGM (Comm/Fin.)/CS, Nodal Officer will facilitate the CSR and sustainability initiatives of the Corporation and report the progress before Board Level Committee.

The terms of reference of the Committee is given below:

Formulate and recommend CSR policy to the Board for approval.

· {dH$mg H$mo ~‹T>mdm XoZo Ho$ CÔoí¶ d bmoH$ CnH$mar

J{V{d{Y¶m| go nao grEgAma Xoe H$mo Omo‹S>Zo Vm{H$

gm‘m{OH$ Am{W©H$ g§JR>Z d ì¶mdgm{¶H$ bú¶m|

VH$ nhþ±Mm Om gHo$ Ed§ CZHo$ à{V¶moJr bm^m| H$mo

gwa{jV d H$m¶‘ aIm Om gHo$ &

· {ZJ‘ Ho$ g§gmYZm| H$s j‘Vm VWm AnZo g§MmbZ H$s AmYma^yV {Z^©aVm H$mo XoIVo hþE N>moQ>r go N>moQ>r BH$mB¶m| O¡go Jm±dm|, n§Mm¶V, ãbm°H$ AWdm {S>ñQ´>rŠQ>

Ho$ bm^m| H$mo gw{Z{üV H$aZm &

· {nN>bo VrZ {dÎmr¶ dfm] Ho$ Xm¡amZ H§$nZr Ho$ ewÕ

bm^m| ‘| go Am¡gVZ 2% VH$ {H$E IMm] Ho$ ^rVa

bm^ hm{Z H$m {dMma {H$E ~J¡a gm‘m{OH$-Am{W©H$

grEgAma J{V{d{Y¶m| H$mo em{‘b H$aZm &

iii) grEgAma Zr{V H$m do~ qbH$ :

i) grEgAma J{V{d{Y¶m| H$s dm{f©H$ [anmoQ>© {ZJ‘ Ho$

do~gmB©Q> www.cotcorp.org.in na CnbãY h¡ &

2. grEgAma g{‘{V H$m JR>Z :

Zm‘ nXZm‘ loUr

S>m°. nr A{„ amZr AÜ¶j Ed§ à~§Y {ZXoeH$ AÜ¶j

lr àXrn Hw$‘ma AJ«dmb

{ZXoeH$({dÎm) gXñ¶

gwlr J«og {nÝQ>mo ñdV§Ì {ZXoeH$ gXñ¶

gwlr a{OH$m Q>r. H$Mo[a¶m

ñdV§Ì {ZXoeH$ gXñ¶

lr Eb.Ho$. Jwám, ‘w»¶ ‘hm à~§YH$ (dm{U./{dÎm)/H§$.g., ZmoS>b

A{YH$mar {ZJ‘ ‘| {ZJ{‘V gm‘m{OH$ Xm{¶Ëd H$mo àma§^ H$aZo ‘|

gh¶moJ H$a|Jo VWm Bg na H$s JB© CÞ{V H$mo ~moS>© ñVa g{‘{V

Ho$ g‘j [anmoQ>© H$a|Jo &

g{‘{V Ho$ H$m¶© {ZåZ{bpIV h¡ :

~moS>© Ho$ AZw‘moXZmW© grEgAma Zr{V gyÌ~Õ d {g’$m[ae

H$aZm

44

^m.H$.{Z.

C.C.I.


Recommend the amount of expenditure to be incurred on the CSR activities in a financial year along with CSR projects to be undertaken earmarking funds for area-wise projects.

Monitor from time to time the implementation of the CSR projects undertaken by the Company.

3) Average net profit of the company for last three financial year i.e. from 2015-16 to 2017-18: Rs. 1888.11 lakhs

4) Prescribed CSR expenditure (two percent of the amount as in item 3 above):

As per the Companies (Corporate Social Responsibility Policy) Rules, 2014 atleast 2% of the average net profits of the company made during the three immediately preceding financial years should be allocated to CSR. In view of these guidelines, Rs.37.76 lakhs is budgeted for undertaking CSR activities for 2018-19.

5) Details of CSR spent during the financial year :

a) Total amount to be spent for the financial year:

2% of the average net profits made during the three immediately preceding financial years i.e. Rs.37.76 lakhs.

b) Amount unspent, if any : Nil

{dÎmr¶ df© ‘| joÌdma àmoOoŠQ>g Ho$ {bE {Z{Y ~VmVo

hþE àmoOoŠQ>g g{hV grEgAma J{V{d{Y¶m| na {H$E

OmZodmbo IM© H$s am{e H$mo {g’$m[ae H$aZm &

H§$nZr Ûmam {bE JE grEgAma àmoOoŠQ>g Ho$ H$m¶m©Ýd¶Z

na g‘¶-g‘¶ na {Z¶§ÌU aIZm &

3) {nN>bo VrZ {dÎmr¶ dfm] Ho$ {bE H§$nZr H$m ewÕ Am¡gV bm^ ¶m{Z 2015-16 go 2017-18 : ê$. 1888.11 bmI

4) {ZYm©[aV grEgAma ì¶¶ (Cnamoº$ ‘X g§. 3 ‘| ~Vm¶o

AZwgma am{e H$m 2%)

H§$nZr {Z¶‘mdbr 2014 Ho$ AZwgma (grEgAma Zr{V)

{nN>bo VrZ {dÎmr¶ dfm] Ho$ Xm¡amZ H§$nZr Ûmam ewÕ Am¡gV

bm^ H$m H$‘ go H$‘ 2% grEgAma H$mo Am~§{Q>V {H$¶m

OmZm Mm{h¶o & BZ ‘mJ©Xe©Zm| H$mo XoIVo hþE df© 2018-

19 hoVw grEgAma J{V{d{Y¶m| Ho$ A§VJ©V H$m¶© H$aZo hoVw

37.76 bmI ê$. ~OQ> ~Zm¶m J¶m h¡ &

5) {dÎmr¶ df© Ho$ Xm¡amZ grEgAma IM© H$m {ddaU :

H$) {dÎmr¶ df© Ho$ {bE ì¶¶ H$s OmZodmbr Hw$b am{e:

VrZ nyd©dVu {dÎmr¶ dfm] Ho$ Xm¡amZ Am¡gV ewÕ bm^m| go Ý¶yZV‘ 2% ¶m{Z 37.76 bmI ê$ IM©

{H$¶m Om¶oJm &

I) IM© Z H$s JB© am{e, ¶{X H$moB© hmo : {Zb

45


^m.H$.{Z.

C.C.I.

J) df© 2018-19 Ho$ Xm¡amZ grEgAma J{V{d{Y¶m±: {dÎmr¶ df© 2018-19 Ho$ Xm¡amZ IM© H$s JB© am{e Ho$ {ddaU {ZåZmZwgma h¡ :

c) CSR Activities for 2018-19: Manner in which the amount spent during the financial year 2018-19 is detailed below:

joÌ Sector

grEgAma J{V{d{Y¶m| H$m {ddaU/ñWmZDetails of CSR activities undertaken/

Location

B§pßb‘|qQ>J EO|gr H$m Zm‘Name of Implementing

Agency

IM© H$s JB© am{e (ê$. bmI ‘|)

Expenditure(Rs. in Lakhs)~OQ

BudgetdmñV{dH$ Actual

ñdÀN> ^maV {‘eZ

Ho$ VhV ñdÀN>Vm

Am¡a {ZdmaH$ ñdmñÏ¶

XoI^mb (H§$nZrO

A{Y{Z¶‘ 2013 Ho$

eoS>çyb VII H$s ‘X g§.(i) Promoting sanitation & preventive health care under Swachh Bharat Mission: Item No. (i) of Schedule-VII of Companies Act, 2013

Vob§JmZm amÁ¶ ‘| ‘wbwJw, Am{g’$m~mX ‘| aqZJ

dmQ>a H$s gw{dYm Ho$ gmW {Obm n[afX hmB© ñHy$b

‘| ~m{bH$mAm| Ho$ {bE em¡Mmb¶ ~ZdmZo H$m H$m¶©

{H$¶m Construction of Girls Toilets with running water facility in Zilla Parishad Girls High School, Mulugu, in Asifabad aspirational district, Telangana

g‘J« {ejm B§Or{Z¶g© (EgEgE

{gdrb qdJ) {ejm {d^mJ, {Obm

{ejm A{YH$mar H$m H$m¶m©b¶,

Am{g’$m~mX Samagra Shiksha Engineers (SSA Civil Wing), Education Department, Office of District Education Officer, Asifabad

3.00 3.00

Vob§JmZm amÁ¶ ‘| ‘wbwJw, ^ynbmnbr ‘| aqZJ dmQ>a

H$s gw{dYm Ho$ gmW {Obm n[afX hmB© ñHy$b ‘|

~m{bH$mAm| Ho$ {bE em¡Mmb¶ ~ZdmZo H$m H$m¶©

{H$¶m Construction of Girls Toilets with running water facility in Zilla Parishad Girls High School, Mulugu, Bhooplapali aspirational district, Telangana

EZOrAmo ‘ogg© gy¶m© {H$aU dob’o$¶a

gmogm¶Q>r NGO M/S. Surya Kiran Welfare Society

3.00 3.00

H$Zm©Q>H$m amÁ¶ ‘| XodXþJm©, am¶Mya ‘| aqZJ dmQ>a

H$s gw{dYm Ho$ gmW gaH$mar ñHy$b ‘| ~m{bH$mAm|

Ho$ {bE em¡Mmb¶ ~ZdmZo H$m H$m¶© {H$¶m Construction of Girls Toilets with running water facility in Govt. Girls High School, Devdurga, Raichur aspirational district, Karnataka

EZOrAmo OZgodm à{Vð>mZNGO Janaseva Prathisthana

3.00 3.00

H$Zm©Q>H$m amÁ¶ ‘| ¶mXJra ‘| aqZJ dmQ>a H$s

gw{dYm Ho$ gmW gaH$mar ñHy$b ‘| ~m{bH$mAm| Ho$

{bE em¡Mmb¶ ~ZdmZo H$m H$m¶© {H$¶m Construction of Girls Toilets with running water facility in Govt. High School, Yadgir aspirational district, Karnataka

EZOrAmo H$m{bHo$> Q>mQ>m Q´>ñQ> Ho$

A§VJ©V g‘¥{Õ CnH«$‘ NGO Kalikae Samruddhi Upakram under Tata Trusts

3.00 3.00

ñdÀN> ^maV H$moe Ho$ {bE A§eXmZ Contribution to Swachh Bharat Kosh

grgrAmB© Ûmam grYoDirectly by CCI

1.00 1.00

46

^m.H$.{Z.

C.C.I.


XoI^mb VWm {ZdmaH$

ñdmñÏ¶ XoI^mb H$mo

~‹T>mdm XoZm & H§$nZrO

A{Y{Z¶‘ 2013 Ho$

eoS>çyb VII H$s ‘X

g§.(i) Promoting health care including preventive health care: Item No. (i) of Schedule-VII of Companies Act, 2013

212 Z§~a H$s h¢S> ßbH$a ‘erZ AmH$m§jmË‘H$

{Obm| Ho$ H$nmg {H$gmZm| H$mo O¡go H$Zm©Q>H$m

amÁ¶ (56 ZJ) Vob§JmZm amÁ¶ ‘| Am{g’$m~mX

Am¡a ^ynmbn„r, (56 ZJ) Am¡a Amo{‹S>gm amÁ¶

(100 ZJ) ‘| am¶J‹S>m, H$mbmh§S>r Am¡a ~mbm§Jra

‘| {dVarV H$s JB© & Distributed 212 nos of hand-held kapas plucker machine to cotton farmers in the aspirational districts Raichur & Yadgir in the state of Karnataka (56 nos), Asifabad & Bhooplapali in the state of Telangana (56 no.) and Raygada, Kalahandi & Balangir in the state of Odisha (100 nos.)

H|$Ð gaH$ma /EnrE‘gr Ho$ gh¶moJ

go grgrAmB© Ûmam grYoDirectly by CCI with the help of State Government / APMC

15.37 15.37

{H$gmZ ‘obm| H$m Am¶moOZOrganising kisan melas


go grgrAmB© Ûmam grYoDirectly by CCI with the help of State Govt./ APMC

1.14 1.14

{ejm H$mo ~‹T>mdm XoZo

H$s Iwer & H§$nZrO

A{Y{Z¶‘ 2013 Ho$

eoS>çyb VII H$s ‘X

g§.(ii)Joy of Giving: Promoting education: Item No.(ii) of Schedule-VII of Companies Act, 2013

Vob§JmZm amÁ¶ ‘| Am{g’$m~mX E§S> ^ynbmn{„Z

VWm H$Zm©Q>H$ amÁ¶ ‘| am¶Mya E§S> ¶mXJra

4 AmH$m§jr {Obm| ‘| gaH$mar nmR>embmAm| ‘|

S>oŠgQ>mn H§$ß¶yQ>a Ho$ gmW ¶ynrEg VWm qàQ>a

àXmZ {H$E &To provide desktop computer along with UPS and printer to four Govt Schools in the four aspirational districts viz Raichur & Yadgir in the state of Karnataka, Asifabad & Bhooplapali in the state of Telangana


go grgrAmB© Ûmam grYoDirectly by CCI with the help of State Government / APMC

4.00 4.03

{ZdmaH$ ñdmñÏ¶

XoI^mb Am¡a

n¶m©daUr¶ pñWaVm H$mo

~‹T>mdm XoZmPromoting Preventive health care and environmental sustainability

ñdÀN> J§Jm {Z{Y Ho$ {bE A§eXmZContribution to Clean ganga Funds

grgrAmB© Ûmam grYo Directly by CCI

2.25 2.25

AÞm {dœ{dÚmb¶ H¢$ng H$mo¶§~Îmya ‘| d¥jm amonUTree plantation in the Anna University, Coimbatore campus.

EZOrAmo, grê$Wwbr, Zm°¶b bmB’$

g|Q>a, H$mo¶§~ÎmyaNGO, Siruthuli, Noyyal Life Centre, Coimbatore 1.00 1.00

47


^m.H$.{Z.

C.C.I.

geó g¡Ý¶ ~b Ho$

g¡{ZH$, dm°a {dS>mo VWm

CZHo$ Am{lVm| Ho$ {hVm|

Ho$ {bE (‘X g§.(vi) Ho$ eoS>çyb-VII)

Benefit to armed forces veterans, war widows and their dependents (Item No. (vi) of Schedule-VII)

geó g¡Ý¶ ~b Ho$ g¡{ZH$ ¶wÕ ‘| hþB© {dYdmAm|

VWm CZHo$ Am{lVm| Ho$ {hVm| Ho$ {bE geó ~b

ÜdO {Xdg {Z{Y ‘| A§eXmZ {X¶m Contribution in Armed Forces Flag Day Fund for the benefit of armed forces veteran, war widows and the dependents

grgrAmB© Ûmam grYoDirectly by CCI

1.00 1.00

Hw$b / Total 37.76 37.79

6) {nN>bo VrZ {dÎmr¶ dfm] Ho$ ewÕ Am¡gV bm^ H$m 2% ì¶¶ Z H$aZo H$m H$maU :6) Reasons for not spending the 2% of average net profit of last three financial years :

7) grEgAma g{‘{V Ho$ CÎmaXm{¶Ëd H$s {ddaUr7) Responsibility statement of the CSR Committee :

^mH${Z ‘| grEgAma Zr{V H$m H$m¶m©Ýd¶Z d {Z¶§ÌU grEgAma CÔoí¶ d H§$nZr Zr{V Ho$ AZwnmbZ Ho$ AZwgma hmoVm h¡ & The implementation and monitoring of CCI’s CSR Policy is in compliance with CSR objectives and Policy of

the Company.

Eb.Ho$. JwßVm‘w»¶ ‘hm à~§YH$(dm{U./{dÎm)

Ed§ ZmoS>b A{YH$mar - grEgAma

(L.K. GUPTA)CGM (COMM./FIN.)

& NODAL OFFICER-CSR

(lr‘Vr am{OH$m Q>r. H$Mo[a¶m)(MS. RAJIKA T. KACHERIA)

(ñdV§Ì {ZXoeH$)(INDEPENDENT DIRECTOR)

(lr‘Vr J«og qnQ>mo)(MS. GRACE PINTO)

(ñdV§Ì {ZXoeH$)(INDEPENDENT DIRECTOR)

(àXrn Hw$‘ma AJ«dmb)(PRADEEP KUMAR AGARWAL)

{ZXoeH$ ({dÎm)DIRECTOR (FINANCE)

(S>m°. nr. A{„ amZr)(DR. P. ALLI RANI)AÜ¶j Ed§ à~§Y {ZXoeH$

CHAIRMAN-CUM- MANAGING DIRECTOR

48

^m.H$.{Z.

C.C.I.


ADDENDUM TO DIRECTOR’S REPORT FOR THE YEAR 2018-19

Qualified opinion of the Auditors on the Internal Financial Control (IFC) under Clause no (i) of Sub-section 3 of section 143 of the Companies Act, 2013 ("the Act")

Except for the possible effects of the material weakness described in the Basis for Qualified Opinion in Annexure - C to the Independent Auditor’s Report, the Company has, in all material respects, adequate internal financial controls over financial reporting with reference to these financial statements and such internal financial controls over financial reporting with reference to these financial statements were operating effectively as at March 31, 2019, based on the internal control over financial reporting criteria established by the Company considering the essential components of internal control stated in the Guidance Note on Audit of internal Financial controls over Financial Reporting issued by ICAI.

We have considered the material weakness identified and reported above in determining the nature timing and extent of audit tests applied in our audit of Ind AS financial statements of the Company as at and for the year ended 31st March 2019 and the material weakness do not affect our opinion on the Ind AS financial statements of the Company.

Reply of the Management

The Corporation has in house independent internal audit department and at each branch independent internal audit officials are posted. The internal audit officials of the Corporation are fully independent of any other functions like authorising transactions, recording transactions, and maintaining custody of assets i.e. segregation based on maker and checker and hence there is no conflict of interest at any stage. Further, the fixed assets are periodically verified by the internal audit officials of the Corporation, who are independent of the officials maintaining custody of assets. There are proper allocation of roles and duties amongst various officials posted in different sections as well as in internal audit department. The duties assigned to internal auditors are adequate to safeguard the assets of the company.

df© 2018-19 Ho$ {bE {ZXoeH$ [anmoQ>© H$m n[a{eï>

H§$nZr A{Y{Z¶‘ H$s Ymam 143 CnYmam 3 IÊS> (i) Ho$

A§VJ©V Am§V[aH$ {dÎmr¶ {Z¶§ÌU na boIm n[ajH$m| H$s

‘¶m©{XV A§Ho$jU [anmoQ>©

ñdV§Ì boIm narjH$ H$s [anmoQ>© Ho$ A§VJ©V {deof am¶ Ho$ AmYma

na {XE JE VÏ¶JV H${‘¶m| Ho$ g§^mì¶ à^md Ho$ A{V[aº$ H§$nZr

‘| g^r VÏ¶m| Ho$ g§~§Y ‘|, BZ {dÎmr¶ {dda{U¶m| Ho$ g§X^© ‘|

{dÎmr¶ [anmo{Qª>J Ho$ AmYma na ¶Woð> Am§V[aH$ {dÎmr¶ {Z¶§ÌU

Ed§ BZ {dÎmr¶ {dda{U¶m| Ho$ AmYma na Bg àH$ma Ho$ Am§V[aH$

{dÎmr¶ {Z¶§ÌU H$m H§$nZr Ûmam ñWm{nV {dÎmr¶ [anmo{Qª>J ‘mZX§S>

H$mo Ü¶mZ ‘| aIVo hþE Am§V[aH$ {dÎmr¶ {Z¶§ÌU Ho$ AmYma na

Am¡a AmB©grAmB©E Ûmam Omar {dÎmr¶ [anmo{Qª>J Ho$ AmYma na

Am§V[aH$ {dÎmr¶ {Z¶§ÌU boIm narjm na ‘mJ©Xeu {Q>ßnUr ‘|

d{U©V Am§V[aH$ {Z¶§ÌU Ho$ A{Zdm¶© KQ>H$m| na Ü¶mZ XoVo hþE 31

‘mM©, 2019 VH$ H$maJa VarHo$ go àMmbZ ‘| Wr &

h‘Zo VÏ¶JV H${‘¶m| na Ü¶mZ {X¶m h¡ Am¡a ZoMa Q>mB©q‘J Ho$

{ZYm©aU ‘| VWm 31 ‘mM© 2019 H$o df© g‘már Ed§ CgHo$ Xm¡amZ

H§$nZr Ho$ B§S> EEg {dÎmr¶ {ddaU H$s boIm narjm ‘| à¶wº$ boIm

narjm Q>oñQ> H$s gr‘m VH$ Cn¶w©º$ Ho$ ~mao ‘| [anmoQ>© {H$¶m h¡ Ed§

VÏ¶JV H${‘¶m| go H§$nZr Ho$ B§S>EEg {dÎmr¶ {ddaU na h‘mar

am¶ ‘| H$moB© à^md Zht n‹S>oJm &

à~§YZ H$m CÎma

{ZJ‘ ‘| ñdV§Ì ê$n go Am§V[aH$ boIm narjm {d^mJ H$s ì¶dñWm h¡ Am¡a àË¶oH$ emIm ‘| ñdV§Ì ê$n go Am§V[aH$ boIm narjH$ H$s {Z¶w{º$ H$s JB© h¡ & {ZJ‘ Ho$ Am§V[aH$ boIm narjm AÝ¶ Xÿgao H$m¶m} Ho$ {bE nyU©V: ñdV§Ì h¡ & O¡go {H$ boZ-XoZ H$m àm{YH$ma, boZ-XoZ H$m [aH$mS>© H$aZm Am¡a {Z‘m©UH$Vm© Ed§ Om§MH$Vm© Ho$ AmYma na eoJ«oJoeZ (n¥WH$H$aU) H$aVo hþE n[ag§n{Îm¶m| H$s A{dajm AV: {H$gr r Xem ‘| {hV ‘| H$moB© Q>H$amd Zht h¡ & BgHo$ Abmdm AMyH$ n[ag§n{Îm¶m| H$s {ZJ‘ Ho$ Am§V[aH$ boIm narjm Ho$ Ûmam Amd{YH$ ê$n go gË¶mnZ {H$¶m OmVm h¡, Omo n[ag§n{Îm¶m| H$s ajm H$aZo dmbo A{YH$m[a¶m| go AbJ h¡& {d{^Þ AZw mJ Am¡a Am§V[aH$ boIm narjm {d^mJ ‘| {Z¶wº$ {d{^Þ H$‘©Mm[a¶m| Ho$ ~rM CZH$s y{‘H$m Am¡a H$V©ì¶m| H$m C{MV ê$n go {ZYm©aU {H$¶m J¶m h¡ & Am§V[aH$ boIm narjH$mo H$mo {ZYm©[aV CZH$s S>¶yQ>r H§$nZr H$s n[ag§n{Îm¶m| H$s ajm H$aZo Ho$ {bE ¶^rï> h¡ &

49


^m.H$.{Z.

C.C.I.

In addition to in-house internal audit cell, the Audit Committee of the Corporation, in order to further strengthen the internal audit functions, initially decided to appoint external audit CA firms at eight branches upto FY 2017-18 and at all the 16 operational branches w.e.f. financial year 2018-19 to conduct monthly internal audit of the branches.The external audit firms were appointed by each branch, by following open tender procedure. The appointment of external audit firms was placed before the audit committee for its approval. These firms submit their monthly report directly to head office after obtaining comments of the branch online, for placing before the audit committee of the Corporation.

All the monthly audit reports are compiled at Corporate Office and submitted directly to the audit committee for their review. However, Audit Committee in its meeting held on 23rd February 2018, directed to place summarized monthly audit report before the Audit Committee. Accordingly, the salient features of the audit reports requiring immediate attention are being placed before the Audit Committee. This is with a view to place the audit reports in better and precise manner and also to enable the Audit Committee to review important observations.

The internal audit cell at head office just compilesaudit reports and submits to the management/audit committee. Hence, there is no conflict of interest as maker and checkers at any stage, as there is proper segregation of duties. The CGM (Fin/Com) only acts as a coordinator and ensures submission of reports to the audit committee.

for and on behalf of Board of Directors

sd/-(Dr. P. Alli Rani)

Chairman-cum-Managing Director


Am§V[aH$ boIm narjm {d^mJ H$s ì¶dñWm Ho$ Abmdm {ZJ‘ ‘| boIm narjm g{‘{V H$s ^r ì¶dñWm H$s JB© h¡, {Oggo Am§V[aH$ boIm narjm Ho$ H$m¶m] H$mo gwÑT> {H$¶m Om gHo$ & àma§^ ‘| {dÎmr¶ df© 2017-18 VH$ 8 emImAm| ‘| dmø boIm narjm grE ’$‘m} H$mo {Z¶wº$ {H$E OmZo H$m {ZU©¶ {b¶m J¶m Wm Am¡a ¶hr ì¶dñWm {dÎmr¶ df© 2018-19 go g^r 16 àMmbZ emImAm| ‘| H$s JB©, {Oggo emImAm| H$s ‘m{gH$ ê$n go Am§V[aH$ boIm narjm H$s Om gHo$ & Iwbr {Z{dXm à{H$¶m H$m nmbZ H$aVo hþE àË¶oH$ emIm H$m¶m©b¶ Ûmam dmø boIm narjm ’$‘m} H$s {Z¶w{º$ H$mo AZw‘moXZ Ho$ {bE boIm narjm g{‘{V Ho$ g‘j àñVwV {H$¶m J¶m & ¶h ’$‘] Am°ZbmB©Z ì¶dñWm Ûmam emImAm| go CZH$s {Q>ßnUr àmá H$aZo Ho$ nümV grYo Vm¡a na ‘w»¶mb¶ H$mo AnZr [anmoQ>© H$aVr h¢, {Oggo Cgo {ZJ‘ H$s boIm narjm g{‘{V Ho$ g‘j aIm Om

gHo$ &

g^r boIm narjm [anmoQ>m] H$mo {ZJ‘ ‘| g§H${bV {H$¶m OmVm h¡

Am¡a grYo hr boIm narjm g{‘{V H$mo CZH$s g‘rjm Ho$ {bE

àñVwV {H$¶m OmVm h¡ VWm{n boIm narjm g{‘{V {OgH$s ~¡R>H$

23 ’$adar, 2018 H$mo Am¶mo{OV H$s JB© Wr CgZo ¶h {ZX}e

{X¶m J¶m {H$ boIm narjm g{‘{V Ho$ g‘j ‘m{gH$ ê$n go boIm

narjm H$s gma [anmoQ>© H$s OmE & VX²Zwgma Vwa§V Ü¶mZ {XE OmZo

dmbo boIm narjm [anmoQ>m} Ho$ ‘hÎdnyU© VÏ¶ boIm narjm g{‘{V

Ho$ g‘j bm¶o OmVo aho & ¶h Bg Ñ{ï> go h¡ {H$ boIm narjm [anmoQ>©

H$mo ~ohVa VarHo$ go Cgo g§{já ê$n go àñVwV {H$¶m OmE, {Oggo

boIm narjm g{‘{V ‘hÎdnyU© {Q>ßn{U¶m| H$s g‘rjm H$a gHo$ &

‘w»¶mb¶ ‘| Am§V[aH$ boIm narjm {d^mJ boIm narjm [anmoQ>m} H$mo g§^m{dV H$aVm h¡ Am¡a Cgo à~§YZ / boIm narjm g{‘{V H$mo àñVwV H$aVm h¡ & AV: {H$gr ^r Xem ‘| H$moB© Q>H$amd Zht h¡ Š¶m|{H$ CZHo$ H$V©ì¶m| H$mo C{MV {ZYm©aU {H$¶m J¶m h¡ & ‘w»¶ ‘hm à~§YH$ ({dÎm/dm{U.) {g’©$ g‘Ýd¶H$ H$m H$m¶© H$aVo h¢ Am¡a boIm narjm g{‘{V H$mo [anmoQ>© àñVwV {H$E OmZo H$mo gw{Z{üV

H$aVo h¡ &

H¥$Vo Ed§ {ZXoeH$ ‘§S>b H$s Amoa go

hñVm/- (S>m°. nr A{„ amZr)


ñWmZ : Zdt ‘w~B©

{XZm§H$ : 30.08.2019

50

^m.H$.{Z.

C.C.I.


H§$nZr A{Y{Z¶‘, 2013 H$s Ymam 143(6)(I) Ho$ AYrZ 31 ‘mM©, 2019 H$mo g‘má df© Ho$ {bE ^maVr¶ H$nmg {ZJ‘ {b{‘Q>oS> Ho$ boIm| na {Z¶§ÌH$ Ed§ ^maV Ho$ ‘hmnarjH$ H$s {Q>ßn{U¶m±

COMMENTS OF THE COMPTROLLER AND AUDITOR GENERAL OF INDIA UNDER SECTION 143(6)(b) OF THE COMPANIES ACT, 2013 ON THE FINANCIAL STATEMENTS OF THE COTTON CORPORATION OF

INDIA LIMITED FOR THE YEAR ENDED 31 MARCH 2019

The preparation of financial statements of The Cotton Corporation of India Limited for the year ended 31 March 2019 in accordance with the financial reporting framework prescribed under the companies Act.2013 (Act) is the responsibility of the management of the company. The statutory auditors appointed by the Comptroller and Auditor General of India under section 139(5) of the Act are responsible for expressing opinion on the Financial Statements under section 143 of the Act based on independent audit in accordance with the standards on auditing prescribed under section 143(10) of the Act. This is stated to have been done by them vide their Audit Report dated 28 June 2019.

I, on behalf of the Comptroller and Auditor General of India, have conducted a supplementary audit of the financial statements of The Cotton Corporation of India Limited for the year ended 31 March 2019 under section 143 (6) (a) of the Act. This supplementary audit has been carried out independently without access to the working papers of the statutory auditors and is limited primarily to inquiries of the statutory auditors and company personnel and a selective examination of some of the accounting records.

On the basis of my supplementary audit nothing significant has come to my knowledge which would give rise to any comment upon or supplement to statutory auditors report under section 143 (6) (b) of the Act.

For and on the behalf of the Comptroller & Auditor General of India

Sd/-(Roop Rashi)

Director General of Commercial Audit & Ex-officio Member, Audit Board-I, Mumbai

Place : MumbaiDate : 27.08.2019

H§$nZr A{Y{Z¶‘ 2013 (A{Y{Z¶‘) Ho$ AYrZ {ZYm©[aV {dÎmr¶ ‘mZX§S>m| Ho$ AZwgma 31 ‘mM© 2019 H$mo g‘mßV df© Ho$ {bE ^maVr¶ H$nmg {ZJ‘ {b{‘Q>oS> H$s {dÎmr¶ {ddaUr V¡¶ma H$aZm H§$nZr H$s à~§YZ ì¶dñWm H$m CÎmaXm{¶Ëd h¡ & A{Y{Z¶‘ H$s Ymam 139(5) Ho$ AYrZ {Z¶§ÌH$ Ed§ ^maV Ho$ ‘hmboIm narjH$ Ûmam {Z¶wº$ gm§{d{YH$ boIm narjH$ H§$nZr A{Y{Z¶‘ H$s Ymam 143 Ho$ AYrZ BZ {dÎmr¶ {dda{U¶m| na am¶ ì¶º$ H$aZo Ho$ {bE CÎmaXm¶r h¡, Omo boIm narjm Ho$ AZwgaU ‘| ñdV§Ì boIm narjm Am¡a A{Y{Z¶‘ H$s Ymam 143 (10) Ho$ A§VJ©V {ZYm©[aV AmœmgZ ‘mZX§S> na AmYm[aV ~Vm¶m J¶m h¡ & ¶h CZHo$ Ûmam AnZr Am°{S>Q> [anmoQ>© {XZm§H$ 28 OyZ 2019 H$mo {H$¶m J¶m Wm &

‘¢Zo, {Z¶§ÌH$ Ed§ ^maV Ho$ ‘hmboIm narjm H$s Amoa go 31 ‘mM© 2019 H$mo g‘mßV df© Ho$ {bE ^maVr¶ H$nmg {ZJ‘ {b{‘Q>oS> H$s {dÎmr¶ {dda{U¶m| H$s Ymam 143 (6)(A) Ho$ A{YZ AZwnyaH$ boIm narjm H$s h¡ & ¶h AZwnyaH$ boIm narjm gm§{d{YH$ boIm narjH$m| Ho$ d{Hª$J H$mJOmV Ho$ {~Zm ñdV§Ì ê$n go H$s J¶r h¡ VWm gm§{d{YH$ boIm narjH$m| Ho$ àým| Am¡a H§$nZr H$m{‘©H$ Ed§ Hw$N> boIm [aH$m°S>© H$s M¶ZmË‘H$ Om±M VH$

‘w»¶V: gr{‘V h¡ &

‘oao nyaH$ Am°{S>Q> Ho$ AmYma na ‘oao kmZ ‘| Hw$N> ^r ‘hÎdnyU© Zhr Am¶m h¡ & Omo A{Y{Z¶‘ H$s Ymam 143(6)(I) Ho$ VhV d¡Ym{ZH$ boIm n[ajH$m| H$s {Q>ßnUr Am¡a nyaH$ H$mo CËnÞ H$aVm hmo &

H¥$Vo Am¡a {Z¶§ÌH$ Ed§ ^maV Ho$ ‘hmboImnarjH$ H$s Amoa go

hñVm/-(én am{e)

‘hm{ZXoeH$, dm{UÁ¶H$ boIm narjm Ed§ nXoZ gXñ¶, boIm narjm ‘§S>b - 1, ‘w§~B©

ñWmZ : ‘w§~B©{XZm§H$ : 27.08.2019

51


^m.H$.{Z.

C.C.I.

To,

The members of the Cotton Corporation of India Limited

Report on the Audit of the Ind AS Financial Statements

Opinion

We have audited the Ind AS financial statements of The Cotton Corporation of India Limited ("the Company"), which comprise the Balance Sheet as at 31st March, 2019, the Statement of Profit and Loss (including other comprehensive income), the Statement of Cash Flows and the Statement of Changes in Equity for the year then ended and notes to financial statements, including a summary of the significant accounting policies and other explanatory information.

In our opinion and to the best of our information and according to the explanations given to us, the aforesaid Ind AS financial statements give the information required by the Companies Act, 2013, as amended ("the Act") in the manner so required and give a true and fair view in conformity with the accounting principles generally accepted in India including Indian Accounting Standards (‘Ind AS’) specified under Section 133 of the Act, of the state of affairs (financial position) of the Company as at 31 March 2019, and its profit (financial performance including other comprehensive income), its cash flows and the changes in equity for the year ended on that date.

Basis for Opinion

We conducted our audit of Ind AS financial statements in accordance with the Standards on Auditing (SAs), as specified under Section 143 (10) of the act. Our responsibilities under those Standards are further described in the Auditor's Responsibilities for the Audit of the Financial Statements section of our report. We are independent of the Company in accordance

ñdV§Ì boIm narjH$m| H$s [anmoQ>© $INDEPENDENT AuDITOR’S REPORT

à{V,

^maVr` H$nmg {ZJ‘ {b{‘Q>oS> Ho$ gXñ`JU

B§S>EEg {dÎmr` {dda{U`m| Ho$ AmYma> na [anmoQ>©

am`

h‘Zo ^maVr¶ H$nmg {ZJ‘ {b{‘Q>oS> (H§$nZr) Ho$ B§S> EEg

{dÎmr¶ {ddaUm| H$m Am°{S>Q> {H$¶m h¡, {Og‘| 31 ‘mM©, 2019

H$m VwbZ nÌ Am¡a Cg g‘má df© Ho$ {b¶o bm^ Ed§ hm{Z

H$m {ddaU (AÝ¶ ì¶mnH$ Am¶ g{hV), ZJX àdmh {ddaU

Am¡a B{¹$Q>r ‘| n[adV©Z {ddaU Am¡a ‘hÎdnyU© boIm Zr{V¶m|

Am¡a AÝ¶ ì¶m»¶mË‘H$ OmZH$mar H$m gmam§e em{‘b H$aVo hþE

{dÎmr¶ {ddaUm| Ho$ {bE ZmoQ²g em{‘b h¡ &

h‘mar am¶ ‘| Am¡a h‘mar OmZH$mar Ho$ AZwgma Am¡a h‘| {XE

JE ñnï>rH$aU Ho$ AZwgma Cn¶wº$ B§S> EEg {dÎmr¶ {dda{U¶m§,

H§$nZr A{Y{Z¶‘, 2013, O¡go g§gmo{YV hþAm h¡ (A{Y{Z¶‘),

H$s Anojm AZwgma OmZH$mar XoVo h¢ Am¡a ^maV ‘| gm‘mÝ¶ ê$n

go ñdrH¥$V boIm {gÕm§Vm| Ho$ AZwgma, A{Y{Z¶‘ H$s Ymam

133 Ho$ VhV ^maVr¶ boIm ‘mZH$ (B§S> EEg) Ho$ AZwgma

31 ‘mM© 2019 H$mo H§$nZr Ho$ H$m¶©H$bmnm| VWm Cgr {XZ

g‘má df© Ho$ {b¶o bm^ Ed§ hm{Z H$m {ddaU (AÝ¶ ì¶mnH$

Am¶ g{hV), ZJX àdmh {ddaU Am¡a B{¹$Q>r ‘| n[adV©Z

{ddaU gË¶ Ed§ {Zînj Vñdra àñVwV H$aVo h¢ &

am¶ Ho$ {bE AmYma

h‘Zo A{Y{Z¶‘ H$s Ymam 143 (10) Ho$ VhV {Z{X©ï> Am°{S>Q>

Ho$ ‘mZH$m| (EgE Eg) Ho$ AZwgma, B§S> EEg {dÎmr¶ {ddaUm|

H$m Am°{S>Q> {H$¶m h¡ & CZ ‘mZH$m| Ho$ VhV h‘mar {Oå‘oXm[a¶m|

H$mo h‘mar [anmoQ>© Ho$ {dÎmr¶ {ddaUm| H$s boIm narjm Ho$ {bE

boIm narjH$ H$s {Oå‘oXm[a¶m| ‘| AmJo d{U©V {H$¶m J¶m h¡ &

B§ñQ>rQ>çyQ> Am°’$ MmQ>©S>© AH$mC§Q>|Q²g Am°’$ B§{S>¶m Ûmam Omar 'H$moS>

52

^m.H$.{Z.

C.C.I.


with the 'Code of Ethics' issued by the Institute of Chartered Accountants of India together with the ethical requirements that are relevant to our audit of the financial statements under the provisions of the Act and the Rules thereunder, and we have fulfilled our ethical responsibilities in accordance with these requirements and the Code of Ethics. We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our audit opinion on the Ind AS financial statements.

Information Other than the Financial Statements and Auditor's Report Thereon

The Company’s Board of Directors is responsible for the preparation of other information.

The other information comprises the information included in the Annual report but does not include the Ind AS financial statements and our auditor’s report thereon ('Other Information').

The Other Information is expected to be made available to us after the date of this auditor's report. Our opinion on the Ind AS financial statements does not cover the other information and we do not express any form of assurance conclusion thereon.

In connection with our audit of the Ind AS financial statements, our responsibility is to read the other information and, in doing so, consider whether such other information is materially inconsistent with the financial statements or our knowledge obtained in the audit or otherwise appears to be materially misstated.

When we read the other information and if we conclude that there is a material misstatement therein, we are required to communicate the matter to those charged with governance as required under SA 720 'The Auditor's responsibilities Relating to Other Information.

Responsibility of management for the Ind AS Financial Statements

The Company’s Board of Directors is responsible for the matters stated in Section 134(5) of the Act with respect to the preparation of these Ind AS financial statements that give a true and fair view of the state

Am°’$ E{WŠg' Ho$ AZwgma h‘ H§$nZr go ñdV§Ì h¢ Omo {H$ Z¡{VH$

Amdí¶H$VmAm| Ho$ gmW A{Y{Z¶‘ Am¡a {Z¶‘m| Ho$ àmdYmZm| Ho$

VhV {dÎmr¶ {ddaUm| Ho$ h‘mao Am°{S>Q> Ho$ {bE àmg§{JH$ h¢, Am¡a

h‘Zo AnZr Z¡{VH$ {Oå‘oXm[a¶m| H$mo BZ Amdí¶H$VmAm| Am¡a

AmMma g§{hVm Ho$ AZwgma nyam {H$¶m h¡ & h‘ ‘mZVo h¢ {H$ h‘Zo

Omo Am°{S>Q> gmú¶ àmá {H$E h¢, dh B§S> EEg {dÎmr¶ {ddaUm| na

h‘mar Am°{S>Q> am¶ Ho$ {bE EH$ AmYma àXmZ H$aZo Ho$ {bE n¶m©á

Am¡a Cn¶wº$ h¡&

{dÎmr` {ddaU Am¡a boIm narjH$ H$s [anmoQ>© Ho$ Abmdm AÝ`$

OmZH$mar

H§$nZr H$m {ZXoeH$ ‘§S>b AÝ` gyMZmAm| H$s V¡`mar Ho$ {bE

{Oå‘oXma h¡ &

AÝ` OmZH$mar ‘| dm{f©H$ [anmoQ>© ‘| gpå‘{bV OmZH$mar em{‘b

h¡, bo{H$Z Bg‘| B§S>EEg {dÎmr` {ddaU Am¡a h‘mao boIm narjH$

H$s [anmoQ>© (AÝ` OmZH$mar) em{‘b Zht h¡ &

Bg Am°{S>Q>a H$s [anmoQ>© H$s {VWr Ho$ ~mX AÝ`> OmZH$mar h‘|

CnbãY H$amZo H$s Cå‘rX h¡ & B§S>EEg {dÎmro` {dda{U`m| na

h‘mar am¶ AÝ` OmZH$mar H$mo H$da Zht H$aVm h¡ Am¡a h‘ na

{H$gr ê$n ‘| AmœmgZ {ZîH$f© H$mo ì`º$ Zht H$aVo h¡ &

B§S> EEg {dÎmr¶ {ddaUm| Ho$ h‘mao Am°{S>Q> Ho$ g§~§Y ‘|, h‘mar

{Oå‘oXmar AÝ¶ OmZH$mar H$mo nT>Zm h¡ Am¡a Eogm H$aZo ‘|, Ü¶mZ

aIZm h¡ {H$ Š¶m Eogr AÝ¶ OmZH$mar {dÎmr¶ {ddaUm| go ‘hÎdnyU©

ê$n go Ag§JV h¡ ¶m Am°{S>Q> ‘| àmá h‘mar OmZH$mar ¶m AÝ¶Wm

‘hÎdnyU© ê$n go JbV àVrV hmoVm h¡&

O~ h‘ AÝ¶ OmZH$mar n‹T>Vo h¢ Am¡a ¶{X h‘ ¶h {ZîH$f© {ZH$mbVo

h¢ {H$ Bg‘| H$moB© ‘hÎdnyU© JbV dU©Z h¡, V~ h‘| Eg E 720

"AÝ¶ OmZH$mar Ho$ gå~§Y ‘| A§Ho$jH$m| H$s {Oå‘oXmar' ‘o {d{Z{X©ï>

àmdYmZmo Ho$ AZwgma ‘m‘bo H$mo CZH$mo Omo Bgo àem{gV H$aVo h¡,

gy{MV H$aZo H$s Amdí¶º$m h¡ &

B§S>EEg {dÎmr` {dda{U`m| Ho$ {bE à~§YZ H$s {Oå‘oXmar

H§$nZr Ho$ {ZXoeH$ ‘§S>b A{Y{Z¶‘ H$s Ymam 134 (5) ‘|

BZ B§S> EEg {dÎmr¶ {ddaUm| H$s V¡¶mar Ho$ g§~§Y ‘| d{U©V

‘m‘bm| Ho$ {bE {Oå‘oXma h¡ Omo {dÎmr¶ ‘m‘bm| H$s pñW{V ({dÎmr¶

53


^m.H$.{Z.

C.C.I.

of affairs (financial position), profit or loss (financial performance including other comprehensive income), changes in equity and cash flows of the company in accordance with the accounting principles generally accepted in India, including the Ind AS specified under Section 133 of the Act read with the Companies (Indian Accounting Standards) Rules, 2015, as amended. This responsibility also includes maintenance of adequate accounting records in accordance with the provisions of the Act for safeguarding the assets of the Company and for preventing and detecting frauds and other irregularities; selection and application of appropriate accounting policies; making judgments and estimates that are reasonable and prudent; and design, implementation and maintenance of adequate internal financial controls, that were operating effectively for ensuring the accuracy and completeness of the accounting records, relevant to the preparation and presentation of the Ind AS financial statements that give a true and fair view and are free from material misstatement, whether due to fraud or error.

In preparing the Ind AS financial statements, management is responsible for assessing the Company’s ability to continue as a going concern, disclosing, as applicable, matters related to going concern and using the going concern basis of accounting unless management either intends to liquidate the Company or to cease operations, or has no realistic alternative but to do so.

The board of directors are also responsible for overseeing the Company's financial reporting process.

Auditor's Responsibilities for the Audit of Ind AS Financial Statements

Our objectives are to obtain reasonable assurance about whether the Ind AS financial statements as a whole are free from material misstatement, whether due to fraud or error, and to issue an auditor’s report that includes our opinion. Reasonable assurance is a high level of assurance, but is not a guarantee that an audit conducted in accordance with SAs will always detect a material misstatement when it exists. Misstatements can arise from fraud or error and are considered material if, individually or in the aggregate,

pñW{V),bm^ ¶m hm{Z(AÝ¶ ì¶mnH$ Am¶ g{hV {dÎmr¶ àXe©Z),

H§$nZr Ho$ B{¹$Q>r Am¡a ZH$Xr àdmh ‘| ~Xbmd H$s maV ‘| gm‘mÝ¶

ê$n go ñdrH$ma {H$E JE boIm§H$Z {gÕm§Vm| Ho$ AZwgma, {Og‘|

A{Y{Z¶‘ H$s Ymam 133 Ho$ VhV {Z{X©ï> B§S> EEg {OÝho H§$nZr

(^maVr¶ boIm ‘mZH$) {Z¶‘ 2015,O¡gm g§emo{YV {H$¶m J¶m

h¡, Ho$ gmW n‹T>m J¶m h¡ r em{‘b h¡, H$s gË¶ Ed§ {Zînj Vñdra

àñVwV H$aVo h¢& Bg {Oå‘oXmar ‘| H§$nZr H$s g§n{Îm H$s gwajm Ho$

{bE Am¡a YmoImY‹S>r Am¡a AÝ¶ A{Z¶{‘VVmAm| H$mo amoH$Zo Am¡a

nVm bJmZo Ho$ {bE A{Y{Z¶‘ Ho$ àmdYmZm| Ho$ AZwgma n¶m©á

boIm A{^boIm| H$m aIaImd ^r em{‘b h¡; C{MV boIm§H$Z

Zr{V¶m| H$m M¶Z Am¡a AmdoXZ; {ZU©¶ Am¡a AZw‘mZ bJmZm Omo

C{MV Am¡a {ddoH$nyU© hmo; Am¡a n¶m©á Am§V[aH$ {dÎmr¶ {Z¶§ÌUm|

H$m {S>OmBZ, H$m¶m©Ýd¶Z Am¡a aIaImd, Omo boIm [aH$m°S>© H$s

gQ>rH$Vm Am¡a nyU©Vm gw{Z{üV H$aZo Ho$ {bE à^mdr ê$n go H$m‘

H$a aho Wo, Omo {H$ EH$ gË¶ Ed§ {Zînj Ñ{ï>H$moU XoZo dmbo

B§S> EEg {dÎmr¶ {ddaUm| H$s V¡¶mar Am¡a àñVwVrH$aU Ho$ {bE

àmg§{JH$ h¢ Omo {H$gr YmoImY‹S>r ¶m Ìw{Q> Ho$ H$maU ‘hËdnyU© JbV

{ddaU go ‘wº$ h¢&

B§S> EEg {dÎmr¶ {ddaUm| H$mo V¡¶ma H$aZo Ho$ {bE, à~§YZ H§$nZr H$s ì¶dgm¶ Omar aIZo g§^mdZm H$m AmH$bZ, àH$Q>rH$aU, O¡gm bmJy hmo, ì¶dgm¶ Omar aIZo Ho$ ê$n ‘| g§~§{YV ‘m‘bm| Am¡a boIm§H$Z Ho$ AmYma V¶ H$aZo Ho$ {bE CÎmaXm¶r h¡,O~ VH$ à~§YZ ¶m Vmo H§$nZr H$mo ~§X H$aZo ¶m g§MmbZ H$mo ~§X H$aZo H$m BamXm aIVm h¡, ¶m Eogm H$aZo Ho$ {bE H$moB© dmñV{dH$ {dH$ën

Zht h¡&

{ZXoeH$ ‘§S>b H§$nZr H$s {dÎmr¶ [anmo{Qª>J à{H«$¶m H$s XoIaoI Ho$

{bE ^r {Oå‘oXma h¢&

B§S>EEg {dÎmt` {ddaUm| boIm narjm Ho$ {bE boIm narjH$mo

H$s {Oå‘oXmar`m±

h‘mam CÔoí¶ Bg ~mao ‘| C{MV AmœmeZ àmá H$aZm h¡ {H$ Š¶m B§S> Eg {dÎmr¶ {ddaU g‘J« ê$n go ‘hËdnyU© JbV dU©Z,Mmho dh YmoImY‹S>r ¶m Ìw{Q> Ho$ H$maU hmo, go ‘wº$ h¡ Am¡a EH$ Am°{S>Q>a [anmoQ>© Omar H$aZm h¡ {Og‘o h‘mar am¶ ^r em{‘b h¡& C{MV AmœmgZ EH$ Cƒ ñVar¶ AmœmgZ h¡, bo{H$Z ¶h EH$ Jma§Q>r Zht h¡ {H$ EgE Ho$ AZwgma {H$¶m J¶m Am°{S>Q> h‘oem ‘hËdnyU© JbV dU©Z,O~{H$ do ‘m¡OyX h¡, H$m nVm bJmEJm& JbV dU©Z YmoImY‹S>r ¶m Ìw{Q> go CËnÞ hmo gH$Vo h¢ Ed§ BÝho ‘hËdnyU© ‘mZm Om¶|Jo ¶{X,ì¶{º$JV ¶m g‘J« ê$n go BZ B§S> Eg {dÎmr¶

54

^m.H$.{Z.

C.C.I.


they could reasonably be expected to influence the economic decisions of users taken on the basis of these Ind AS financial statements.

As part of an audit in accordance with SAs, we exercise professional judgement and maintain professional skepticism throughout the audit. We also:

(a) Identify and assess the risks of material misstatement of the Ind AS financial statements, whether due to fraud or error, design and perform audit procedures responsive to those risks, and obtain audit evidence that is sufficient and appropriate to provide a basis for our opinion. The risk of not detecting a material misstatement resulting from fraud is higher than for one resulting from error, as fraud may involve collusion, forgery, intentional omissions, misrepresentations, or the override of internal control.

(b) Obtain an understanding of internal control relevant to the audit in order to design audit procedures that are appropriate in the circumstances. Under section 143(3)(i) of the Act, we are also responsible for expressing our opinion on whether the company has adequate internal financial controls system in place and the operating effectiveness of such controls.

(c) Evaluate the appropriateness of accounting policies used and the reasonableness of accounting estimates and related disclosures made by management.

(d) Conclude on the appropriateness of management’s use of the going concern basis of accounting and, based on the audit evidence obtained, whether a material uncertainty exists related to events or conditions that may cast significant doubt on the Company’s ability to continue as a going concern. If we conclude that a material uncertainty exists, we are required to draw attention in our auditor’s report to the related disclosures in the Ind AS financial statements or, if such disclosures are inadequate, to modify our opinion. Our

{ddaUm| Ho$ AmYma na {bE JE Cn¶moJH$Vm©Am| Ho$ Am{W©H$ {ZU©¶m| H$mo ¶Wmo{MV à^m{dV H$aZo H$s Cå‘rX aIVo h¡&

EgE Eg Ho$ AZwgma Am°{S>Q> Ho$ EH$ ^mJ Ho$ ê$n ‘|, h‘ noeoda

{ZU©¶ boVo h¢ Am¡a nyao Am°{S>Q> ‘| noeoda {ZanojVm H$mo ~Zm¶o aIVo

h¡& h‘ ^r :

(H$) B§S> Eg {dÎmr¶ {ddaUm| H$s ‘hËdnyU© JbV dU©Z H$s OmopI‘m|, Mmho dh YmoImY‹S>r ¶m Ìw{Q> go hm|, H$mo nhMmZZm Am¡a CgH$m AmH$bZ H$aZm, CZ OmopI‘m| Ho$ à{V CÎmaXm¶r Am°{S>Q> à{H«$¶mAm| H$s aMZm Ed§ {ZînmXZ Ed§ h‘mar am¶ Ho$ {bE EH$ AmYma àXmZ H$aZo Ho$ {bE Cn¶wº$ Ed§ C{MV Am°{S>Q> gmú¶ àmá H$aZm& {H$gr YmoImY‹S>r go CËnÞ ‘hËdnyU© JbV dU©Z H$mo Z Ty>§T> nmZo H$s OmopI‘, {H$gr JbVr Ho$ n[aUm‘ñdê$n hmoZo dmbo JbV dU©Z, go Á¶mXm hmoVr h¡, Š¶y±H$s YmoImY‹S>r ‘| {‘br^JV, OmbgmOr, OmZ~yPH$a MyH$, JbV AW© {Zê$nU ¶m Am§V[aH$ {Z¶§ÌU H$mo A{Y^mdr H$aZm em{‘b hmoVm h¡&

(I) boIm narjm à{H«$¶mAm| H$mo {S>OmBZ H$aZo Ho$ {bE Am°{S>Q> Ho$ {bE àmg§{JH$ Am§V[aH$ {Z¶§ÌU H$s g‘P àmá H$aZm Omo n[apñW{V¶m| ‘| Cn¶wº$ h¢& A{Y{Z¶‘ H$s Ymam 143(3)(i) Ho$ VhV, h‘ Bg na ^r AnZr am¶ ì¶º$ H$aZo Ho$ {bE {Oå‘oXma h¢ {H$ Š¶m H§$nZr Ho$ nmg n¶m©á Am§V[aH$ {dÎmr¶ {Z¶§ÌU àUmbr h¡ Am¡a Bg Vah Ho$ {Z¶§ÌUm| Ho$ g§MmbZ H$s à^mderbVm h¡ &

(J) Cn¶moJ H$s JB© boIm§H$Z Zr{V¶m| H$s Cn¶wº$Vm Am¡a

à~§YZ Ûmam {H$E JE boIm§H$Z AZw‘mZm| Am¡a g§~§{YV

àH$Q>rH$aU H$s VH©$g§JVVm H$m ‘yë¶m§H$Z H$aZm&

(K) à~§YZ Ho$ ì¶dgm¶ Omar aIZo Ho$ AmYma na à¶moJ H$s

J¶r boIm§H$Z H$s Cn¶wº²$Vm Am¡a àmá Am°{S>Q> gmú¶

Ho$ AmYma na {ZîH$f© {ZH$bZm,H$s Š¶m EH$ ‘hËdnyU©

A{Z{üVVm, CZ KQ>ZmAm| ¶m pñW{V¶m| go g§~§{YV h¡ Omo

H§$nZr H$s ì¶dgm¶ Omar aIZo g§^mdZm na ‘hËdnyU©

g§Xoh S>mb gH$Vo h¢& ¶{X h‘ {ZîH$f© {ZH$mbVo h¡ {H$ H$moB©

‘hËdnyU© A{Z{üVVm ‘m¡OyX h¡,Vmo h‘| AnZr Am°{S>Q>a

[anmoQ>© ‘| B§S> Eg {dÎmr¶ {ddaUm| ‘| gå~§{YV àH$Q>rH$aU

na Ü¶mZ AmH$f©U H$aZm hmoJm,Am¡a ¶{X Bg Vah H$m

àH$Q>rH$aU An¶m©á h¡ Vmo h‘mar am¶ H$mo g§emo{YV H$aZm&

55


^m.H$.{Z.

C.C.I.

conclusions are based on the audit evidence obtained up to the date of our auditor’s report. However, future events or conditions may cause the Company to cease to continue as a going concern.

(e) Evaluate the overall presentation, structure and content of the Ind AS financial statements, including the disclosures, and whether the Ind AS financial statements represent the underlying transactions and events in a manner that achieves fair presentation.

Materiality is the magnitude of misstatements in the Ind AS financial statements that, individually or in aggregate, makes it probable that the economic decisions of a reasonably knowledgeable user of the financial statements may be influenced. We consider quantitative materiality and qualitative factors in (i) planning the scope of our audit work and in evaluating the results of our work; and (ii) to evaluate the effect of any identified misstatements in the financial statements

We communicate with those charged with governance regarding, among other matters, the planned scope and timing of the audit and significant audit findings, including any significant deficiencies in internal control that we identify during our audit.

We also provide those charged with governance with a statement that we have complied with relevant ethical requirements regarding independence, and to communicate with them all relationships and other matters that may reasonably be thought to bear on our independence, and where applicable, related safeguards.

Other matter

A. The comparative financial information of the Company for the year ended 31st March, 2017 and 31st March 2018, included in these financial statements, are based on the previously issued financial statements, issued by the then joint auditors as under ─

(i) For the Financial Year ending 31st March 2017

i. The financial statements, prepared in

h‘mao {ZîH$f© h‘mao boIm narjH$ H$s [anmoQ>© H$s VmarI

VH$ àmá Am°{S>Q> gmú¶ na AmYm[aV h¢& hmbm§{H$, ^{dî¶

‘| hmoZo dmbr KQ>ZmE§ ¶m n[apñW{V¶m| go H§$nZr H$s

ì¶dgm¶ Omar aIZo g§^mdZm g‘má hmo gH$Vr h¡ &

(S>.) B§S> EEg {dÎmr¶ {ddaUm| Ho$ ê$n ‘| H$s g‘J« àñVw{V,

g§aMZm Am¡a gm‘J«r H$m àH$Q>rH$aU g{hV ‘yë¶m§H$Z

H$aZm VWm Š¶m B§S> Eg {dÎmr¶ {ddaU AÝV{Z©{hV

boZXoZ Am¡a KQ>ZmAmo H$mo Bg Vah go Xem©Vo h¡ Omo {Zînj

àñVw{V àmá H$ao&

‘hËdVm H$m n[a‘mU, B§S> EEg {dÎmr¶ {ddaUm| ‘| JbV dU©Z,

ì¶{º$JV ê$n go ¶m g‘J« ê$n go,¶h g§^d ~ZmVm h¡ {H$ {dÎmr¶

{ddaUm| Ho$ ¶Wmo{MV OmZH$ma Cn¶moJH$Vm© Ho$ Am{W©H$ {ZU©¶

à^m{dV hmo gH$Vo h¢& h‘ ‘mÌmË‘H$ ‘hËdVm Am¡a JwUmË‘H$

H$maH$m| na {dMma H$aVo h¢ (i) h‘mao Am°{S>Q> H$m¶© Ho$ Xm¶ao H$s

¶moOZm ~ZmZm Am¡a h‘mao H$m‘ Ho$ n[aUm‘m| H$m ‘yë¶m§H$Z H$aZm;

Am¡a (ii) {dÎmr¶ {ddaU ‘| {H$gr nhMmZ {bE JE JbV dU©Z H$m

à^md H$m ‘yë¶m§H$Z H$aZo Ho$ {bE&

h‘Zo AnZo Am°{S>Q> Ho$ Xm¡amZ, AÝ¶ ‘m‘bm| Ho$ ~rM, Am°{S>Q> H$s ¶moOZm~Õ H$m¶©joÌ Am¡a g‘¶ VWm ‘hËdnyU© Am°{S>Q> {ZîH$fm] Ho$ gmW, Am§V[aH$ {Z¶§ÌU ‘| {H$gr ^r ‘hËdnyU© H${‘¶m| H$mo em{‘b H$aVo hþE {Ogo h‘Zo AnZo Am°{S>Q> Ho$ Xm¡amZ nhMmZm h¡ H$mo CZHo$ gmW gmPm {H$¶m h¡ Omo Bgo àem{gV H$aVo h¢&

h‘ CÝh| Omo Bgo àem{gV H$aVo h¡,EH$ {ddaU ^r àXmZ H$aVo

h¢ {H$ h‘Zo ñdV§ÌVm Ho$ g§~§Y ‘| àmg§{JH$ Z¡{VH$ Amdí¶H$VmAm|

H$m AZwnmbZ {H$¶m h¡, Am¡a CZ g^r [aíVm| Am¡a AÝ¶ ‘m‘bm|

Ho$ {b¶o {OÝh| h‘mar ñdV§ÌVm na dhZ H$aZo ‘| Am¡a Ohm§ bmJy

hmo,g§~§{YV gwajm Cnm¶ Ho$ {bE CÝho gy{MV {H$¶m h¡ &

AÝ` ‘m‘bo

H$) H§$nZr VwbZmË‘H$ {dÎmr` OmZH$mar 31 ‘mM©, 2017

Am¡a 31 ‘mM©, 2018 H$mo g‘má {dÎmr` {ddaUm| ‘|

em{‘b h¢, Omo nhbo Omar {H$E JE {dÎmr` {ddaUm| na

AmYm[aV h¡ VËH$mbrZ g§`wº$ boIm narjH$m| Ûmam Omar

{H$E JE Wo {ZåZmZwgma h¡ -

(i) 31 ‘mM©, 2017 H$mo g‘má {dÎmr` df© Ho$ {bE

i. {dÎmr` df© 31 ‘mM©, 2017 H$mo g‘már Ho$

56

^m.H$.{Z.

C.C.I.


accordance with section 133, for the year ending 31st March 2017 were audited by joint auditors Prasad Azad & Company, Chartered Accountants, New Delhi and Bansal R. Kumar & Associates, Chartered Accountants, Mumbai.

ii. Audit report dated 17th August 2017, issued by the said joint auditor expressed an unmodified opinion on those financial statements.

(ii) For the Financial Year ending 31st March 2018

i. The Ind AS financial statements, prepared in accordance with section 133, for the year ending 31st March 2018 were audited by joint auditors Baweja & Kaul, Chartered Accountants, New Delhi and Bansal R. Kumar & Associates, Chartered Accountants, Mumbai.

ii. Audit report dated 15th October 2018, issued by the said joint auditor expressed an adverse opinion on those financial statements.

iii. The adverse opinion on those financial statement was issued for following reasons:

I. Reversal of accumulated provision of interest on Punjab Infrastructure Cess.

II. Incomplete disclosure of provisions like provision for interest on Punjab infrastructure Cess, provision for expenses, provision for interest on outstanding dues to MSME and other staff related provisions as required under Para 84 and Para 85 of Ind AS 37.

III. Non-disclosure of transaction with Company Secretary who is a Key managerial Personal as per section 203(2) of the Companies Act, 2013.

IV. The Company not using the word “Revised” in the Financial Statements approved by the Board in its meeting held on 23rd August 2018.

{bE Ymam 133 Ho$ AZwgma V¡`ma {H$E JE {dÎmr`

{ddaU, g§`wº$ boIm narjH$ àgmX AmOmX E§S>

H§$nZr, MmQ>©S©> EH$mC§Q>|Q>, ZB© {X„r Am¡a ~§gb

Ama Hw$‘ma E§S> Egmo{gEQ²g, MmQ>©S©> AH$m§C§Q>|Q>,

‘w§~B© Ûmam Am°{S>Q> {H$E JE Wo &

ii. 17 AJñV 2017 H$mo Omar Am°{S>Q> [anmoQ>© ‘| H$hm J`m {H$ g§`wº$, Am°{S>Q>a Zo CZ {dÎmr` dº$ì`m| na EH$ Ag§emo{YV (AZ‘mo{S>’$mBS>) am` ì`º$$H$s h¡ &

(ii) 31 ‘mM©, 2018 H$mo g‘má {dÎmr` df© Ho$ {bE

i. {dÎmr` df© 31 ‘mM©, 2018 H$mo g‘mßV Ho$

{bE Ymam 133 Ho$ AZwgma V¡`ma {H$E JE

B§S>EEg {dÎmr` {ddaU, g§`wº$ boIm narjH$

~doOm E§S> H$m¡b, MmQ>©S©> EH$mC§Q>|Q>, ZB© {X„r

Am¡a ~§gb Ama Hw$‘ma E§S> Egmo{gEQ²g, MmQ>©S©>

AH$m§C§Q>|Q>, ‘w§~B© Ûmam Am°{S>Q> {H$E JE Wo &

ii. 15 A³Qy>~a 2018 H$mo Omar Am°{S>Q> [anmoQ>©

‘| H$hm J`m {H$ g§`wº$ Am°{S>Q>a Zo CZ {dÎmr`

dº$ì`m| na EH$ à{VHw$b am` ì`º$ H$s h¡ &

iii. {ZåZ{bpIV H$maUm| go CZ {dÎmr>` {ddaUm| na

à{VHy$b am` Omar H$s JB© Wr :

I. n§Om~ B’«$mñQ´>ŠMa gog na ã`mO Ho$ g§{MV àmdYmZ H$mo àË¶md{V©V H$aZm &

II. n§Om~ B’«$mñQ´>ŠMa gog na ã`mO, IM© Ho$ {bE àmdYmZ,

E‘EgE‘B© H$mo ~H$m`m ~H$mE na ã`mO H$m àmdYmZ Am¡a

AÝ` ñQ>m’$ g§~§{YV àmdYmZm| Ho$ {bE B§S>EEg 37 n¡am

84 Am¡a n¡am 85 Ho$ VhV AnyU© àH$Q>rH$aU &

III. H§$nZr g{Md Ho$ gmW boZXoZ H$m J¡a àH$Q>rH$aU H§$nZr A{Y{Z`‘, 2013 H$s Ymam 203(2) Ho$ AZwgma EH$ à‘wI à~§YZ ì`º$s h¡ &

IV. H§$nZr Zo 23 AJñV 2018 H$mo Am`mo{OV AnZr ~¡R>H$ ‘| ~moS©> Ûmam AZw‘mo{XV {dÎmr` {ddaUm| ‘| "'g§emo{YV'' eãX H$m Cn`moJ Zht {H$`m h¡ &

57


^m.H$.{Z.

C.C.I.

V. Balances under Trade Receivables (Other than NTC), Trade payables, EMD / Deposits / Retention money were subject to confirmation/ Reconciliation and consequent adjustments, if any

B. Attention is invited to Note No. 30, regarding change in accounting policy, in respect of revenue recognition on application of Ind AS 115 with effect from 1st April 2018. The Company has applied Ind AS 115 retrospectively to each prior reporting period presented in accordance with paragraph C3(a) of Appendix C of Ministry of Corporate Affairs notification dated 28.03.2018 read with Ind AS 8, Accounting Policies, Changes in Accounting estimates and errors. This change in accounting policy has resulted into increase in profit before tax, for the year under consideration amounting to Rs.118.60 lakh.

Report on Other Legal & Regulatory Requirements

1. As required by the Companies (Auditor’s Report) Order 2016 ("the Order") issued by the Central Government of India in terms of sub-section (11) of section 143 of the Act, we give in the ‘Annexure A’, a statement on the matters specified in paragraph 3 and 4 of the Order.

2. Based on the verification of records of the company and as per information and explanations given to us, we give our comments on the Directions issued by the Comptroller and Auditor General of India in terms of Sec 143(5) of the Act in ‘Annexure B’

3. As required by the section 143 (3) of the Act, we report that :

a. We have sought and obtained all the information and explanations, which to the best of our knowledge and beliefs were necessary for the purpose of our audit;

b. In our opinion, proper books of account as required by law have been kept by the Company so far as appears from our examination of those books;

V. ì`mnma àmß` Ho$ VhV eof am{e (EZQ>rgr Ho$ Abmdm),

ì`mnma Xo`VmE°§, B©E‘S>r/O‘m/à{VYmaU YZ nw{ï> Ho$

AYrZ/ gwbh Am¡a n[aUm‘ñdê$n g‘m`moOZ Ho$ AYrZ

Wo, `{X H$moB© hmo

I. 1 Aà¡b, 2018 go à^md Ho$ gmW 115 Ho$ AmdoXZ

na amOñd ‘mÝ`Vm Ho$ g§~§Y ‘| boIm§H$Z Zr{V ‘| ~Xbmd

Ho$ ~mao ‘| Ü`mZ AmH${f©V {H$`m OmVm h¡ ZmoQ> g§. 30

H§$nZr Zo àË`oH$ nyd©dVu [anmo{Qª>J Ad{Y Ho$ {bE 115 H$mo

nyd©ì`mnr ê$n go bmJy H$a {X`m h¡, Omo {H$ H$m°nm}aoQ> ‘m‘bm|

Ho$ ‘§Ìmb` Ho$ n[a{eï> J 3 (H$) Ho$ AZwgma àñVwV {H$`m

J`m h¡ & {XZm§H$ 28.03.2018 H$mo B§S>EEg 8, boIm§H$Z

AZw‘mZm| Am¡a Ìw{Q>`m| ‘o n[adV©Z Ho$ gmW àñVwV {H$¶m

J`m h¡ & boIm§H$Z Zr{V ‘| n[adV©Z Ho$ n[aUm‘ñdê$n df©

Ho$ {bE am{e¶m| na {dMma Ho$ VhV H$a go nhbo bm^ ‘|

118.60 bmI ê$ H$s d¥{Õ hþB© h¡ &

{d{Y$VWm {d{Z`‘Z Amdí`H$VmAm| na [anmoQ>©²g

1. H§$nZrO A{Y{Z`‘ (boIm narjH$ [anmoQ>©) AmXoe

2016 Ho$ Amdí`H$VmZwgma H|$Ð gaH$ma Ûmam Omar

A{Y{Z`‘ 143 Ho$ Cn {Z`‘ (11) Ho$ AZwgma,

h‘ AmXoe Ho$ n¡am 3 Am¡a 4 ‘| {d{Z©{Xï> ‘m‘bm| na

n[a{eï>-"H$' ‘| Xo aho h¡ &

2. H§$nZr Ho$ [aH$m°S²©>g Ho$ gË`‘mnZ Ho$ AmYma na VWm h‘|

Xr JB© gyMZmAm| d ñnï>rH$aU Ho$ AZwgma h‘ A{Y{Z`‘

H$s Ymam 143(5) "AZwb¾ I' Ho$ ~mao ‘| {Z`§ÌH$ d

^maV Ho$ ‘hmboIm narjm Ûmam Omar {ZXoem| VWm Cn

{ZXoem| na {ZåZmZwgma {Q>ßnUr XoVo h¢ &

3. A{Y{Z`‘ H$s Ymam 143(3) Ho$ Amdí`H$VmZwgma h‘ [anmoQ>© H$aVo h¢ {H$ :

H$. h‘Zo AnZo kmZ d OmZH$mar Ho$ AZwgma do g^r

OmZH$m[a`m± d nwï>rH$aU àm{á {H$E h¡ Omo boIm

narjm Ho$ {bE Amdí`H$ Wo &

I. h‘mar am` ‘| O¡gm {H$ h‘Zo ~wŠg H$s Om±M H$s h¡,

H§$nZr Zo {d{Y go g^r ~wŠg H$mo C{MV ê$n ‘| aIm

h¡ &

58

^m.H$.{Z.

C.C.I.


c. The Balance Sheet, the Statement of Profit and Loss (including other comprehensive income), the Cash Flow Statement and Statement of Changes in Equity dealt with by this report are in agreement with the books of account;

d. In our opinion, the aforesaid Ind AS Financial Statements comply with the Indian Accounting Standards specified under section 133 of the Act, read with Companies (Indian Accounting Standards) Rules, 2015, as amended;

e. The provisions of Section 164 (2) of the Act regarding disqualification of directors are not applicable to the Company in view of Notification No. G.S.R. 463 (E) dated 5th June, 2015 issued by Ministry of Corporate Affairs, Government of India;

f. With respect to the adequacy of the internal financial controls over financial reporting of the Company with reference to these Ind AS financial statements and the operating effectiveness of such controls, refer to our separate Report in ‘Annexure C’ to this report. Our report expresses modified opinion on the adequacy and operating effectiveness of the company’s internal financial control over financial reporting; and

g. With respect to the other matters to be included in the Auditor’s Report in accordance with Rule 11 of the Companies (Audit and Auditors) Rules, 2014, (as amended) in our opinion and to the best of our information and according to the explanations given to us:

I. The Company has disclosed the impact of pending litigations on its financial position in its Ind AS financial statements – (Refer Note No. 32 to the Ind AS financial statements);

II. The Company did not have any long-term contracts including derivative

J. Bg [anmoQ>© Ûmam VwbZm nÌ, bm^ hm{Z ImVm

(AÝ` ì`mnH$ Am` g{hV) ZH$Xr àdmh

{ddaUr VWm B{¹$Q>r ‘| n[adV©Z H§$nZr Ho$

boIm ~{h`m| Ho$ gmW ‘ob ImVo h¢ &

K. h‘mar am` ‘| Cº$ B§S>EEg {dÎmr` {ddaUm| Ho$

~mao ‘| A{Y{Z`‘ H$s Ymam 133 Omo H§$nZr

(^maVr` boIm ‘mZH$) {Z`‘mdbr 2015

O¡go g§emo{YV hþAm Ho$ gmW n‹T>m Om`o;

‹S>. {dÎm ‘§Ìmb` (^maV gaH$ma) Ûmam Omar

A{YgyMZm g§»`m : Or.Eg.Ama. 463 (B©)

{XZm§H$ 5 OyZ 2015 H$mo XoIVo hþE H§$nZr

H$s Ymam 164(2)Ho$ àmdYmZ {ZXoeH$mo Ho$

A`mo½`Vm Ho$ g§~§Y ‘| H§$nZr na bmJy Zht h¡ &

M. H§$nZr H$s {dÎmr` [anmo{Qª>J na Am§V[aH$ {dÎmr`

{Z`§ÌUm| H$s n`m©áVm Ho$ g§~§Y ‘| B§S>EEg

{dÎmr` {ddaUm| Am¡a Eogo {Z`§ÌUm| Ho$ g§MmbZ

à^mderbVm Ho$ g§X^© ‘|, Bg [anmoQ>© Ho$ {bE

h‘mao AbJ [anmo{Qª>J 'AZwb¾H$ J' H$m g§X^©

X| & h‘mar [anmoQ>© H§$nZr Ho$ {dÎmr¶ [anmo{Q>ªJ na

A§V[aH$ {Z¶§ÌU Am¡a n[aMmbZ à^mderbVm

na g§emo{YV (‘mo{S>’$mBS>) am` ì`º$ H$aVr h¡&

N>. H§$nZrO (Am°{S>Q> d Am°{S>Q>g©) {Z`‘mdbr

2014 Ho$ {Z`‘ 11 (O¡go g§emo{YV hþAm)

boIm narjm [anmoQ>© ‘| AÝ` ‘m‘bo em{‘b

H$aZo Ho$ ~mao ‘|, h‘mar am` ‘| VWm h‘mar

OmZH$mar d h‘| {XE JE ñnï>rH$aU Ho$ AZwgma:

I. H§$nZr Zo AnZr B§S>EEg {dÎmr` {dda{U`m|

‘| AnZr {dÎmr` pñW{V na b§{~V H$m`©dmhr

H$m à^md àH$Q> {H$`m h¡ & (B§S>EEg {dÎmr`

{ddaUr ZmoQ> g§ 32 XoI|)

II. H§$nZr ‘| S>o[adoQ>rìh g§{dXmE°§ em{‘b H$aHo$

{H$gr XrKm©d{Y g§{dXmAm| ‘| H$moB© Am{W©H$

59


^m.H$.{Z.

C.C.I.

contracts for which there were any material foreseeable losses;

III. The provision of transferring the amount to the Investor Education and Protection Fund is not applicable to the company;

IV. The disclosure requirements relating to holding as well as dealings in specified bank notes were applicable for the period from 8 November 2016 to 30 December 2016, as per the MCA notification, G.S.R. 308 (E), dated 30.03.2017 which are not relevant to these Ind AS financial statements. Hence, reporting under this clause is not applicable.

hm{Z {XImB© Zht Xo ahr h¡ &

III. H§$nZr H$mo {ZdoeH$ {ejm VWm gwajm {Z{Y ‘|

am{e ñWmZm§VaU H$aZo H$m àmdYmZ bmJy Zht

h¡&

IV. {Z{X©ï> ~¢H$ ZmoQ>m| ‘o boZ-XoZ go g§~§{YV hmo{Sª>½g

Ho$ ~mao ‘| àH$Q>rH$aU g§~§Yr Amdí`H$VmAm| H$mo

8 Zd§~a, 2016 go 30 {Xg|~a 2016 VH$

H$s Ad{Y Ho$ {bE bmJy {H$`m J`m Wm, E‘grE

A{YgyMZm Ho$ AZwgma, Or.Eg.Ama 308(B©)

{XZm§H$ 30.03.2017 h¡ & Omo {dÎmr` {ddaU

Ho$ ê$n ‘| B§S>EEg Ho$ {bE àmg§{JH$ Zht h¡ &

Bg{bE Bg I§S> Ho$ VhV [anmo{Qª>J bmJy Zht h¡&

H¥$Vo ~doOm E§S>> H$m¡bFor Baweja and Kaul

gZXr boImnmb

Chartered Accountants (’$‘© a{OñQ´>oeZ Z§. 005834EZ)Firm Registration No: 005834N

g§{dV Hw$. JwaQy>Samvit K. Gurtoo^mJrXma$/ PartnergXñ¶Vm H«$. 090758Membership No. : 090758

ñWmZ : ZB© {X„rPlace : New Delhi{XZm§H$ / Date : 28.06.2019

H¥$Vo Or ~r gr E E§S> Agmo{gEQ²>g EbEbnrFor G B C A & Associates LLP

gZXr boImnmbChartered Accountants(’$‘© a{OñQ´>oeZ Z§. 103142 S>ãë¶y/S>ãë¶y100292)Firm Registration No: 103142W/W100292

g§Ord bmbZSanjeev Lalan^mJrXma$/ PartnergXñ¶Vm H«$. : 045329Membership No. : 045329

60

^m.H$.{Z.

C.C.I.


Annexure A to the Independent Auditor's Report

(Referred to in Paragraph 1 under the heading of "Report on Other Legal & Regulatory Requirements" of our report of even date on the Ind AS Financial Statements of The Cotton Corporation of India Limited)

1. In respect of the Company’s fixed assets:

a) The company has maintained proper records showing full particulars, including quantitative details and situation of Fixed Assets.

b) All fixed assets are physically verified by the management during the year, which in our opinion is reasonable having regard to the size of the Company and nature of its assets. No material discrepancies were noticed on such verification.

c) Based on the documents provided and examined, title deeds of immovable properties are held in the name of the Company.

2. The Inventories are verified by the internal auditors. Further, the inventories have been physically verified by the Independent agencies at the year end. In our opinion, having regards to the volume of the inventories, the frequency/intervals of verification is reasonable. No material discrepancies have been noticed on such verification of stocks.

3. The Company has not granted any loans, secured or unsecured to companies, firms, Limited Liability Partnerships or other parties covered in the register maintained under section 189 of the Companies Act, 2013. In view of this, the related provisions of sub clause (a), (b) and (c) of clause 3(iii) of the Order are not applicable to the company.

4. The Company has not given any loans, guarantees, and security and has not made investments covered under section 185 and 186 of the Companies Act, 2013. Accordingly, clause 3(iv) of the Order is not applicable to the company.

ñdV§Ì boIm narjH$m| H$s [anmoQ>© H$m n[a{eï>$- H$

(^maVr` H$nmg {ZJ‘ {b{‘Q>oS> Ho$ B§S>EEg {dÎmr` {ddaUm|

na h‘mar g‘{XZm§{H$V [anmoQ>© Ho$ A§VJ©V "{d{Y VWm

{d{Z`‘Z Amdí`H$VmAm| na [anmoQ>©g' Ho$ n¡amJ«m’$ - 1 ‘|

g§X{^©V XoI|)

1. H§$nZr H$s AMb g§n{Îm`m| Ho$ g§~§Y ‘| :

H$) H§$nZr Zo AMb n[ag§n{Îm`m| H$s pñW{V Am¡a

‘mÌmË‘H$ {ddaU Ho$ gmW nyao ã`m¡ao Xem©Zodmbo C{MV

A{^boIm| H$m AZwajU {H$`m h¡ &

I) df© Ho$ Xm¡amZ à~§YZ Ûmam g^r V` {H$E JE

n[ag§n{Îm`m| H$mo ^¡{VH$ ê$n go gË`{nV {H$`m

OmVm h¡ Omo h‘mao ‘VmZwgma H§$nZr Ho$ AmH$ma d

n[ag§n{Îm`m| Ho$ AZwê$n h¡ & Bg àH$ma Ho$ gË`mnZ

‘| H$moB© dmñV{dH$ {dg§J{V Zht nm`r J`r h¡ &

J) CnbãY H$admò JE XñVmdoOm| VWm CZH$s Om±M

Ho$ AmYma na H§$nZr Ho$ Zm‘ na AMb g§n{Îm Ho$

Q>mB©Q>b S>rS²g nmò JE h¢ &

2. ‘mbgyMr H$m gË`mnZ Am§V[aH$ boIm narjH$ Ûmam

{Z`{‘V A§Vamb na {H$`m OmVm h¡ df© Ho$ A§V ‘| ñdV§Ì

gË`mnH$ Ûmam ‘mbgyMr H$m dmñV{dH$ gË`mnZ {H$`m

J`m h¡ & h‘mar am` ‘|, ‘mbgyMr H$s ‘mÌm H$mo XoIVo hþE

gË`mnZ H$s Amd¥{Îm C{MV h¡ & BZ gË`mnZ na ‘w»`

ê$n go H$moB© {dg§J{V`m± Zht nm`r JB© h¡ &

3. H§$nZr A{Y{Z`‘ 2013 H$s Ymam 189 Ho$ A§VJ©V aIo

Jò a{OñQ>na ‘| {Z{hV Ho$ AZwgma H§$n{Z`m|, ’$‘©g `m

AÝ` nm{Q©>`m| H$mo/go {H$gr r àH$ma H$m a{jV m Aa{jV

F$U Z Vmo àXmZ {H$`m h¡ Am¡a Z hr {b`m h¡& AV: BgHo$

AZwgma Šbm°O 3(iii) Ho$ CnŠbm°O (H$),(I) Ed§ (J)

Ho$ AmXoe Ho$ g§~§{YV àmdYmZ H§$nZr na bmJy Zht h¡ &

4. H§$nZr Zo H$moB© F$U, Jma§Q>r VWm à{V y{V Zht Xr h¡ VWm

H§$nZr A{Y{Z`‘, 2013 H$s Ymam 185 d 186 Ho$ AYrZ

H$moB© {Zdoe H$da Zht {H$`m J`m h¡ & AV: Šbm°O 3(iv) Ho$

Am°S©>a Ho$ Bg I§S> go g§~§{YV àmdYmZ H§$nZr na bmJy Zht

h¡ &

61


^m.H$.{Z.

C.C.I.

5. The Company has not accepted any deposits from the public within the meaning Section 73 to 76 or any other relevant provisions of the Companies Act 2013 and the rules framed thereunder, Consequently, the directives issued by the Reserve Bank of India and the provision of the Companies Act 2013 and the rules framed there under are not applicable to the company.

6. The Central Government of India has not prescribed the maintenance of cost records under section 148(1) of the Act in respect of any of the activities of the company.

7. According to the information and explanations given to us in respect of statutory dues:

a) The Company has generally been regular in depositing undisputed statutory dues including provident fund, income-tax, sales-tax, goods and services tax, service tax, duty of customs, duty of excise, cess and other statutory dues, as applicable, with the appropriate authorities. We have been informed that employees' state insurance is not applicable to the company.

b) According to the information and explanations given to us, no undisputed amounts payable in respect of provident fund, income tax, service tax, sales tax, custom duty, excise duty, value added tax, goods and service tax, cess and other statutory dues were outstanding, at the year end, for a period of more than six months from the date they became payable.

5. H§$nZr Zo H§$nZr A{Y{Z`‘, 2013 H$s Ymam 73 go 76

Am¡a AÝ` g§~§{YV {H$gr àmdYmZ Ho$ A§VJ©V H$moB© O‘m

am{e npãbH$ go ñdrH$ma Zht H$s h¡ & n[aUm‘ñdê$n

Bg g§~§Y ‘| ^maVr` [aOd© ~¢H$ Ûmam Omar {ZX}e Am¡a

H§$nZr A{Y{Z`‘, 2013 Ho$ àmdYmZ H§$nZr na bmJy

Zht hmoVo h¡ &

6. H§$nZr A{Y{Z`‘ H$s Ymam 148 (1) Ho$ A§VJ©V H§$nZr na H|$Ð gaH$ma Ûmam {ZYm©[aV bmJV [aH$m°S©> H$m aI aImd H§$nZr H$s {H$gr ^r àH$ma H$s J{V{d{Y`m| Ho$ {bE bmJy Zht hmoVo h¢ &

7. d¡Ym{ZH$ ~H$m`m Ho$ g§~§Y ‘| h‘| Xr JB© OmZH$mar Am¡a ñnï>rH$aU Ho$ AZwgma :

H$) H§$nZr ^{dî` {Z{Y, H$‘©Mmar ~r‘m, Am`H$a, {~H«$s

H$a, g§n{Îm H$a, g{d©g H$a, H$ñQ>åg S>çwQ>r, EŠgmB©g

S>çyQ>r, doQ> gog VWm H$moB© ~H$m`m gm§{d{YH$ am{e

Cn`wº$ àm{YH$m[a`m| Ho$ nmg, gm‘mÝ`V: {Z`{‘V ê$n

go O‘m H$a ahr h¡ & h‘| `h ~Vm`m J`m h¡ {H$ H$‘©Mmar

amÁ` ~r‘m A{Y{Z`‘ H§$nZr na bmJy Zht h¡ &

I) h‘| Xr JB© OmZH$mar Am¡a ñnï>rH$aU Ho$ AZwgma H$moB©

{Z{d©dmX am{e Zht h¡, {dî` {Z{Y, Am`H$a, {~H«$sH$a,

H$ñQy>‘ S>çyQ>r, CËnmX ewëH$, ‘yë`d{Y©V H$a AÀN>m

Am¡a godmH$a, CnH$a Am¡a AÝ`) d¡Ym{ZH$ Xo` am{e Ho$

g§~§Y ‘| df© Ho$ A§V ‘| ~H$m`m VmarI go N>: ‘mh go

A{YH$ ‘hrZm| H$s Ad{Y Ho$ {b`o ~H$m`m Zht h¡ &

62

^m.H$.{Z.

C.C.I.


gm§{d{YH$ H$m Zm‘ Name of the Statute

Xo` H$m àH$ma Nature of Dues

am{e

(bmI ê$n`o ‘|) Amount

(Rs. In lakhs)

am{e go g§~§{YV Ad{Y Period to which the

amount relates

{H$g ’$moa‘ na {ddmX

b§{~V h¡Forum where

dispute is pending

amÁ` Am¡a Ho$ÝÐ

{~H«$s H$a A{Y{Z`‘State & Central Sales Tax Act

IarX H$a Ho$

A§VJ©V ‘m§J Demand under Purchase Tax.

53.59 1996-97

{~H«$s H$a {Q´>~wZb,

{demImnQ>Z‘ ‘| Anrb Appeal in Sales

Tax Tribunal, Visakhapatnam

amÁ` Am¡a Ho$ÝÐ

{~H«$s H$a A{Y{Z`‘State & Central Sales Tax Act

Enr d¡Q> EŠQ> Ho$ A§VJ©V Demand under AP

VAT Act.5.96 2011-12

h¡Xam~mX hmB©H$moQ>©

‘| AnrbAppeal in High

Court, Hyderabad

amÁ` Am¡a Ho$ÝÐ {~H«$s H$a A{Y{Z`‘State & Central Sales Tax Act

Enr d¡Q> EŠQ >Ho$ A§VJ©VDemand under AP

VAT Act.15.58 2013-14

h¡Xam~mX hmB©H$moQ>©

‘| AnrbAppeal in High

Court, Hyderabad

amÁ` Am¡a Ho$ÝÐ {~H«$s

H$a A{Y{Z`‘State & Central Sales Tax Act

{~H«$s H$a Ho$ A§VJ©V ‘m§JDemand under

Sales Tax.11.37 2012-13

Cn Am¶wº$ Anrb Ho$

g‘j AnrbAppeal Before Dy.

Commissioner, Appeals



{~H«$s H$a Ho$ A§VJ©V ‘m§J Demand under

Sales Tax.6.25 2008-09

H$Zm©Q>H$m AnrboQ>

{Q´ã`wZb, ~|Jbmoa Karnataka Appellate Tribunal, Bangalore



{~H«$s H$a Ho$

A§VJ©V ‘m§J Demand under

Sales Tax.

13.73 2011-12

g§`wº$ Am`wº$ Anrb

hþ~br Joint Commissioner

of Appeals Hubli



IarX H$a Ho$


6.83 2011-12 ES>rgr(grQ>r)-Jw§Vya ADC(CT)-Guntur



IarX H$a Ho$


9.01 2013-14 ES>rgr(grQ>r)-Jw§Vya ADC(CT)-Guntur

J) H§$nZr Ho$ [aH$m°S©> Ho$ {hgm~ go Am`H$a, {~H«$sH$a, ‘yë¶ d{Y©V H$a Ho$ Am{X H$m ~H$m¶m Bg àH$ma h¡ &

c) According to the records of the Company, the dues of income tax, sales tax, value added tax, cess, etc on account of any dispute are as follows:

63


^m.H$.{Z.

C.C.I.



am{e


(Rs. In lakhs)


amount relates



dispute is pending




sales tax14.28 2010-11 & 2011-12

n§Om~ d°Q> {Q´>ã¶wZb,

M§S>rJT>Punjab Vat tribunal,

Chandigarh




Sales Tax.4.06

1980-81, Anrb nwZ{Z©YmaU

Ho$ {bE Xþ~mam ^§{Q>S>m

{~H«$sH$a H$m¶m©b¶ ‘|

^oOr J¶r Appeals

remanded back for reassessment at

Bhatinda Sale Tax Office.

1981-82,

1989-90 &

1992-93.

godm H$aService Tax

godm H$a Ho$ A§VJ©V ‘m§JDemand under

service tax4.06 2009-10 grB©EgQ>rEQ>r, H$mobH$mVm

CESTAT, Kolkata




Sales Tax3.97 2005-06

ì`dgm` H$a Am¶wº$,

~oahm‘nwa, C‹S>rgm Ho$

nmg AnrbAppeal with

Commissioner of Commercial Tax,

Berhampur, Orissa




Sales Tax1.53 2006-07

ì`dgm` H$a Am¶wº$,

~oahm‘nwa, C‹S>rgm Ho$

nmg AnrbAppeal with

Commissioner of Commercial Tax,

Berhampur, Orissa




Sales Tax5.42 2010-11

{~H«$s H$a {Q´ã`yZb,

C‹S>rgm Ho$ nmg AnrbAppeal with Sales

Tax Tribunal, Orissa




Sales Tax2.27 2009-10

{~H«$s H$a {Q´ã`yZb,

C‹S>rgm Ho$ nmg AnrbAppeal with Sales

Tax Tribunal, Orissa

64

^m.H$.{Z.

C.C.I.




am{e


(Rs. In lakhs)


amount relates



dispute is pending

Am`H$a A{Y{Z`‘,

1961Income Tax Act,

1961

Ymam 200 E Ho$ A§VJ©VU/s 200A

1.82 2006-07to

2011-12

Am`H$a Am`wº$,

‘w§~B© Ho$ nmg AnrbAppeal with

Commissioner of Income Tax,

Mumbai

Am`H$a A{Y{Z`‘, 1961

Income Tax Act, 1961

àmoËgmhZ na Q>rS>rEgTDS on incentive

41.11 2013 to 2015

Am`H$a Am`wº$,

Ho$ nmg AnrbAppeal with

Commissioner of Income Tax

n§Om~ BZ’«$mñQ´>ŠMa {S>dbn‘|Q> E§S> aoJwboeZ

EŠQ> 2002Punjab

Infrastructure (Development & Regulation) Act,

2002.

n§Om~ BZ’«$mñQ´>ŠMa gog Punjab

Infrastructure Cess

4292.79 2005-06 & Onwards

gdm}ƒ Ý`m`mb` Ho$ nmg ñnoeb brd no{Q>eZ

Xm`a H$s h¡Special Leave

Petition filed with Hon’ble Supreme

Court.

Am`H$a A{Y{Z`‘, 1961


àmoËgmhZ na Q>rS>rEg TDS on incentive

0.26 2015-16

Am`H$a Am`wº$,



Am`H$a A{Y{Z`‘, 1961



40.49 2016-17

Am`H$a Am`wº$,



Am`H$a A{Y{Z`‘, 1961



0.36 2017-18

Am`H$a Am`wº$,



65


^m.H$.{Z.

C.C.I.

8. The Company has not defaulted in repayment of loans or borrowings to any financial institution, bank, Government. The Company has not issued any debentures in financial year 2018-19 or earlier.

9. The Company has not raised monies by way of initial public offer or further public offer (including debt instruments) and term loans during the year. Accordingly, paragraph 3(ix) of the Order is not applicable.

10. During the course of our examination of the books and records of the Company, carried out in accordance with the generally accepted auditing practices in India, and according to the information and explanations given to us, we have come across instance of material fraud on or by the Company by its officers or employees, noticed or reported during the year. The management have informed us of such cases. The details of fraud and misappropriation of such cases are as follows:

Reported during the year

(a) A cotton seed buyer complained that neither they have purchased nor lifted any cotton seed valued at Rs. 57.65 lakh from Sadashiv Peth centre of Warangal branch pertaining to crop year 2014-15 under one contract number which is totally false and fabricated. After internal investigation the matter has been referred to CBI. There is no financial impact on the financial statements of the company for the year under consideration.

(b) During the cotton season 2017-18, a centre in-charge of Kaledia, Naswadi and Palej of Ahmedabad branch purchased the kapas of below prescribed quality parameter. Further, he misappropriated kapas equivalents to 697 FP bales valuing to Rs. 122.00 lakh and 1600 quintals of cotton seed valuing to Rs.30.00 lakh out

8. H§$nZr Zo gaH$ma, ~¢H$m| d {dÎmr` g§ñWmoAm| go {bE JE

F$Um| Ho$ wJVmZ ‘| H$moB© MyH$ Zht H$s h¡ & H§$nZr Zo {dÎmr`

df© 2018-19 Ho$ Xm¡amZ {H$gr ^r àH$ma Ho$ {S>~o|Ma

Omar Zht {H$ò h¡ &

9. H§$nZr Zo df© Ho$ Xm¡amZ {H$gr ^r àH$ma Ho$ B{Z{e¶b$ npãbH$ Am°’$a AWdm AmJo H$moB© ^r npãbH$ Am°’$a (F$U XñVmdoOm| H$mo em{‘b H$aHo$) d Q>‘© bmoZ go H$moB© am{e d{Y©V Zht H$s h¡ & VX²Zwgma Bg I§S> Ho$ àmdYmZ H§$nZr na bmJy Zht hmoVo h¢ & VX²Zwgma 3(ix) H$m AmXoe bmJy Zht h¡ &

10. ^maV ‘| gm‘mÝ`V: H$s OmZodmbr boIm narjm Ho$ AZwgma

H$s JB© H§$nZr H$s ~hr Ed§ [aH$m°S©> H$s h‘mar Om±M Ho$ Xm¡amZ

Am¡a h‘| ~VmB© JB© gyMZm Ed§ ñnï>rH$aU Ho$ AZwgma h‘mao

gm‘Zo H§$nZr ‘| Am¡a CgHo$ A{YaH$m[a`m| Ûmam AWdm

H$‘©Mm[a`m| Ûmam ~‹S>r YmoImY‹S>r Ho$ Ñï>m§V bmò Jò h¡,

{OgHo$ ~mao ‘| df© Ho$ Xm¡amZ Ü`mmZ {X`m J`m h¡ AWdm

CgH$s [anmoQ>© H$s JB© h¡ & à~§YZ Zo h‘| Eogo ‘m‘bm| H$s

gyMZm Xr h¡ & Eogo ‘m‘bm| ‘| YmoImY‹S>r Am¡a Xw{Z©{d`moOZ

H$m {ddaU {ZåZ àH$ma go h¡ &

df© Ho$ Xm¡amZ H$s JB© [anmoQ>©

H$) H$m°Q>Z grS> Ho$ IarXXma Zo `h {eH$m`V H$s {H$

CgZo 57.65 bmI ê$nò ‘yë`& Ho$ {H$gr ^r Vah

H$s H$m°Q>Z grS> H$s IarXXmar gXm{ed noR> g|Q>a,

dma§Jb emIm go ’$gb df© 2014-15 Ho$ Xm¡amZ

EH$ g§{dXmg§»`m Ho$ A§VJ©V Zm Vmo H$s JB© h¡ Zm

CR>mB© JB© h¡ Omo {~ëHw$b PyR>m Am¡a ‘ZJ‹T>V h¡ &

‘m‘bo H$s Am§V[aH$ Om§M Ho$ nümV Bgo gr~rAmB© H$mo

ôO {X`m J`m h¡ {dMmamYrZ df© ‘| H§$nZr Ho$ {dÎmr`

{ddaU ‘| {H$gr Vah H$m {dÎmr` à^md Zht n‹S>m &

I) H$m°Q>Z grOZ 2017-18 Ho$ Xm¡amZ Ah‘Xm~mX Ho$

A§VJ©V H$bo{‹S>`m, Zgdm‹S>r Ed§ nmboO Ho$ÝÐµ à^mar

Zo {ZYm©[aV JwUdÎmm Ho$ {ZåZ ñVa na H$nmg H$s

IarXXmar H$s & BgHo$ Abmdm CÝhm| Zo bJ^J 697

E’$nr ~oëg Ho$ ~am~a {OgH$m 122 bmI ê$nò Wm

Am¡a gmW 1600 q¹$Q>b H$m°Q>Z grS> {OgH$m ‘yë`

30 bmI ê$nò Wm, CgH$m Xw{d©{Z`moOZ {H$`m Am¡a

66

^m.H$.{Z.

C.C.I.


of the kapas purchased by him at Kaledia centre. FIR has been lodged against the centre in-charge on 22.06.2018 at Naswadi Police Station. Police investigation is under progress. The above items are not considered in the valuation of the closing stock.

Other prior period cases

(c) In Akola branch a misappropriation of 1212 FP bales at MSWC godown, Pusad Centre was noticed on 06.05.2010. A Criminal case was registered against the accused at police station Pusad vide First information report (FIR) no. 117/10 dated 08.05.2010. The value of the said 1212 FP Bales is approx. Rs.150.63 lakh. The said case is still under investigation by the concerned police authorities.

During the investigation, Police recovered 900 FP Bales and ceased. Further, value of 300 FP bales amounting to Rs. 37.49 lakh has been recovered from the accused and deposited with the Investigating office L.C.B. Yeotmal. For balance 12 FP bales police investigation is in progress. Currently the case is being investigated by CID, Amravati. The above is not considered in the valuation of the stock. After the approval of Hon’ble session court, Pusad the 900 bales have been sold through online e-auction and deposited the sale proceeds of Rs.179 lakh in Court till further proceedings. Any realization on this account will be accounted for as and when received from L.C.B Yeotmal and Court.

(d) In Guntur branch, during the year 2007-08, misappropriation of stock of 233 cotton bales and 28882 meters of Grey Cloth was observed and the same was not considered

`h g~ H$bo{S>`m H|$Ð ‘| CZHo$ Ûmam IarXo Jò

H$nmg ‘| Wm & H|$Ð à^mar Ho$ {dê$Õ Zgdm‹S>r nw{bg

ñQ>oeZ ‘| 22.06.2018 H$mo E’$AmB©Ama XO© H$am

Xr JB© h¡ & nw{bg Om§M H$a aht h¡ & Cn`w©º$ ‘Xm| H$mo

ŠbmoqOJ ñQ>m°H$ Ho$ ‘yë`m§H$Z ‘| em{‘b Zht {H$`m

J`m h¡ &

AÝ`nyd© Ad{Y Ho$ ‘m‘bo

J) AH$mobm emIm ‘| E‘EgS>ãë`wgr JmoXm‘, nwgX H|$Ð ‘| 1212 E’$nr ~oëg H$m Xw{d©{Z`moOZ 06.05.2010 ‘| Ü`mZ ‘| bm`m J`m h¡ & A{^`wº$ Ho$ {dê$Õ Amnam{YH$ ‘m‘bm nw{bg ñQ>oeZ nwgX ‘| XO© H$am Xr JB© h¡ & E’$AmB©Ama g§. 117/10 {X. 08.05.2010 Cº$ 1212 E’$nr ~oëg H$m ‘yë` bJ^J 150.63 bmI ê$nò h¡ & Cº$ ‘m‘bm A^r ^r g§~§{YV nw{bg àm{YH$m[a`m| Ûmam Om±M Ho$ A§VJ©V h¢ &

Om±M Ho$ Xm¡amZ nw{bg Zo 900 E’$nr ~oëg dgybm h¢ Am¡a Cgo OãV {H$`m h¡ BgHo$ A{V[aº$ 300 E’$nr ~oëg {OgH$s H$s‘V 37.49 bmI ê$nò h¡ & A{^`wº$ go CgH$s ^r ~am‘XJr H$s JB© h¡& Am¡a Cgo Om±M H$m`m©b` Eb.gr.~r. `dV‘mb ‘| O‘m H$am {X`m J`m h¡ & eof 12 E’$nr ~oëg H$s nw{bg Om±M H$a ahr h¡ Am¡a dV©‘mZ ‘| ‘m‘bo H$s grAmB©S>r A‘amdVr Ûmam Om§M H$s Om ahr h¢& Cn`w©º$ H$mo ñQ>m°H$ ‘| ‘yë`m§H$Z ‘| em{‘b Zht {H$`m J`m h¡ & ‘mZZr` gogZ Ý`m`mb` nwgX Ho$ AZw‘moXZ Ho$ nümV 900 ~oëg Am°ZbmB©Z B©-Am°ŠeZ Ho$ ‘mÜ`‘ go {~H«$s H$s JB© h¡ & Am¡a Cgo AmJo H$m`©dmhr VH$ Ý`m`mb` Zo CgH$s {~H«$s Am` 179 bmI ê$nò Ho$ gmW O‘m H$a Xr JB© h¡& Bg AmYma na {H$gr Vah H$s CJmhr O~ H$^r H$s OmòJr Cgo Eb.gr.~r. `dV‘mb Ed§ Ý`m`mb` Ho$ {hgm~ ‘| aIm OmòJm &

K) Jw§Vya emIm ‘| 2007-08 Ho$ Xm¡amZ 233 H$m°Q>Z

doëg Ed§ 28882 ‘rQ>a J«o - Šbm°W Ho$ Xw{Z©{d`moOZ

H$m ‘m‘bm gm‘Zo Am`m Am¡a Cgo ‘yë`m§H$Z Ho$

à`moOZ ŠbmoqOJ ñQ>m°H$ ‘| em{‘b Zht {H$`m J`m

67


^m.H$.{Z.

C.C.I.

as Closing Stock for valuation purpose. The matter is now under Trial Court. During investigation Police recovered 100 cotton bales, which were handed over by the police to the Company. The said 100 cotton bales were sold during 2010-11 as per order of the Honourable Court, Chilakaluripet and an amount of Rs. 20.81 lakh was realized thereof. The amount of Rs. 19.98 lakh after deducting expenses on disposal of bales of Rs. 0.83 lakh has been deposited with the court on 19.4.2011. The same will be accounted as and when the case is settled.

(e) During the Cotton season 2014-15, abnormal difference in press and delivery weight were observed at Maur and Talwandi centres of Bathinda Branch. The Centre-in-charge and subordinate staff were charge-sheeted and penalty of recovery of 80% of loss was imposed upon the centre in-charge (amount involved Rs. 18.79 lakh). The subordinate staff was imposed a penalty of reduction to a lower stage in the time scale of pay. Further, it was found that the factories at these centres had not carried out ginning work as per the quality standards of the Corporation. After following the due procedure of law, the security amount of the concerned factory was forfeited and the factory was blacklisted. The Centre in-charge and subordinate staff have been charge-sheeted under the rule pertaining to major penalty. The Reviewing Authority has passed the order by levying penalty of Rs. 15.37 lakhs, which is fully recovered till September 2018.

11. The provisions of Section 197 of the Companies Act, 2013 in respect of Managerial Remuneration are not applicable to the company in view of Notification no. G.S.R No.463 (E) dated 5th June 2015 issued by Ministry of Corporate Affairs (Government of India)

12. The Company does not fall within the definition of Nidhi Company. Accordingly, paragraph 3(xii) of the Order is not applicable.

h¡ & ‘m‘bm Q´>m`b H$moQ>© ‘| h¡ Om±M Ho$ Xm¡amZ nw{bg

Zo 100 H$m°Q>Z ~ob H$s ~am‘XJr H$s {Ogo nw{bg

Ûmam H§$nZr ‘| gm¢n {X`m J`m & Cº$ 100 H$m°Q>Z

~oëg 2010-11 Ho$ Xm¡amZ ‘mZZr` Ý`m`mb`

{MëH$mbwarnoQ> Ho$ AmXoemZwgma {~H«$s H$a {X`m J`m

h¡, {OgHo$ ~Xbo ‘| bJ^J 20.81 ê$nò H$s CJmhr

H$s JB© & 0.83 bmI ê$nò ~oëg Ho$ {ZnQ>mZ na

IM© H$s H$Q>m¡Vr Ho$ nümV 19.98 bmI ê$nò am{e

19.4.2011 H$mo Ý`m`mb` ‘| O‘m H$a Xr JB© h¡

O¡go hr ‘m‘b| H$m {ZnQ>mZ hmoJm Cgo ^r {hgm~ ‘|

{b`m OmòJm &

L>) 2014-15 H$m°Q>Z grOZ Ho$ Xm¡amZ àog ‘| Am¡a {S>brdar ^ma ‘| Agm‘mÝ` A§Va ^{Q>§S>m emIm Ho$ ‘m¡a Ed§ Vbd§S>r H|$Ð ‘| nm`m J`m & H|$Ð à^mar Ed§ AYrZñW H$‘©Mm[a`m| H$mo Amamon nÌ Xo {Xò Jò h¡ Am¡a H|$Ð à^mar na {Og‘| 18.79 bmI am{e em{‘b h¡ 80% hm{Z H$s dgybr H$m X§S> bJm`m J`m h¡ & AYrZñW H$‘©Mm[a`m| na {ZåZV‘ doVZ‘mZ ‘| àË`md{V©V H$aZo H$m X§S> bJm`m J`m h¡ BgHo$ A{V[aº$ `h nm`m J`m {H$ BZ H|$Ðmo Ho$ emIm Zo {ZJ‘ H$s JwUdÎmm Ho$ ‘mZH$ AZwgma H$m`© Zht H$a aho Wo & C{MV {d{Y à{H«$`m H$m nmbZ H$aVo hþE g§~§{YV ’°$³Q>ar H$s A‘mZV am{e Oá H$s JB© h¡ Ed§ Cgo ãb¡H$ {bñQ> H$a {X`m J`m h¡& Ho$ÝÐ à^mar Ed§ AYrZñW H$‘©Mm[a`m| H$mo ‘oOa noZëQ>r Ho$ {Z`‘ Ho$ A§VJ©V Amamo{nV {H$`m J`m h¡ & g‘rjm àm{YH$mar Zo 15.37 bmI ê$nò H$s noZëQ>r dgyb H$aZo H$m AmXoe Omar {H$`m h¡ {Ogo {gV§~a, 2018 VH$ nyU©V: dgyb H$a {b`m J`m

h¡&

11. à~§YH$s` nm[al{‘H$ Ho$ g§~§Y ‘| H§$nZr A{Y{Z`‘ 2013

H$s Ymam 197 H$‘o àmdYmZ H§$nZr H$m`© ‘§Ìmb` ^maV

gaH$ma Ûmam Omar H$s JB© A{YgyMZm g§. OrEgAma Z§~a

463 (B©) 5 OyZ, 2015 H$mo Ñ{ï>JV aIVo hþE H§$nZr

na bmJy Zht h¡ &

12. H§$nZr, {Z{Y H§$nZr H$s n[a^mfm Ho$ A§VJ©V Zht h¡

VX²Zwgma AmXoe H$m n¡am 3(xii) bmJy Zht h¡ &

68

^m.H$.{Z.

C.C.I.


13. In our opinion, and according to the information and explanations given to us by the management, the transactions with the related parties are in compliance with sections 177 and 188 of the Act and the details have been disclosed in the notes to Ind AS Financial Statements etc., as required by the applicable accounting standards.

14. The Company has not made preferential

allotment or private placement of shares or

fully or partly convertible debentures during the

year. Accordingly, paragraph 3(xiv) of the Order

is not applicable.

15. The company has not entered into non-cash transactions with directors or persons connected with him as referred to in Section 192 of the Companies Act 2013. Accordingly, paragraph 3(xv) of the Order is not applicable.

16. The company is not required to be registered under section 45-IA of the Reserve Bank of India Act, 1934. Accordingly, the provisions of clause 3(xvi) are not applicable to the company.

13. h‘mar am` ‘| à~§YZ Ûmam h‘| Xr JB© gyMZm Am¡a ñnï>rH$aU

Ho$ AmYma na g§~§{YV nm{Q©>`m| go {ZH$mbo Jò boZ-XoZ

A{Y{Z`‘ H$s Ymam 177 Ed§ 188 Ho$ AZwnmbZ Ho$

A§VJ©V h¡ Am¡a BgH$m nyam {ddaU B§S>EEg {dÎmr` {ddaU

BË`m{X ‘| Xr JB© {Q>ßnUr ‘| ñnï> {H$`m J`m h¡ O¡gm {H$

bmJy boImH$aU ‘mZH$m| ‘| Anojm H$s OmVr h¡ &

14. H§$nZr Zo df© Ho$ Xm¡amZ eoàm| H$m A{Y‘mZVm na Amd§Q>Z

AWdm {ZOr ßbog‘|Q> AWdm {S>~|Mam| H$mo Omo nyU©V:

`m Am§{eH$ ê$n go n[adV©Zr` Zht ~Vm¶m h¡ & CZH$m

A{Y‘mZVm Amd§Q>Z AWdm {ZOr ßb|g‘|Q> Zht {H$`m h¡ &

VX²Zwgma AmXoe H$m n¡am 3(xiv) bmJy Zht h¡ &

15. H§$nZr Zo {ZdoeH$m| AWdm CZgo g§~§{YV ì`{º$`m| Ho$

gmW J¡a ZH$Xr boZXoZ Zht {H$`m h¡ & O¡gm {H$ H§$nZr

A{Y{Z`‘ 2013 H$s Ymam 192 ‘| {Z{X©ï> {H$`m J`m h¡&

VX²Zwgma AmXoe H$m n¡am 3(xv) bmJy Zht h¡ &

16. H§$nZr H$mo ^maVr` [aOd© ~¢H$ A{Y{Z`‘ 1934 H$s Ymam

45-AmBE Ho$ A§VJ©V n§OrH¥$V {H$ò OmZo H$s Amdí`

H$Vm Zht h¡ & VX²Zwgma IÊS> 3(xvi) Ho$ àmdYmZ H§$nZr

na bmJy Zht h¡ &

H¥$Vo ~doOm E§S> H$m¡bFor Baweja and Kaul

gZXr boImnmb


g§{dV Hw$. JwaQy>Samvit K. Gurtoo^mJrXma$/ PartnergXñ¶Vm H«$. 090758Membership No.: 090758



gZXr boImnmbChartered Accountants(’$‘© a{OñQ´>oeZ Z§. 103142S>ãë¶y/S>ãë¶y100292)Firm Registration No: 103142W/W100292

g§Ord bmbZSanjeev Lalan^mJrXma$/ PartnergXñ¶Vm H«$. : 045329Membership No.: 045329

69


^m.H$.{Z.

C.C.I.

“Annexure B” to the Independent Auditor’s Report

The Annexure Referred to in Paragraph 2 Under the heading “Report on Other Legal and Regulatory Requirements” section of our Report of even date to the members of The Cotton Corporation of India Limited for the financial year ended 31st March 2019.

{ZXoe / Directions CÎma / Replies

(i) Š¶m H§$nZr Zo AmBQ>r {gñQ>‘ Ho$ ‘mÜ¶‘

go g^r boImH$aU Ho$ {bE H$moB© à{H«$¶m

AnZm aIr h¡ ? ¶{X {dÎmr¶ boZXoZ

Ho$ gmW-gmW boImAm| Ho$ g‘oH$Z na

AmB©Q>r àUmbr Ho$ Abmdm boImH$aU Ho$

boZoXoZ H$s à{H«$¶m ‘| {H$gr Vah H$s

AÝ¶Wm {H$gr VÏ¶ Ho$ ~mao ‘| C„oI

{H$¶m J¶m h¡ &

(i) Whether the company has system in place to process all the accounting transactions through IT system? If yes, the implications of processing of accounting transactions outside IT system on the integrity of the accounts along with the financial implications, if any, may be stated.

H$) H§$nZr Zo ‘w»¶mb¶ ‘| Am¡a AnZr emImAm| ‘| B©Amnr {gñQ>‘ bmJy {H$¶m h¡ Am¡a Ama

12.1.3 Ho$ AZwgma Amoa¡H$b B© {~OZg H$m à¶moJ {H$¶m & Xo¶ boIm, àmß¶ boIm,

BZd|Q>ar, ‘oZoO‘|Q>, {dH«$s Ed§ {dnUZ, noamob Ed§ ZJX à~§YZ ‘moS>çyb Ho$ ‘mÜ¶‘ go

{dÎmr¶ boZXoZ XO© {H$E JE &

(a) The Company has implemented ERP system at head office and its branches and using Oracle e-business suite R12.1.3. All financial transactions are recorded through Account Payable, Accounts Receivables, Inventory Management, Sales and Marketing, Payroll and Cash Management modules.

I) B©Amanr {gñQ>‘ Ho$ Abmdm AÝ¶Wm {H$gr àH$ma go {dÎmr¶ boZXoZ H$s JUZm Zht H$s

JB© Bg{bE boImAm| Ho$ EH$sH$aU ‘| boImH$aU boZXoZ H$s à{H«$¶m na H$moB© {d{eï>

à^md Zht n‹S>m &

(b) No financial transactions are accounted otherwise than through the ERP system, therefore there is no implication on processing of accounting transactions on the integrity of the accounts.

(ii) Š¶m F$U Ho$ ^wJVmZ ‘| H§$nZr H$s {H$gr

Xo¶Vm Ho$ H$maU H§$nZr H$mo F$UXmVm

Ûmam {H$gr àH$ma Ho$ F$U AWdm {XE

JE ã¶mO BË¶m{X H$mo ~Å>o ImVo S>mbZo

Ho$ ‘m‘bo AWdm ‘m¡OyXm F$U H$mo {H$gr

àH$ma nwZJ©{R>V {H$¶m J¶m h¡ ? ¶{X hm±

Vmo CgHo$ {dÎmr¶ à^md H$mo ñnï> H$a| &

(ii) Whether there is any restructuring of an existing loan or cases of waiver/write off of debts /loans/interest etc. made by a lender to the company due to the company’s inability to repay the loan? If yes, the financial impact may be stated.

H$) df© Ho$ Xm¡amZ F$U Ho$ ^wJVmZ Ho$ {bE H§$nZr H$s Ag‘W©Vm Ho$ H$maU H§$nZr H$mo

F$UXmVm Ûmam F$U, H$O©, ã¶mO BË¶m{X ‘| Ny>Q>/~Å>o ImVo S>mbZo O¡gm H$moB© ‘m‘bm

Zht h¡ &

(a) There are no case of waiver/write off of debts/loans/interest etc. by a lender to the company due to the company’s inability to repay the loan during the year.

ñdV§Ì boIm narjH$m| H$s [anmoQ>© H$m ""n[a{eï>-I''

31 ‘mM©, 2019 H$mo g‘má df© Ho$ {bE ^maVr¶ H$nmg {ZJ‘

{b{‘Q>oS> Ho$ gXñ¶m| H$mo h‘mar g‘{XZm§{H$V [anmoQ>© Ho$ ({d{YH$

VWm {d{Z¶‘Z Amdí¶H$VmAm| na [anmoQ>©g) Ho$ n¡amJ«m’$ 2 ‘|

g§X{^©V {H$¶m J¶m n[a{eï> "I'

70

^m.H$.{Z.

C.C.I.


(iii) Š¶m H|$Ð AWdm amÁ¶ gaH$ma H$s

EO|{g¶m| go àmá/àmß¶ {d{eï> ñH$s‘ go

g§~§{YV {Z{Y H$s C{MV ê$n go JUZm

H$s JB© h¡ ¶m CgH$s eVm] Ho$ AZwgma

CgH$m à¶moJ {H$¶m J¶m h¡ & {dMbZ Ho$

‘m‘bm| H$mo gyMr~Õ H$[a¶o &

(iii) Whether funds received receivable for specific schemes from central/ state agencies were properly accounted for/ utilized as per its term and conditions? List the cases of deviation.

H$) gm¢nr JB© ^y{‘H$m Ho$ AZwgma O~ H$^r H$nmg H$s ~mOma H$s‘V ^maV gaH$ma Ûmam

Kmo{fV Ý¶yZV‘ g‘W©Z ‘yë¶ Ho$ Amg-nmg hmoVr h¡ Vmo H§$nZr H$mo Ý¶yZV‘ g‘W©Z

‘yë¶ H$m {ZYm©aU H$aZm n‹S>Vm h¡ &(a) As per the role assigned, the company is required to undertake

Minimum Support Price (MSP) operations, whenever, the market prices of Kapas touches the support prices announced by the Government of India.

I) H$m°Q>Z grOZ ewê$ hmoZo go nhbo dó ‘§Ìmb¶, maV gaH$ma H§$’$Q>© boQ>a Omar H$aVm

h¡, {Ogo ~¢H$ Ho$ H§$gmo{Q>©¶‘ H$mo àñVwV {H$¶m OmVm h¡ Vm{H$ H$nmg {H$gmZm| H$mo g‘¶

go ^wJVmZ {H$¶o OmZo Ho$ {bE H«o${S>Q> H$s gw{dYm Xr Om gHo$ &(b) Before start of Cotton Season, Ministry of Textiles, Government of

India, issues comfort letter which is submitted to the Consortium of Banks for providing credit facility for timely payment to the cotton farmers.

J) Bg Vah Ho$ Ý¶yZV‘ g‘W©Z ‘yë¶ Ho$ AmYma na {H$gr àH$ma H$s hm{Z ^maV gaH$ma

H$mo nm°{bgr ¶m {ZVr AZwgma Ý¶yZV‘ g‘W©Z ‘yë¶ Ho$ Q´>oqS>J AH$mC§Q> Ho$ nümV

àmá hmoVr(c) The losses arising on account of such MSP operations are received

from the Government of India after submission of trading account of MSP operations as per policy.


gZXr boImnmb Chartered Accountants (’$‘© a{OñQ´>oeZ Z§. 005834EZ)Firm Registration No: 005834N




gZXr boImnmbChartered Accountants(’$‘© a{OñQ´>oeZ Z§. 103142S>ãë¶y/S>ãë¶y100292)Firm Registration No: 103142W/W100292


71


^m.H$.{Z.

C.C.I.

Annexure - C to the Independent Auditor's Report of even date on the Ind AS Financial Statements of The Cotton Corporation of India Limited

(Referred to in paragraph 3(f) under 'Report on Other Legal and Regulatory Requirements' section of our report to the Members of The Cotton Corporation of India Limited for the financial year ended on 31st

March 2019.)

Report on the Internal Financial Controls under Clause (i) of Sub-section 3 of Section 143 of the Companies Act, 2013 (“the Act”)

We have audited the internal financial controls over financial reporting of The Cotton Corporation of India Limited (“the Company”) for the period ended 31st March, 2019, in conjunction with our audit of the financial statements of the Company for the year ended on that date.

management's Responsibility for Internal Financials Controls

The Company’s management is responsible for establishing and maintaining internal financial controls based on the internal control over financial reporting criteria established by the Company considering the essential components of internal control stated in the Guidance Note on Audit of Internal Financial Controls over Financial Reporting issued by the Institute of Chartered Accountants of India (‘ICAI’). These responsibilities include the design, implementation and maintenance of adequate internal financial controls that were operating effectively for ensuring the orderly and efficient conduct of its business, including adherence to company’s policies, the safeguarding of its assets, the prevention and detection of frauds and errors, the accuracy and completeness of the accounting records, and the timely preparation of reliable financial information, as required under the Companies Act, 2013.

^maVr¶ H$nmg {ZJ‘ {b{‘Q>oS> Ho$ B§S>EEg {dÎmr¶ {ddaUm| na h‘mar g‘{XZm§{H$V [anmoQ>© ñdV§Ì boIm narjH$m| H$s [anmoQ>© H$m n[a{eï> - J

({XZm§H$ 31 ‘mM©, 2019 H$mo g‘má {dÎmr¶ df© hoVw ^maVr¶

H$nmg {ZJ‘ {b{‘Q>oS> Ho$ gXñ¶m| H$mo h‘mar g‘{XZm§{H$V [anmoQ>©

H$s Ymam "'{d{YH$ VWm {d{Z¶‘Z'' H$s AÝ¶ Amdí¶H$VmAm| na

[anmoQ>©g Ho$ n¡amJ«m’$ 3(M) ‘| g§X{ ©V {H$¶m J¶m n[a{eï> "J')

H§$nZr A{Y{Z¶‘ 2013 (A{Y{Z¶‘) H$s Ymam 143 H$s

CnYmam 3 Ho$ Šbm°O (i) Ho$ A§VJ©V Am§V[aH$ {dÎmr¶ {Z¶§ÌU

na [anmoQ>©

h‘Zo ^maVr¶ H$nmg {ZJ‘ {b{‘Q>oS> (H§$nZr) Ho$ 31 ‘mM©

2019 H$mo {dÎmr¶ [anmoQ>© na Ed§ Cg {XZ H§$nZr H$s h‘mar

Amoa go Am§Ho${jV {dÎmr¶ {ddaU Ho$ g§~§Y ‘| Am§V[aH$ {dÎmr¶

{Z¶§ÌU H$m narjU {H$¶m h¡ &

Am§V[aH$ {dÎmr¶ {Z¶§ÌU Ho$ {bE à~§YZ H$m CÎmaXm{¶Ëd :

X B§pñQ>Q>çwQ> Am°’$ MmQ>©S> AH$mC§Q> Am°’$ B§{S>¶m (Am¶grEAm¶)

Ho$ Ûmam Omar {H$E JE {dÎmr¶ [anmo{Q>ªJ na Am§V[aH$ {dÎmr¶

{Z¶§ÌU Ho$ JmBS>Ýg ZmoQ> ‘| C„opIV Amdí¶H$ ‘Xm| H$mo Ü¶mZ ‘|

aIVo hþE H§$nZr Ho$ Ûmam ñWm{nV {dÎmr¶ [anmo{Q>ªJ na Am§V[aH$

{dÎmr¶ {Z¶§ÌU Ho$ ‘mnX§S> Ho$ AZwgma H§$nZr H$m à~§YZ Am§V[aH$

{dÎmr¶ {Z¶§ÌU H$mo ñWm{nV H$aZo VWm Cgo ~ZmE aIZo Ho$

{bE CÎmaXm¶r h¡ & Bg {Oå‘oXmar ‘| A{Y{Z¶‘ Ho$ àmdYmZm| Ho$

AZwgma H§$nZr H$s n[ag§n{Îm¶m| H$mo gwa{jV aIZo VWm N>b-

H$nQ> d Ìw{Q>¶m| H$mo ImoOZo VWm A{Z¶{‘VVmAm| H$mo amoH$Zo Ho$

{bE n¶m©á boIm Zr{V¶m| Ho$ M¶Z Ý¶m¶mo{OV d AZw‘mZ bJmZm,

Omo C{MV d {ddoH$nyU© hmo VWm {S>OmB©Z, AZwnmbZ d n¶m©á

Am§V[aH$ {dÎmr¶ {Z¶§ÌU Ho$ aIaImd Omo boIm [aH$mS>©g² Ho$ nyU©

d n[aewÕVm hoVw à^mdembr àMmbZ H$m¶© H$a aho hmo, {Oggo

{dÎmr¶ {dda{U¶m| H$mo V¡¶ma d àñVwV {H$¶m Om¶o Vm{H$ {dÎmr¶

{dda{U¶m| N>b-H$nQ> d Ìw{Q> Ho$ H$maU ‘oQ>r[a¶b {‘g-ñQ>oQ>‘|Q>

go ‘wº$ hmo, O¡gm {H$ H§$nZr A{Y{Z¶‘ 2013 H$s Amdí¶H$Vm

h¡ &

72

^m.H$.{Z.

C.C.I.


Auditors Responsibility

Our responsibility is to express an opinion on the Company's internal financial controls over financial statement based on our audit. We conducted our audit in accordance with the Guidance Note on Audit of Internal Financial Controls over Financial Reporting (the “Guidance Note”) and the Standards on Auditing, issued by ICAI and deemed to be prescribed under section 143(10) of the Companies Act, 2013, to the extent applicable to an audit of internal financial controls, both applicable to an audit of Internal Financial Controls and, both issued by the Institute of Chartered Accountants of India. Those Standards and the Guidance Note require that we comply with ethical requirements and plan and perform the audit to obtain reasonable assurance about whether adequate internal financial controls over financial reporting was established and maintained and if such controls operated effectively in all material respects.

Our audit involves performing procedures to obtain audit evidence about the adequacy of the internal financial controls system over financial reporting and their operating effectiveness. Our audit of internal financial controls over financial reporting included obtaining an understanding of internal financial controls over financial reporting, assessing the risk that a material weakness exists, and testing and evaluating the design and operating effectiveness of internal control based on the assessed risk. The procedures selected depend on the auditor’s judgment, including the assessment of the risks of material misstatement of the Ind AS financial statements, whether due to fraud or error.

We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our audit opinion on the Company’s internal financial controls system over financial statement.

boIm narjH$m| H$m Xm{¶Ëd

h‘mar {Oå‘oXmar, h‘mar boIm narjm [anmoQ>© Ho$ AmYma na BZ {dÎmr¶ {dda{U¶m| na AnZr am¶ ì¶º$ H$aZm h¡ & h‘Zo h‘mar boIm narjm {dÎmr¶ [anmo{Qª>J na Am§V[aH$ {dÎmr¶ {Z¶§ÌU H$s boIm narjm Ho$ {Xem {ZX}e ZmoQ>, Am¶grEAm¶ Ûmam Omar boIm narjH$ Ho$ ‘mZH$ Am¡a H§$nZr A{Y{Z¶‘ 2013 H$s Ymam 143 (10) Ho$ AYrZ g‘Po OmZodmbo {ZYm©[aV, Am§V[aH$ {dÎmr¶ {Z¶§ÌU H$s boIm narjm H$s gr‘m VH$ bmJy, XmoZm| Am§V[aH$ {dÎmr¶ {Z¶§ÌU H$s boIm narjm Ho$ {bE bmJy Ed§ Omo XmoZmo hr X B§ñQ>rQ>çyQ> Am°’$ MmQ>©S> AH$mC§Q> Am°’$ B§{S>¶m (Am¶grEAm¶) Ho$ Ûmam Omar {H$E JE h¡, Ho$ AmYma na H$s h¡ & BZ ‘mZH$m| d JmBS>Ýg ZmoQ> H$s Anojm h¡ {H$ h‘ Amdí¶H$VmZwgma Bg AZwnmbZ d ¶moOZm H$mo ~ZmE VWm boIm narjm H$m {ZînmXZ H$a| {H$ Š¶m {dÎmr¶ [anmo{Qª>J na h‘ C{MV AmœmgZ XoVo h¡ {H$ n¶m©á Am§V[aH$ {dÎmr¶ {Z¶§ÌU ñWm{nV VWm ~ZmE aIm J¶m h¡ VWm g^r ‘Q>r[a¶b ‘| Bg {Z¶§ÌU H$m à^mdembr ê$n go n[aMmbZ {H$¶m Om ahm h¡ &

boIm narjm H$s Om±M, narjm Ho$ AmYma na am{e¶m| Ho$ g‘W©Z ‘| à‘mU Am¡a {dÎmr¶ [anmo{Qª>J na Am§V[aH$ {dÎmr¶ {Z¶§ÌU H$s n¶m©áVm Ed§ CZHo$ g§MmbZ H$s à^mderbVm H$s A{^ì¶{º$ em{‘b h¡ & M¶{ZV nÜX{V ‘|, boIm narjH$m| Ho$ {ZU©¶m| ‘| {dÎmr¶ [anmo{Qª>J na Am§V[aH$ {dÎmr¶ {Z¶§ÌU {‘g-ñQ>oQ>‘|Q>m| Ho$ OmopI‘m| H$m {ZYm©aU ^r em{‘b h¡ & CZ OmopI‘m| Ho$ {ZYm©aU H$aZo ‘| boIm narjH$ H§$nZr Ûmam V¡¶ma {H$¶o J¶o g§~§{YV Am§V[aH$ {dÎmr¶ {Z¶§ÌU nÜX{V na VWm C{MV {dÎmr¶ {ddaUr V¡¶ma H$aZo Ho$ {bE n[apñW{V Ho$ AZwgma C{MV boIm nÜX{V H$m {S>OmB©Z V¡¶ma H$aZo na ghr VWm Š¶m H§$nZr Zo {dÎmr¶ [anmoQ>© na n¶m©á Am§V[aH$ {dÎmr¶ {Z¶§ÌU nÜX{V ñWm{nV H$s h¡ VWm Eogo {Z¶§ÌU na à^mdembr àMmbZ H$a ahr h¡ & {dÎmr¶ {dda{U¶m| Ho$ N>b-H$nQ> Ho$ H$maU ‘Q>oar¶b {‘gñQ>oQ>‘|Q> Ho$ OmopI‘ H$m {ZYm©aU em{‘b H$aHo$ boIm narjm Ho$ {ZU©¶ na Am{lV H$m¶©{d{Y H$m M¶Z {H$¶m J¶m h¡ &

h‘| {dœmg h¡ {H$ {dÎmr¶ {dda{U¶m| na Omo gmú¶ boIm-narjm

Ho$ Xm¡amZ àmá hþE h¢ do h‘mar am¶ ‘| boIm narjm Ho$ AmYma hoVw

{dÎmr¶ {ddaUr na Am§V[aH$ {dÎmr¶ {Z¶§ÌU H$s boIm narjm Ho$

{bE n¶m©á Ed§ Cn¶wº$ h¢ &

73


^m.H$.{Z.

C.C.I.

meaning of Internal Financial Controls over Financial Reporting

A company's internal financial control over financial reporting with reference to Ind AS financial statement is a process designed to provide reasonable assurance regarding the reliability of financial reporting and the preparation of Ind AS financial statements for external purposes in accordance with generally accepted accounting principles. A company's internal financial control over financial reporting includes those policies and procedures that (1) pertain to the maintenance of records that, in reasonable detail, accurately and fairly reflect the transactions and dispositions of the assets of the company; (2) provide reasonable assurance that transactions are recorded as necessary to permit preparation of Ind AS financial statements in accordance with generally accepted accounting principles, and that receipts and expenditures of the company are being made only in accordance with authorisations of management and directors of the company; and (3) provide reasonable assurance regarding prevention or timely detection of unauthorised acquisition, use, or disposition of the company's assets that could have a material effect on Ind AS financial statements.

Inherent Limitations of Internal Financial Controls Over Financial Reporting

Because of the inherent limitations of internal financial controls over financial reporting, including the possibility of collusion or improper management override of controls, material misstatements due to error or fraud may occur and not be detected. Also, projections of any evaluation of the internal financial controls over financial reporting to future periods are subject to the risk that the internal financial control over financial reporting may become inadequate because of changes in conditions, or that the degree of compliance with the policies or procedures may deteriorate.

Basis for Qualified opinion

In our opinion according to the information and explanations given to us and based on our audit procedure performed the following material weakness have been identified in the operating effectiveness of the Company's Internal Financial Controls Over Financial Reporting as at 31st March 2019:

{dÎmr¶ [anmo{Qª>J na Am§V[aH$ {dÎmr¶ {Z¶§ÌH$ H$m A{^àm¶ :

gm‘mÝ¶ ê$n go ñdrH$m¶© boIm {gÕm§Vmo Ho$ AZwê$n ~mÜ¶ bú¶m|

hoVw B§S>EEg {dÎmr¶ {dda{U¶m| H$mo V¡¶ma H$aZo VWm {dœgZr¶

{dÎmr¶ [anmo{Qª>J Ho$ ~mao ‘| C{MV gw{Z{üVVm CnbãY H$admZo

‘| {dÎmr¶ [anmo{Qª>J na H§$nZr Ho$ Am§V[aH$ {dÎmr¶ {Z¶§ÌU H$mo

{S>OmB©Z {H$¶m J¶m h¡ & H§$nZr Ho$ {dÎmr¶ [anmo{Q>ªJ na Am§V[aH$

{dÎmr¶ {Z¶§ÌU H$s dmo Zr{V¶m± d à{H«$¶m em{‘b h¡ Omo 1)

H§$nZr Ho$ [aH$m°S>© Ho$ aIaImd H$mo H§$nZr boZXoZ d n[ag§n{Îm¶m|

Ho$ ì¶¶ H$mo ghr d C{MV ê$n go à{Vq~{~V H$aVm h¡ & 2)

gm‘mÝ¶ ê$n go ñdrH$m¶© boIm {gÕm§Vmo Ho$ AZwê$n B§S> EEg

{dÎmr¶ {dda{U¶m± V¡¶ma H$aZo H$s C{MV gw{Z{üVVm àXmZ H$aZo

VWm à~§YH$ d H§$nZr Ho$ {ZXoeH$ Ho$ àm{YH$aU Ho$ AZwê$n

àm{á d ì¶¶ H$mo V¡¶ma H$aZm VWm 3) Aàm{YH¥$V AO©Z H$m

Cn¶moJ d H§$nZr H$s n[ag§n{Îm¶m| Ho$ ì¶¶ H$s amoH$Wm‘ AWdm

g‘¶mZwgma nVm bJmZo Ho$ ~mao ‘| C{MV gw{Z{üVVm CnbãY

H$admZm {Oggo B§S>EEg {dÎmr¶ {dda{U¶m| na VmpËdH$ à^md

n‹S> gH$Vm h¡ &

{dÎmr¶ [anmo{Qª>J na Am§V[aH$ {dÎmr¶ {Z¶§ÌH$ H$s A§Va{ZhrV

n[agr‘m :

{‘br^JV H$s g§^mdZm ¶m {Z¶§ÌU Ho$ AYr^mdr AZw{MV à~§YZ,

A{Z¶‘VmAm| AWdm N>b H$nQ> VWm Ìw{Q>¶m| Ho$ H$maU ‘Q>r[a¶b

{‘gñQ>oQ>‘|Q> H$mo em{‘b H$aHo$ {dÎmr¶ [anmo{Qª>J na Am§V[aH$

{dÎmr¶ {Z¶§ÌH$ H$s A§Va{ZhrV n[agr‘m Ho$ H$maU K{Q>V hmo

gH$Vm h¡ {OgH$mo nH$‹S>Zm ‘w‘{H$Z Zht h¡ & ^mdr Ad{Y ‘|

{dÎmr¶ [anmo{Qª>J na {H$gr ‘yë¶m§H$Z Ho$ àH$bZ H$m Am§V[aH$

{dÎmr¶ {Z¶§ÌU Ho$ OmopI‘ na hmoJm {Og na n[apñW{V¶m| ‘|

hþE n[adV©Z Ho$ H$maU An¶m©á AWdm Zr{V¶m| ¶m à{H«$¶m Ho$

AZwnmbZ H$s {S>J«r go {dH¥$V hmoJm &

¶mo½¶ am¶ Ho$ {bE AmYma

h‘mao Ûmam Xr JB© OmZH$mar Am¡a ñnï>rH$aU Ho$ AZwgma h‘mar am¶ ‘| Am¡a h‘mar Am°{S>Q> à{H«$¶m Ho$ AmYma na H§$nZr Ho$ g§MmbZ à^md ‘| {ZåZ {bpIV ‘Q>o[a¶b H$s H$‘Omoar H$s nhMmZ H$s JB© h¡, 31 ‘mM©, 2019 H$mo {dÎmr¶ [anmo{Qª>J na Am§V[aH$ {dÎmr¶ {Z¶§ÌU {H$¶m J¶m &

74

^m.H$.{Z.

C.C.I.


The Basic Principles of Internal Audit requires that the internal audit function shall be positioned outside the functions which are subject to internal audit (e.g., Finance and Accounts) and the Internal Auditor shall report directly to the highest governing body of the Company. Furthermore, segregation of duties requires assigning different persons the responsibilities of authorizing transactions, recording transactions and maintaining custody of assets i.e. segregation based on maker and checker. Segregation of duties is intended to reduce the opportunities to allow any person to be in a position to both perpetrate and conceal errors or fraud in the normal course of the person’s duties. From the organisation chart provided, it is observed that the reporting by the internal auditors for branches and the head office is to the Chief General Manager (Finance & Commercial) to whom various other functional heads, including those from branches, report. The effectiveness of entity level controls, especially controls that monitor other controls, are thus rendered weak due to such consolidation of duties for implementation of meaningful control strategies and therefore need to be segregated.

Qualified Opinion

In our opinion, except for the possible effects of the material weakness described above in the Basis for Qualified Opinion paragraph, the Company has, in all material respects, adequate internal financial controls over financial reporting with reference to these financial statements and such internal financial controls over financial reporting with reference to these financial statements were operating effectively as at March 31, 2019, based on the internal control over financial reporting criteria established by the Company considering the essential components of internal control stated in the Guidance Note on Audit of internal Financial Controls over Financial Reporting issued by the ICAI.

We have considered the material weakness identified and reported above in determining the nature timing and extent of audit tests applied in our audit of Ind AS financial statements of the Company as at and for the year ended 31 March 2019 and the material weakness do not affect our opinion on the Ind AS financial statements of the Company.

Am§V[aH$ Am°{S>Q> Ho$ AmYma na {gÕm§Vm| H$s Amdí¶H$Vm h¡ {H$

Am§V[aH$ Am°{S>Q> ’§$ŠeZ H$mo CZ H$m¶m] Ho$ ~mha V¡ZmV {H$¶m

OmEJm Omo Am§V[aH$ Am°{S>Q> (O¡go {dÎmr¶ Am¡a boIm) Ho$ AYrZ h¢

Am¡a Am§V[aH$ Am°{S>Q>a grYo H§$nZr Ho$ CƒV‘ g§MmbZ {ZH$m¶ H$mo

[anmoQ>© H$a|Jo & BgHo$ Abmdm, H$V©ì¶m| Ho$ AbJ-AbJ ì¶{º$¶m|

H$mo boZXoZ H$mo [aH$m°S>© H$aZo Am¡a {hamgV ¶m g§n{Îm ~ZmE aIZo

H$s Amdí¶H$Vm hmoVr h¡ & H$V©ì¶m| H$m n¥W¸$aU {H$gr ^r ì¶{º$

H$mo XmZm| hr pñW{V¶m| ‘| hmoZo H$s g§^mdZm H$mo H$‘ H$aZo Am¡a

Ìw{Q>¶m| H$mo {N>nmZo ¶m ì¶{º$ Ho$ gm‘mÝ¶ nmR>çH«$‘ ‘| YmoImY‹S>r

H$aZo Ho$ Adgam| H$mo H$‘ H$aZo H$m BamXm h¡ & g§JR>Z MmQ>© go ¶h

XoIm J¶m h¡ {H$ emImAm| Ho$ {bE Am§V[aH$ boIm narjmAm| Ûmam

[anmo{Qª>J Am¡a MmQ>© ‘| Ìw{Q> hþB© h¢ & ¶h XoIm J¶m h¡ {H$ emImAm|

Am¡a ‘w»¶mb¶ Ho$ {bE Am§V[aH$ boIm narjmAm| Ûmam [anmo{Qª>J

‘w»¶ à~§YH$ ({dÎmr¶ Am¡a dm{UpÁ¶H$) Ho$ {bE h¡ {OÝh| {d{^Þ

AÝ¶ ’§$ŠeZ à‘wI h¢, {Og‘| emImE§ em{‘b h¢, BH$mB© ñVa

{Z¶§ÌUm| H$s [anmoQ>© do {deof ê$n go {Z¶§ÌU Omo AÝ¶ {Z¶§ÌUm|

H$s {ZJamZr H$aVo h¢, Bg àH$ma gmW©H$ {Z¶§ÌU aUZr{V¶m| Ho$

H$m¶m©Ýd¶Z Ho$ {bE H$V©ì¶m| Ho$ Bg Vah Ho$ g‘oH$Z Ho$ H$maU

H$‘Omoa h¢ AmJo Bg{bE CÝh| AbJ H$aZo H$s Amdí¶H$Vm h¡ &

¶mo½¶ am¶

h‘mar am¶ ‘|,¶mo½¶ am¶ n¡amJ«m’$ Ho$ {bE AmYma ‘| D$na d{U©V

‘hËdnyU© H$‘Omoar Ho$ g§^m{dV à^mdm| H$mo N>mo‹S>H$a, H§$nZr Zo

g^r {dÎmr¶ ‘m‘bm| ‘| BZ {dÎmr¶ dº$ì¶m| Am¡a Bg Vah Ho$

Am§V[aH$ {dÎmr¶ {Z¶§ÌUm| Ho$ g§X^© ‘| {dÎmr¶ [anmo{Qª>J na n¶m©á

Am§V[aH$ {dÎmr¶ {Z¶§ÌU {H$¶m h¡& BZ {dÎmr¶ dº$ì¶m| Ho$ g§X^©

‘| {dÎmr¶ [anmo{Qª>J 31 ‘mM©, 2019 VH$ à^mdr ê$n go Mb

ahr Wr, H§$nZr Ûmam ñWm{nV {dÎmr¶ [anmo{Qª>J ‘mZX§S>m| na {dÎmr¶

[anmo{Qª>J na Am§V[aH$ {Z¶§ÌU Ho$ AmYma na Am§V[aH$ {dÎmr¶

{Z¶§ÌUm| Ho$ Am°{S>Q> na AmB© gr B AmB© Ûmam Omar {Xem{ZX}e ‘|

Am§V[aH$ {Z¶§ÌU Ho$ Amdí¶H$ KQ>H$m| na {dMma {H$¶m J¶m h¡ &

h‘Zo H§$nZr Ho$ 31 ‘mM© 2019 H$mo g‘má hþE df© Ho$ {bE B§S>

Eg {dÎmr¶ {ddaUm| ‘| D$na d{U©V {MpÝhV Ed§ [anmoQ>© H$s J¶r

‘Q>o[a¶b H$‘Omoar na {dMma H$aVo hþE h‘mao Am°{S>Q> ‘| bmJy

Am°{S>Q> narjUm| H$s àH¥${V g‘¶ Am¡a gr‘m {ZYm©[aV H$aZo ‘|

{dMma {H$¶m J¶m h¡ Ed§ ‘Q>o[a¶b H$‘Omoar H§$nZr Ho$ {dÎmr¶

{ddaUm| na h‘mar am¶ H$mo à^m{dV Zht H$aVr h¡&

75


^m.H$.{Z.

C.C.I.


gZXr boImnmb





gZXr boImnmbChartered Accountants(’$‘© a{OñQ´>oeZ Z§. 103142 S>ãë¶y/S>ãë¶y100292)Firm Registration No: 103142W/W100292


777676


77


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

31 ‘mM©, 2019 H$m VwbZ-nÌ BAlAnce Sheet AS At mARch 31, 2019

(én¶o bmI ‘|)/(Rupees in Lakh)

{ddaUparticulars

ZmoQ>g²notes

{X. 31 ‘mM© 2019 H$mo

As at 31st march 2019

{X. 31 ‘mM© 2018 H$mo

As at 31st march 2018

{X. 01 Aà¡b 2017 H$moAs at 1st

April 2017

(I) n[ag§n{Îm¶m±/Assets

1 J¡a Mmby n[ag§n{Îm¶m±/non current Assets

(H$) g§n{Îm, ßbm§Q> VWm CnH$aU(a) Property, Plant and Equipment 2A 1,978.13 1,774.21 1,902.21

(I) ny±OrJV H$m¶© àJ{V na/ (b) Capital Work in Progress 2B 10.80 1.74 -

(J) {Zdoe g§n{Îm (c) Investment Properties 3 2,729.74 2,790.65 2,851.56

gmI / Goodwill - -(K>) A‘yV© n[ag§n{Îm¶m±/(d) Intangible Assets 4 0.32 0.69 0.79 (S>) {dÎmr¶ n[ag§n{Îm¶m±/(e) Financial Assets (i) {Zdoe/Investments 5 0.01 0.01 0.01 (ii) ì¶mnma àmß¶/Trade Receivables 6A - - - (iii) F$U/Loans 7 227.47 276.47 306.02 (iv) AÝ¶ {dÎmr¶ n[ag§n{Îm¶m±/ (iv) Other Financial Assets 8 177.75 171.32 174.25 (Q>) AmñW{JV H$a n[ag§n{Îm¶m±/(f) Deferred Tax Assets 9 5,462.68 6,608.92 6,941.49 (R>) AÝ¶ J¡a-Mmby n[ag§n{Îm¶m°±/(g) Other Non Current assets 10A 232.47 217.48 213.63 Hw$b J¡a-Mmby n[ag§n{Îm¶m±/total non-current Assets 10,819.37 11,841.49 12,389.96

2 Mmby n[ag§n{Îm¶m±/current Assets (H$) ‘mb gy{M¶m±/(a) Inventories 11 2,47,579.38 1,67,785.00 18,188.48 (I) {dÎmr¶ n[ag§n{Îm¶m±/(b) Financial Assets (i) {Zdoe/(i) Investments 5 - - - (ii) ì¶mnma àmß¶/(ii) Trade Receivables 6B 6,895.32 6,104.86 3,279.24 (iii) ZH$X d ZH$X g‘H$j (iii) Cash and Cash Equivalents 12A 313.23 1,405.00 459.44 (iv) ~¢H$ eof Cn¶wº$ (iii) H$mo N>mo‹S>H$a (iv) Bank Balances other than (iii) above 12B 47.69 44.59 41.90 (v) F$U/(v) loans 7 79.30 94.65 105.25 (vi) AÝ¶ {dÎmr¶ n[ag§n{Îm¶m±/ (vi) Other Financial Assets 8 2,56,320.99 3,14,962.94 2,95,894.99 (J) AÝ¶ Mmby n[ag§n{Îm¶m±/(c) Other Current Assets 10B 13,185.83 8,297.44 1,706.52

777676


77


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

(K) {~H«$s hoVw amoH$s JB© dJuH¥$V n[ag§n{Îm¶m± (d) Assets Classified as Held For Sale 2C - 23.08 - (S>) Mmby H$a n[ag§n{Îm¶m±/(e) Current Tax Assets 13 1,562.62 931.54 1,229.43 Hw$b Mmby n[ag§n{Îm¶m±/total current Assets 5,25,984.36 4,99,649.10 3,20,905.25 Hw$b n[ag§n{Îm¶m±/total Assets 5,36,803.73 5,11,490.59 3,33,295.21

(II) B{¹$Q>r Ed§ Xo¶VmE± / equity and liabilities1 B{¹$Q>r/equity

(H$) B{¹$Q>r eo¶a ny±Or/(a) Equity Share Capital 14 2,500.00 2,500.00 2,500.00 (I) AÝ¶ B{¹$Q>r/(b) Other Equity 15 32,856.99 27,931.85 27,375.84 Hw$b B{¹$Q>r/total equity 35,356.99 30,431.85 29,875.84

2 Xo¶VmE±/liabilities(1) J¡a-Mmby Xo¶VmE±/(1) non current liabilities(H$) {dÎmr¶ Xo¶VmE±/(a) Financial Liabilities

(i) CYmar/H$O© (i) Borrowings - - - - (ii) ì¶mnma Xo¶VmE±/(ii) Trade Payables - - - gyú‘ Am¡a bKw CÚ‘m| H$m Hw$b ~H$m¶m Total Outstanding dues of Micro and Small Enterprises - - - gyú‘ Am¡a bKw CÚ‘m| Ho$ Abmdm Hw$b ~H$m¶m

Total Outstanding dues other than Micro and Small Enterprises - - -

(iii) AÝ¶ {dÎmr¶ Xo¶VmE±/ (iii) Other Financial liabilities 19A 1,208.98 770.40 933.19 (I) àmdYmZ/(b) Provisions 16A 6,605.98 6,518.33 12,273.92 (J) ApñW{JV H$a Xo¶VmE±/(c) Deferred Tax liabilities(K) AÝ¶ J¡a-Mmby Xo¶VmE±/(d) Other Non Current Liabilities - - -Hw$b J¡a-Mmby Xo¶VmE±/Total Non Current liabilities 7,814.96 7,288.73 13,207.11 (2) Mmby Xo¶VmE±/(2) current liabilities(H$) {dÎmr¶ Xo¶VmE±/(a) Financial Liabilities (i) CYmar/H$O© (i) Borrowings 17 4,74,459.59 4,44,200.00 2,78,500.00 (ii) ì¶mnma Xo¶VmE±/(ii) Trade Payables 18 gyú‘ Am¡a bKw CÚ‘m| H$m Hw$b ~H$m¶m Total Outstanding dues of Micro and Small Enterprises 1,872.74 64.93 2.73 gyú‘ Am¡a bKw CÚ‘m| Ho$ Abmdm Hw$b ~H$m¶m

Total Outstanding dues other than Micro and Small Enterprises 4,222.77 4,834.44 394.49

(iii) AÝ¶ {dÎmr¶ Xo¶VmE°§ (iii) Other Financial liabilities 19B 4,802.66 6,973.79 2,912.95 (I) àmdYmZ/(b) Provisions 16C 404.99 292.94 314.43 (J) H$‘©Mmar bm^ ~mÜ¶Vm(c) Employee Benefits Obligations 16B 1,323.10 3,130.71 1,706.58 (K) gaH$mar AZwXmZ /(d) Government Grants - - -

797878


79


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

(S>) Mmby H$a Xo¶VmE°§ /(e) Current Tax liabilities 20 1,654.80 545.00 444.40 (N>) AÝ¶ Mmby Xo¶VmE±/ (f) Other Current liabilities 21 4,891.13 13,728.20 5,936.68 Hw$b Mmby Xo¶VmE±/total current liabilities 4,93,631.78 4,73,770.01 2,90,212.26 Hw$b Xo¶VmE±/total liabilities 5,01,446.74 4,81,058.74 3,03,419.37 Hw$b B{¹$Q>r Ed§ Xo¶VmE±/total equity and liabilities 5,36,803.73 5,11,490.59 3,33,295.21

‘hÎdnyU© boIm Zr{V¶m| H$m {dÎmr¶ {dda{U¶m| H$m ^mJ ~ZmZodmbo AÝ¶ ZmoQ> - 1 go 57Significant Accounting Policies and Notes forming part of Financial Statements - 1 to 57

H¥$Vo Ed§ {ZXoeH$ ‘§S>b H$s Amoa goFor and on behalf of Board of Directors

(S>m°. nr. A{„ amZr) (dr. p. Alli Rani)

AÜ¶j Ed§ à~§Y {ZXoeH$Chairman-cum-Managing Director

DIN : 02305257

{XZm§H$/Date : 28/06/2019hñVmja H$m ñWmZ : ZB© {X„r Place of Signature : New Delhi

(àXrn Hw$‘ma AJ«dmb) (pradeep Kumar Agarwal)

{ZXoeH$ ({dÎm) Director (Finance)

DIN : 05234132

(b{bV Hw$‘ma JwßVm) (lalit Kumar Gupta)

H§$nZr g{MdCompany Secretary

M.No.: 46871

h‘mar g‘g§»¶H$ VmarI H$s g§b¾ [anmoQ>© Ho$ AZwgmaIn Terms of our Report of Even Date Attached

H¥$Vo ~doOm E§S> H$m¡bfor Baweja & Kaul

gZXr boImnmbchartered Accountants

(’$‘© a{OñQ´>oeZ Z§. 005834EZ)Firm Registration No. 005834N

H¥$Vo Or ~r gr E E§S> Egmo{gEQ²>g EbEbnrfor G B c A & Associates llp


(’$‘© a{OñQ´>oeZ Z§. 103142S>ãë¶y/S>ãë¶y100292)Firm Registration No. : 103142W/W100292

g§{dV Hw$. JwaQy>(Samvit K. Gurtoo)

^mJrXma$/ Partner

gXñ¶Vm H«$. 090758Membership No. : 090758

{XZm§H$ / Date : 28/06/2019hñVmja H$m ñWmZ : ZB© {X„rPlace of Signature : New Delhi

g§Ord bmbZ(Sanjeev lalan)

^mJrXma$/ Partner

gXñ¶Vm H«$. : 045329Membership No. : 045329

{XZm§H$ / Date : 28/06/2019 hñVmja H$m ñWmZ : ZB© {X„rPlace of Signature : New Delhi

797878


79


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

31 ‘mM©, 2019 H$mo g‘mßV df© H$s bm^ Am¡a hm{Z {ddaUrStAtement of pRofit And loSS foR the YeAR ended 31St mARch, 2019

(én¶o bmI ‘|)/(Rs. in Lakh)

{ddaUParticulars

ZmoQ>g²Notes

31 ‘mM©, 2019 H$mo g‘mßV df©

Year ended 31st March 2019

31 ‘mM©, 2018 H$mo g‘mßV df©

Year ended 31st March 2018

(i) n[aMmbZ go amOñd/Revenue from operations 22 2,83,245.43 1,17,353.06

(ii) AÝ¶ Am¶/other income 23 1,314.90 1,018.44

(iii) Hw$b Am¶ (i+ii) / total income (i+ii) 2,84,560.33 1,18,371.50(iV) ì¶¶ /expenses

(H$) Cn^moJ H$s JB© gm‘J«r H$s bmJV (a) Cost of Material Consumed 24 3,00,837.84 1,31,339.73

(I) ì¶mnma Ho$ {bE ‘mb H$s IarX (b) Purchase of Stock in Trade 4,050.33 96,343.02

(J) V¡¶ma ‘mb, ì¶mnm[aH$ ñQ>m°H$ VWm à{H«$¶mJV ñQ>m°H$ H$s ‘mb gy{M¶m| ‘| n[adV©Z

(c) Changes in Inventories of finished goods, W.I.P., stock In trade 25 (83,096.20) (1,48,718.70)

(K) H$‘©Mmar bm^ ì¶¶/ (d) Employee Benefit Expenses 26 9,360.16 9,286.27

(M) {dÎm bmJV /(e) Finance Cost 27 27,977.29 25,250.63

(N>) ‘yë¶õmg Am¡a n[aemoYZ ì¶¶ (f) Depreciation and amortization Expenses 383.45 241.51

(O) AÝ¶ ì¶¶/(g) Other expenses 28 17,405.77 9,603.71

Hw$b ì¶¶ (iV)/total expenses (iV) 2,76,918.64 1,23,346.17

(V)AndmXmË‘H$ Am¡a AgmYmaU ‘Xm| go nhbo bm^/(hm{Z) VWm H$a (iii-iV)Profit/(Loss) before exceptional and extraordinary items and tax (iii-iV) 7,641.69 (4,974.67)

(Vi) AndmXmË‘H$ ‘X| ì¶¶/(Am¶)exceptional items expense/(lncome) 29 (182.55) (6,827.11)

(Vii) H$a go nhbo bm^/(hm{Z) (V+Vi)Profit/(Loss) before tax (V+VI) 7,824.24 1,852.44

(Viii) H$a ì¶¶ /tax expense

(H$) dV©‘mZ H$a/(a) Current Tax 1,654.80 545.00

(I) AmñW{JV H$a/(b) Deferred Tax 1,081.82 889.96

(J) nyd© Ad{Y go g§~§{YV g‘m¶moOZ(c) Adjustment relating to Prior period (11.74) 0.00

Hw$b H$a ì¶¶ /total tax expense (Viii) 2,724.88 1,434.96

(iX) df© Ho$ {bE bm^/(hm{Z) (Vii-Viii)/Profit/(Loss) for the year (Vii-Viii) 5,099.36 417.48

818080


81


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

(X) AÝ¶ ì¶mnH$ Am¶(AmogrAmB©)/Other Comprehensive Income (OCI)

(H$)do ‘X| {OÝh| bm^ ¶m hm{Z Ho$ {b¶o nwZdJuH¥$V Zht {H$¶m Om¶oJm (a) Items that will not be reclassified to profit or loss:

(i) nm[a^m{fV bm^ ¶moOZmAm| H$m nwZ: ‘yë¶m§H$Z (i) Remeasurements of the Defined benefit plans 227.03 (148.06)

(ii) Am¶H$a H$m à^md /(ii) lncome Tax Effect (64.42) 69.42

AÝ¶ ì¶mnH$ Am¶ (H$a H$m ewÕ) (I)total other comprehensive income (net of tax) (X) 162.61 (78.64)

(Xi) Hw$b ì¶mnH$ Am¶ (H$+I) / total comprehensive income (iX + X) 5,261.97 338.84

(Xii) à{Veo¶a AO©Z /earnings per share:‘yb (én¶o ‘|)/Basic (in Rs.) 203.97 16.70

VZwH¥$V (én¶o ‘|)/ Diluted (in Rs.) 203.97 16.70

‘hÎdnyU© boIm Zr{V¶m| H$m {dÎmr¶ {dda{U¶m| H$m ^mJ ~ZmZodmbo AÝ¶ - ZmoQ> 1 go 57 Significant Accounting Policies and Notes forming part of Financial Statements - Note 1 to 57




DIN : 02305257{XZm§H$ /Date : 28/06/2019hñVmja H$m ñWmZ : ZB© {X„r Place of Signature : New Delhi



DIN : 05234132



M.No.: 46871

h‘mar g‘g§»¶H$ VmarI H$s g§b¾ [anmoQ>© Ho$ AZwgmaIn Terms of our Report of Even Date Annexed

H¥$Vo ~doOm EÊS> H$m¡bfor Baweja & KaulgZXr boImnmbchartered Accountants(’$‘© a{OñQ´>oeZ Z§. 005834EZ)Firm Registration No. 005834N

Or ~r gr E EÊS> Agmo{gEQ²>g EbEbnrfor G B c A & Associates llp gZXr boImnmbchartered Accountants (’$‘© a{OñQ´>oeZ Z§. 103142 S>ãë¶y/S>ãë¶y100292)Firm Registration No. : 103142W/W100292

g§{dV Hw$. JwaQy>(Samvit K. Gurtoo)^mJrXma$/ PartnergXñ¶Vm H«$. 090758Membership No. : 090758{XZm§H$ / Date : 28/06/2019hñVmja H$m ñWmZ : ZB© {X„rPlace of Signature : New Delhi

g§Ord bmbZ(Sanjeev lalan)^mJrXma$/ PartnergXñ¶Vm H«$. : 045329Membership No. : 045329{XZm§H$ / Date : 28/06/2019 hñVmja H$m ñWmZ : ZB© {X„rPlace of Signature : New Delhi

818080


81


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

31 ‘mM©, 2019 H$mo g‘má df© Ho$ {b¶o B{¹$Q>r ‘| n[adV©Z H$m {ddaU StAtement of chAnGeS in equitY AS At 31St mARch 2019

H$) B{¹$Q>r eo¶a ny±Or /A. equity Share capital(én¶o bmI ‘|)/(Rs. in Lakh)

{X. 31 ‘mM©, 2019 H$moAs at 31st march 2019

{X. 31 ‘mM©, 2018 H$moAs at 31st march 2018

eo¶am| H$s g§»¶mno. of Shares

am{eAmount

eo¶am| H$s g§»¶mno. of Shares

am{eAmount

1 Aà¡b, 2018 H$mo eof Balance as at April 01, 2018 2,500,000 2,500 2,500,000 2,500

df© Ho$ Xm¡amZ eo¶a ny±Or B{¹$Q>r ‘| n[adV©Z Changes in Equity Share capital during the year - - - -

31 ‘mM© 2019 H$mo eof Balance as at March 31, 2019 2,500,000 2,500 2,500,000 2,500

I) (i) 31.03.2019 H$mo AÝ¶ B{¹$Q>r /B. (i) other equity as on 31.03.2019(i) a{jV d A{Yeof /(i) Reserves and surplus


{ddaU particulars

H$) gm‘mÝ¶ a{jV

(a) GeneralReserve

I) à{VYm[aV AO©Z

(b) Retainedearnings

J) AÝ¶ ì¶mnH$ Am¶

(c) othercomprehensive

income

Hw$b total

1 Aà¡b, 2018 H$mo eof / Balance as at April 1, 2018 2,798.86 25,265.18 (132.19) 27,931.85

boIm Zr{V ‘| n[adV©Z AWdm nyd© Ad{Y go g§~§{YV n[adV©ZChanges in accounting policy or prior period changes - 0.73 - 0.73

[anmo{Q>ªJ Ad{Y Ho$ àma§^ na nwZ:dJuH¥$V eof Restated balance at the beginning of the reporting period 2,798.86 25,265.91 (132.19) 27,932.58

df© Ho$ {bE Hw$b ì¶mnH$ Am¶ Total Comprehensive Income for the year - 5,099.36 162.61 5,261.96

{dÎmr¶ df© 2017-18 Ho$ {b¶o Xo¶ bm^m§e VWm bm^m§e {dVaU H$a / Dividand and DDT for FY 2017-18 - (337.56) - (337.55)

31 ‘mM© 2019 H$mo eof /Balance as at March 31, 2019 2798.86 30027.71 30.42 32856.99

838282


83


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

I) (ii) 31.03.2018 H$mo AÝ¶ B{¹$Q>r/B. (ii) other equity as on 31.03.2018(i) a{jV d A{Yeof /(i) Reserves and surplus


{ddaU particulars

H$) gm‘mÝ¶ a{jV

(a) GeneralReserve

I) à{VYm[aV AO©Z

(b) Retainedearnings


(c) other comprehensive

lncome

Hw$btotal

1 Aà¡b, 2017 H$mo eof /Balance as at April 01, 2017 2,798.86 24,630.53 (53.55) 27,375.85

boIm Zr{V ‘| n[adV©Z AWdm nyd© Ad{Y go g§~§{YV n[adV©Z Changes In Accounting policy or prior period changes - - - -

‘¡Q> Ho«${S>Q> nmÌVm /MAT Credit Entitlement - 487.97 487.97

[anmo{Q>ªJ Ad{Y Ho$ àma§^ na nwZ: dJuH¥$V eofRestated balance at the beginning of the reporting period 2,798.86 25,118.50 (53.55) 27,863.81

df© Ho$ {bE Hw$b ì¶mnH$ Am¶Total Comprehensive Income for the year - 417.48 (78.64) 338.83

{dÎmr¶ df© 2016-17 Ho$ {b¶o àñVm{dV bm^m§e H$m [adg©b VWm Cg na bm^m§e {dVaU H$a Reversal of proposed dividend and DDT thereon(FY 2016-17) - (270.80) - (270.80)

31 ‘mM© 2018 H$mo eof / Balance as at March 31, 2018 2798.86 25265.18 (132.19) 27931.85I) (iii) 31.03.2017 H$mo AÝ¶ B{¹$Q>r /B. (iii) other equity as on 31.03.2017(i) a{jV d A{Yeof /(i) Reserves and surplus


{ddaU particulars

H$) gm‘mÝ¶ a{jV

(a) General Reserve

I) à{VYm[aV AO©Z

(b) Retained earnings


(c) othercomprehensive

income

Hw$b total

1 Aà¡b, 2016 H$mo eof/ Balance as at April 01, 2016 2,798.86 23,660.34 - 26,459.20

boIm Zr{V ‘| n[adV©Z AWdm nyd© Ad{Y go g§~§{YV n[adV©Z Changes in accounting policy or prior period changes. - (175.42) - (175.42)

‘¡Q> H«o${S>Q> nmÌVm / MAT Credit Entitlement - 2,023.34 2,023.34

[anm{Q>ªJ Ad{Y Ho$ àma§^ ‘| nwZ: dJuH¥$V eof Restated balance at the beginning of the reporting period 2,798.86 25,508.26 -

28,307.12

df© Ho$ {bE Hw$b ì¶mnH$ bm^Total Comprehensive Income for the year - (455.27) (53.55) (508.82)

{dÎmr¶ df© 2015-16 Ho$ {b¶o àñVm{dV bm^m§e H$m [adg©b VWm Cg na bm^m§e {dVaU H$a Reversal of proposed dividend and DDT thereon (FY 2015-16) - (422.46) - (422.46)

31 ‘mM© 2017 H$mo eof/Balance as at March 31, 2017 2798.86 24630.53 (53.55) 27375.84

n[a^m{fV bm^ ¶moOZmAmo| H$m nwZ‘©yë¶m§H$Z

838282


83


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.




DIN : 02305257




DIN : 05234132



M.No.: 46871







(’$‘© a{OñQ´>oeZ Z§. 103142 S>ãë¶y/S>ãë¶y100292)Firm Registration No. : 103142W/W100292


^mJrXma$/ Partner




^mJrXma$/ Partner



858484


85


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

31 ‘mM©, 2019 H$mo g‘mßV df© Ho$ {bE ZH$Xr àdmh {ddaUrcASh floW StAtement foR the YeAR ended 31St mARch 2019

(én¶o bmI ‘|) / (Rs. in Lakh)

31 ‘mM©, 2019 H$mo g‘mßV df©for the

year ended 31st march 2019

31 ‘mM©, 2018 H$mo g‘mßV df©for the

year ended 31st march 2018

(H$) n[aMmbZ J{V{d{Y¶m| go ZH$Xr àdmh :(A) cash flow from operating Activities :H$a Ho$ nyd© ewÕ bm^ / Net profit Before Tax 7,824.23 1,852.43

g‘m¶moOZ Ho$ {bE / Adjustment for

‘yë¶õmg Am¡a n[aemoYZ ì¶¶ Depreciation & Amoritization Expenses 383.45 241.51

ã¶mO Am¶ /Interest Income (33.50) (35.59)

{dÎmr¶ bmJV / Finance Costs 27,977.29 25,250.63

àmdYmZ {OZH$s A~ Amdí¶H$Vm Zht h¡Provision no longer required (177.27) (6,494.51)

ñWm¶r n[ag§n{Îm¶m| H$s {~H«$s na (bm^)/hm{Z na hm{Z(Profit)/loss on sale of fixed asset (5.55) 28,144.42 (0.72) 18,961.32

H$m¶©H$mar ny±Or ‘| n[adV©Z Ho$ nyd© ZH$X n[aMmbZ àdmh Operating cash flows before working capital changes 35,968.65 20,813.75 n[ag§n{Îm¶m| d Xo¶VmAm| Ho$ n[aMmbZ ‘| n[adV©ZChanges In operating assets and liabilities

ì¶mnma àmpßV ¶mo½¶ ‘| (d¥{Õ)/KQ>m¡Vr (Increase)/Decrease In Trade Receivables (790.46) (2,794.09)

‘mbgyMr ‘| (d¥{Õ)/KQ>m¡Vr(Increase) / Decrease in Inventories (79,794.38)

(1,49,596.53)

AÝ¶ Mmby {dÎmr¶ n[ag§n{Îm¶m| ‘| (d¥{Õ)/KQ>m¡Vr (Increase)/Decrease in other current financial Assets 58,937.41 (19,363.42)

AÝ¶ Mmby n[ag§n{Îm¶m| ‘| (d¥{Õ)/KQ>m¡Vr(Increase)/Decrease in Other Current Assets (4,888.38) (6,590.91)

J¡a-Mmby n[ag§n{Îm¶m| ‘| (d¥{Õ)/KQ>m¡Vr(Increase)/Decrease In Non current Assets (15.00) (3.85)

AÝ¶ J¡a Mmby {dÎmr¶ n[ag§n{Îm¶m| ‘| (d¥pÕ)/ KQ>m¡Vr(Increase)/Decrease In Other Non-Current Financial Assets (6.43) 2.93

ì¶mnma ^wJVmZ ¶mo½¶ ‘| d¥{Õ/(KQ>m¡Vr)Increase/(Decrease) In trade Payables 1,196.13 4,502.16

XrKm©d{Y àmdYmZmo ‘| d¥{Õ/(KQ>m¡Vr)Increase/(Decrease) in Long Term Provisions 87.64 754.68

858484


85


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

bKw Ad{Y àmdYmZm| ‘| d¥{Õ/(KQ>m¡Vr)Increase/(Decrease) in Short Term Provisions 112.06 (21.48)

AÝ¶ J¡a Mmby {dÎmr¶ Xo¶VmAm| ‘| d¥{Õ/(KQ>m¡Vr)Increase/ (Decrease) in Non-Current Other Financial Liablities 438.59 (162.79)

AÝ¶ {dÎmr¶ Xo¶VmAm| ‘| d¥{Õ/(KQ>m¡Vr)Increase/(Decrease) in other Financial Liablities (2,171.13) 4,060.85

H$‘©Mmar bm^ Xm{¶Ëd ‘| d¥{Õ/(KQ>m¡Vr)Increase/(Decrease) in Employee benefits obligations (1,807.60) 1,424.13

AÝ¶ Mmby Xo¶VmAm| ‘| d¥{Õ/(KQ>m¡Vr)Increase/(Decrease) in other Current Liablities

(8,837.06) (37,538.61) 7,791.51 (1,59,996.81)

n[aMmbZ go {Z{‘©V ZH$X àdmhCash flow Generated from Operations (1,569.96) (1,39,183.06)àXÎm Am¶H$a (YZ dmngr H$m ewÕ)Income Taxes Paid (Net of Refund) (1,062.26) (47.88)

n[aMmbZ J{V{d{Y¶m± go ewÜX ZH$X àdmh (H$)net cash from operating Activities (A) (2,632.22) (1,39,230.94)(I) {Zdoe J{V{d{Y¶m| go ZH$X àdmh(B) cash flow from investing Activities

g§n{Îm Ho$ {Z‘m©U, ßbm§Q> d CnH$aU AWdm IarX Purchase or construction of Property, Plant and equipment (507.49) (78.86)

{Zdoe H$s IarX / Purchase of Investments - -

g§n{Îm, ßbm§Q> d CnH$aU H$s {~H«$sProceeds on sale of Property, plant and equipment 8.44 3.74

{Zdoe H$s {~H«$s na Am¶ Proceeds on sale of Investment - -

AÝ¶ ~¢H$ {S>nm°{OQ> ‘| ewÕ CVma-M‹T>md Net movement in other bank deposits (3.10) (2.69)

àmß¶ bm^m§e / Interest received 33.50 (468.65) 35.59 (42.22)

{Zdoe H$s JB© J{V{d{Y¶m| go {Zdb ZH$X àdmh (I)net cash generated from investing activites (B) (468.65) (42.22)(J) {dÎmr¶ J{V{d{Y¶m| go ZH$X àdmh(c) cash flow from financial Activities :Aënmd{YH$ CYma (ewÕ) go àmßV am{e (H$s MwH$m¡Vr)Proceed from / (Repayment of) short Term Borrowings (Net) 30,259.59 1,65,700.00

Mmby {dÎmr¶ n[ag§n{Îm¶m| H$m nwZ: ^wJVmZ - F$URepayment of finacial current asset - loans 15.35 10.60

878686


87


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

J¡a Mmby {dÎmr¶ n[ag§n{Îm¶m| H$m nwZ: ^wJVmZ - F$URepayment of Non current financial asset - loans 49.00 29.55

bm^m§e ^wJVmZ (bm^m§e na H$a em{‘b H$aHo$) Dividend Paid (Including tax on Dividend) (337.55) (270.80)

{dÎmr¶ bmJV H$m ^wJVmZ / Finance cost paid (27,977.29) 2,009.10 (25,250.63) 1,40,218.72

ewÕ ZH$X àdmh/(Cn¶moJ ‘|) {dÎmr¶ J{V{d{Y¶m± (J)Net cash flow/(Used in) Financing Activities (c) 2,009.10 1,40,218.72 (K) ZJX ‘| ewÕ n[adV©Z VWm ZH$X g‘Vwë¶

(H$+I+J) (D) Net changes in cash and cash

equivalents (A+B+C) (1,091.77) 945.56

(S>) df© Ho$ àma§^ na ZH$X d ZJX g‘Vwë¶ (ZmoQ> 12 XoI|)

(E) Cash and cash equivalents at the beginning of the year (refer note 12) 1,405.00 459.44

(M) df© Ho$ A§V ‘| ZH$X d ZJX g‘Vwë¶ (ZmoQ> 12 XoI|)

(F) Cash and cash equivalents at the end of the year (refer note 12) 313.23 1,405.00

ZmoQ²>g :1. Cnamoº$ ZH$Xr àdmh {ddaU ZH$X àdmh {ddaUr na B§S> EEg 7 ‘| {ZYm©[aV "'AàË¶j nÕ{V'' Ho$ A§VJ©V V¡¶ma H$s JB© h¡ & 2. ZH$X àdmh {ddaUr Ho$ AZwgma ZH$X g‘mYmZ d ZH$X g‘Vwë¶ &

Note:1. The above cash flow statement has been prepared under the “Indirect method” as set out in AS-7 on Statement

of cash Flow.2. Reconciliation of cash and cash equivalents as per cash flow statement :

Cn¶w©º$ Ho$ AZwgma {ZåZ{bpIV amoH$‹S> g‘m{hV H$aVo hþE ZH$X d ZH$X g‘Vwë¶Cash and cash equivalents as per above comprise of the following

hmW ‘| ZH$X / Cash on hand - -

hmW ‘| MoH$, S´>mâQ>g, ñQ>¡ång / Cheques, Drafts, Stamp on hand - -

~¢H$ Ho$ gmW eof / Balances with banks - -

- Mmby ImVo na / On curent accounts 313.23 1,124.61

- H¡$e H«o${S>Q> na / On cash credit - 280.39

df© H$s g‘m{á na ZH$X d ZH$X g‘Vwë¶Cash and cash equivalents at the end of the year 313.23 1,405.00

‘hÎdnyU© boIm {Z{V¶m| H$m {dÎmr¶ {ddaUr¶m|H$m ^mJ ~ZmZodmbo AÝ¶ ZmoQ> - 1 go 57Significant Accounting Policies and Notes forming part of Financial Statements - 1 to 57

878686


87


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.




DIN : 02305257




DIN : 05234132



M.No.: 46871







(’$‘© a{OñQ´>oeZ Z§. 103142S>ãë¶y/S>ãë¶y100292)Firm Registration No. : 103142W/W100292


^mJrXma$/ Partner




^mJrXma$/ Partner



88


89


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

notes to the financial Statements

Note 1 : Company Information, Significant Accounting policies and other explanatory information

Reporting entity

The Cotton Corporation of India Ltd. (the “Company”) is a company limited by shares, incorporated on 31st July 1970 and domiciled in India (CIN: U51490MH1970GOI14733). The Company is a Government of India Undertaking under administrative control of Ministry of Textiles and engaged in the trading activity of cotton. As per mandate given by the Govt. of India, the Corporation is the Central Nodal Agency to undertake Minimum Support Price (MSP) operations as and when the prices of raw cotton touch the support price announced by the Govt. of India. In the event of kapas prices ruling above MSP level, Corporation also undertakes commercial operations.

The registered office of the Company is situated at ‘Kapas Bhawan’. Plot 3A, Sector 10,CBD Belapur, Navi Mumbai-400614. The company has 19 procurement branches, sales offices and warehousing complex locating in all major cotton growing states.

1.1 Statement of compliance with ind AS

These financial statements have been prepared in accordance with Indian Accounting Standards (Ind AS) notified under section 133 of the Companies Act, 2013. The financial statements have also been prepared in accordance with the relevant presentation requirements of the Companies Act, 2013. The Company has adopted Ind AS from 01st April, 2017. The accounting policies are applied consistently to all the periods presented in the financial statements.

1.2 Recent Accounting pronouncements :

On 30th March 2019, the Ministry of Corporate Affairs (MCA) has notified Ind AS 116 Leases, under Companies (Indian Accounting Standards) Amendment Rules, 2019 which is applicable with effect from 1st April, 2019.

{dÎmr¶ {dda{U¶m| Ho$ ZmoQ²g

ZmoQ> 1 : H§$nZr H$s OmZH$mar, ‘hÎdnyU© boIm§H$Z Zr{V¶m± Ed§ AÝ¶ ì¶m»¶mË‘H$ OmZH$mar

[anmo{Qª>J EZ{Q>{Q>

^maVr¶ H$nmg {ZJ‘ {b. H$s (EH$ H§$nZr) eo¶g© Ûmam ¶h H§$nZr

dó ‘§Ìmb¶ Ho$ àemg{ZH$ {Z¶§ÌU Ho$ AYrZ bmoH$ CÚ‘ H$m¶m©b¶

h¡ VWm {b{‘Q>oS> H§$nZr (CIN: U51490MH1970GOI14733)

Ho$ ê$n ‘| 31 OwbmB© 1970 H$mo ñWmnZm H$s JB© Omo ^maV ‘|

A{Ydmgr h¡ & H$nmg H$s ì¶mnm[aH$ J{V{d{Y¶m| ‘| bJr h¡, ^maV

gaH$ma Ûmam {XE JE AmXoe Ho$ AZwgma O~ H$^r H$nmg ‘yë¶

^maV gaH$ma Ûmam Kmo{fV Ý¶yZV‘ g‘W©Z ‘yë¶ H$mo Ny>Zo bJo

Vmo {ZJ‘ goÝQ´>b ZmoS>b EO|gr Ho$ ê$n ‘| H$m¶© H$aZo Ho$ {bE

Ý¶yZV‘ g‘W©Z ‘yë¶ na n[aMmbZ H$aVm h¡ & {ZJ‘ Ý¶yZV‘

g‘W©Z ‘yë¶ Ho$ ñVa go A{YH$ H$nmg ‘yë¶ nhþ±MZo H$s pñW{V

‘| dm{UÁ¶ n[aMmbZ ^r H$aVm h¡ &

{ZJ‘ H$m n§OrH¥$V H$m¶m©b¶ "H$nmg ^dZ' ßbm°Q> 3 E goŠQ>a

10, gr~rS>r ~obmnwa Zdr ‘w§~B©-400 614 na pñWV h¡& H§$nZr

Ho$ ‘w»¶ ‘w»¶ g^r H$nmg CËnmXH$ amÁ¶m| ‘| 19 IarXr emImE°§,

{~H«$s H$m¶m©b¶ d doAa hmD$qgJ H$m°ånboŠg h¡ &

1.1 AZwnmbZ {ddaU B§S>EEg

BZ {dÎmr¶ {dda{U¶m| H$mo maVr¶ boIm ‘mZH$ (B§S> EEg)

Ho$ AZwgma V¡¶ma {H$¶m J¶m h¡ Omo H§$nZrO A{Y{Z¶‘

2013 H$s Ymam 133 Ho$ A§VJ©V {ZYm©[aV h¢ & {dÎmr¶

{ddaUr H§$nZrO Ho$ A{Y{Z¶‘ 2013 Ho$ Amdí¶H$VmAm|

Ho$ AZwgma V¡¶ma {H$E JE h¡ & H§$nZr Zo 1 Aà¡b, 2017

go B§S>EEg H$mo AnZm¶m h¡, boIm§H$Z Zr{V¶m| H$mo {dÎmr¶

{ddaUm| ‘| àñVwV g^r Ad{Y¶m| na bJmVma bmJy {H$¶m

OmVm h¡ &

1.2 hmb hr ‘| boIm§H$Z KmofUmE°§:

30 ‘mM© 2019 H$mo H$m°anmoaoQ> ‘m‘bm| Ho$ ‘§Ìmb¶ (E‘grE) Zo 116 nÅ>m| Ho$ ê$n ‘| A{Ygy{MV {H$¶m h¡, H§$nZrO (^maVr¶ boIm ‘mZH$m|) g§emoYZ {Z¶‘m| 2019 Ho$ B§S>EEg VhV Omo 1 Aà¡b 2019 go bmJy hmoVm h¡ &

88


89


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

Ind AS 116 sets out the principles for the recognition, measurement, presentation and disclosure of leases for both parties to a contract i.e., the lessee and the lessor. Ind AS 116 introduces a single lease accounting model for lessee and requires the lessee to recognize right of use assets and lease liabilities for all leases with a term of more than twelve months, unless the underlying asset is low value in nature. Currently, operating lease expenses are charged to the statement of profit and loss.

Ind AS 116 substantially carries forward the lessor accounting requirements in Ind AS 17. As per Ind AS 116, the lessee needs to recognize depreciation on rights of use assets and finance costs on lease liabilities in the statement of profit and loss. The lease payments made by the lessee under the lease arrangement will be adjusted against the lease liabilities.

The Company is currently evaluating the impact on account of implementation of Ind AS 116 which might have significant impact on profit & loss and balance sheet items i.e. Earnings before interest, tax, depreciation and amortization (EBITDA), Plant, Properties and Equipments etc.

1.3 Basis of preparation

All assets and liabilities have been classified as current or non-current as per the Company’s normal operating cycle and other criteria set out in Schedule III to the Companies Act, 2013. Based on the nature of products and the time between the acquisition of products for processing and their realization in cash and cash equivalents, the company has ascertained its operating cycle as 12 months for the purpose of current/ non-current classification of assets and liabilities.

Historical Cost Convention :

The Financial Statements have been prepared on a historical cost basis except for the following :

a) Certain Financial assets and liabilities that are measured at fair value.

B§S>EEg 116 Ho$ ê$n ‘|, EH$ AZw~§Y Ho$ {bE XmoZm| njm| Ho$ nÅ>m| H$s ‘mÝ¶Vm, ‘mn, àñVwVr Am¡a àH$Q>rH$aU Ho$ {bE CÔoí¶m| H$mo {ZYm©[aV H$aVm h¡, nÅ>oXma Am¡a nÅ>mXmVm B§S>EEg 116 Ho$ ê$n ‘| nÅ>oXma nÅz> Ho$ {bE EH$b nÅ>m boIm ‘m°S>b H$m n[aM¶ XoVm h¡ Am¡a nÅ>oXma H$mo AnZo A{YH$ma H$mo nhMmZZo H$s Amdí¶H$Vm hmoVr h¡ 12 go A{YH$ ‘hrZmo H$s Ad{Y Ho$ gmW-gmW nÅ>m| Ho$ {bE nmag§n{Îm¶m§ Am¡a nÅ>o ^r XoZXm[a¶m| H$m Cn¶moJ {H$¶m O~ VH$ {H$ A§V{Z©{hV n[ag§n{Îm ZoMa go H$‘ ‘yë¶ Zht hmoVr h¡ & dV©‘mZ ‘| n[aMmbZ nÅ>o H$m IM© bm^ Am¡a hm{Z Ho$ {ddaU Ho$ {bE n[aMmbZ nÅ>o H$m IM© {b¶m OmVm h¡ &

B§S> EEg 116 Ho$ ê$n ‘| B§S>EEg 17 boIm§H$Z AmJo H$s Amoa bo OmVm h¡ & 116 Ho$ AZwgma B§S>EEg bm^ Am¡a hm{Z Ho$ {ddaU ‘| nÅ>o na XoZXm[a¶m| H$m Cn¶moJ g§n{Îm Am¡a {dÎm bmJV Ho$ A{YH$mam| na ‘yë¶hm²g H$mo nhMmZZo H$s Oê$aV h¡ & nÅ>m ì¶dñWm Ho$ VhV nÅ>oXma Ûmam {H$¶o JE nÅ>o Ho$ ^wJVmZ H$mo nÅ>o H$s Xo¶VmAm| H$mo g‘m¶mo{OV {H$¶m OmEJm &

H§$nZr dV©‘mZ ‘| B§S>EEg 116 Ho$ ê$n ‘| H$m¶m©Ýd¶Z Ho$

H$maU à^md H$m ‘yë¶m§H$Z H$a ahr h¡ & Omo bm^ Am¡a

hm{Z Am¡a ~¡b|g erQ> na ‘hÎdnyU© à^md S>mb gH$Vm h¡

¶m{Z ã¶mO H$a ‘yë¶hmg Am¡a n[aemoYZ g§¶§Ì, g§n{Îm¶m|

Am¡a CnH$aUm| go nhbo H$s H$‘mB© &

1.3 V¡¶ma H$aZo H$m AmYma

H§$nZrO A{Y{Z¶‘ 2013 H$s AZwgyMr III ‘| {ZYm©[aV AÝ¶ ‘mZX§S> d H§$nZrO gm‘mÝ¶ n[aMmbZ MH«$ Ho$ AZwgma g^r n[ag§n{Îm¶m± d Xo¶VmAm| H$m Mmby d J¡a Mmby Ho$ ê$n ‘| {dûcofU {H$¶m J¶m h¡ & CËnmXZ H$s àd¥{Îm VWm CËnmXZ Ho$ A{YJ«hU d g§gmYZ d ZH$X dgybr VWm ZH$X g‘Vwë¶ H|$ ~rM Ho$ g‘¶ Ho$ AmYma na H§$nZr Zo n[ag§n{Îm¶m| d Xo¶VmAm| Ho$ Mmby / J¡aMmby {dûcofU Ho$ CÔoí¶ go 12 ‘hrZm| Ho$ n[aMmbZ MH«$ H$m Xmdm {H$¶m h¡ &

E{Vhm{gH$ bmJV g‘Pm¡Vm :

{ZåZ{bpIV H$mo N>mo‹S>H$a {dÎmr¶ {ddaU E{Vhm{gH$ bmJV na

V¡¶ma {H$E JE h¡ &

H$) {dÎmr¶ n[ag§n{Îm¶m± d Xo¶VmE°§ {OZH$m C{MV ‘yë¶ na AmH$bZ {H$¶m J¶m h¡ &

90


91


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

b) Defined Benefit Plans: Plan assets measured at fair value.

1.4 functional and presentation currency

The Financial Statements of the Company are presented in INR which is the Company’s functional currency. All amounts have been rounded to the nearest lakh, unless otherwise stated.

1.5 inventories

Cost comprises all costs of purchase, costs of conversion and other costs incurred in bringing the inventory to the present location and condition.

Net Realizable Value (NRV) is the estimated selling price in the ordinary course of business less the estimated costs of completion and the estimated costs necessary to make the sale.

(a) Purchased finished goods are valued at cost or NRV whichever is lower.

(b) FP Bales/Lint are valued at –

(i) Average cost or NRV whichever is lower in respect of commercial purchases not contracted for sale.

(ii) Average cost in respect of FP bale/Lint not contracted for sale under Support Price Operations. NRV for the purpose of stock under support price operations includes the losses reimbursed by Government of India on account of sale below average cost, if

any.

(iii) Average cost or contracted rates whichever is lower in respect of quantities meant for sale in domestic market (whenever contracted for and approved by buyers).

(iv) Average cost or contracted rates as reduced by contracted freight and cartage etc. whichever is lower in case of quantities meant for export (Wherever contracted for).

I) n[a^m{fV bm^ ¶moOZm : ¶moOZm n[ag§n{Îm¶m| H$m C{MV ‘yë¶ na AmH$bZ {H$¶m J¶m h¡ &

1.4 H$m¶m©Ë‘H$ d àñVw{V H$a§gr

H§$nZr Ho$ ¶o {dÎmr¶ {ddaU ^maVr¶ ‘mZH$ ê$. ‘| àñVwV

{H$E OmVo h¢ Omo H§$nZr H$s H$m¶m©Ë‘H$ ‘wÐm h¡ & g^r

am{e¶m| H$mo ZOXrH$s bmI ê$. ‘| amC§S> Am°’$ {H$¶m J¶m

h¡ & O~ VH$ AÝ¶Wm Z H$hm J¶m hmo &

1.5 ‘mbgyMr (B§Ýd|Q´>r)

‘mbgyMr H$mo àoOoÝQ> bmoHo$eZ VWm H§$S>reZ ‘| bmZo Ho$ {bE bmJV ‘| IarXr H$s g^r bmJV|, ê$nm§VaU na bmJV VWm AÝ¶ bmJVm| g^r na {H$¶m J¶m ì¶¶ em{‘b h¡ &

ewÕ ~moYJå¶ ‘yë¶ (EZAmadr) ì¶dgm¶ Ho$ gmYmaU nmR>çH«$‘ ‘| {~H«$s H$m AZw‘m{ZV ‘yë¶ h¡ Omo nyU©Vm H$s AZw‘m{ZV bmJVm| Am¡a {~H«$s H$aZo Ho$ {bE Amdí¶H$ AZw‘m{ZV bmJVm| go H$‘ h¡&

H$) IarXo JE V¡¶ma ‘mb na ‘yë¶ bmJV na AWdm ewÕ àmß¶ ¶mo½¶ ‘yë¶ Omo ^r H$‘ hmo, bJm¶m OmVm h¡ &

I) nyU©~§{YV Jm±R>m|/ ê$B© H$m ‘yë¶ -

(i) {~H«$s Ho$ {bE g§{dXmJV Z H$s hþB© Jm±R>m| Ho$ dm{UpÁ¶H$ IarX Ho$ ~mao ‘| Am¡gV bmJV AWdm ~mOma ewÕ dgybr ¶mo½¶ ‘yë¶ Omo ^r H$‘ hmo &

(ii) Ý¶yZV‘ g‘W©Z ‘yë¶ n[aMmbZ Ho$ A§VJ©V {~H«$s Ho$ {bE g§{dXmJV Z H$s hþB© Jm±R>m| Ho$ ~mao ‘| Am¡gV bmJV na, ¶{X Bg n[aMmbZ Ho$ A§VJ©V H$moB© hm{Z hmoVr hmo, Vmo dh ^maV gaH$ma go à{Vny{V© ¶mo½¶ h¡ & g‘W©Z ‘yë¶ n[aMmbZ Ho$ VhV ñQ>m°H$ Ho$ à¶moOZ Ho$ {bE EZAmadr ‘| ^maV gaH$ma Ûmam à{Vny{V© Am¡gV go H$‘ {~H«$s Ho$ H$maU ZwH$gmZ H$mo em{‘b {H$¶m J¶m h¡, ¶{X H$moB© hmo&

(iii) Kaoby ~mOma ‘| {~H«$s Ho$ {bE Am¡gV ‘mÌm ¶m AZw~§{YV Xa| Omo ^r H$‘ hm| (O~ ^r IarXmam| Ho$ {bE AZw~§{YV Am¡a AZw‘mo{XV hm|)&

(iv) {Z¶m©V Ho$ {bE ‘mÌm Ho$ ~mao ‘| (Ohm± H$ht g§{dXm H$s JB© hmo) g§{dXmJV Am¡a Tw>bmB© Am{X Ûmam KQ>m¶r JB© Am¡gV bmJV ¶m g§{dXmJV ‘yë¶, Omo ^r H$‘ hmo &

90


91


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

(v) Cost of export stocks is arrived at after including direct expenses incurred up to the point at which the stocks are lying. Similarly the realizable value is derived by deducting from the market price the expenses to be incurred from that point to the stage where they are sold.

(c) Stocks of seeds contracted for sale are valued at contracted rates and other stocks of seeds are valued at the market/net realizable value at the end of reporting period since the cost of seeds cannot be ascertained separately.

(d) Raw Material i.e. Kapas is valued at average cost calculated quality wise, centre wise and cotton year wise. However, when there has been a decline in the price of Raw Material i.e. Kapas and it is estimated that the cost of the finished goods i.e. FP Bales will exceed net realizable value of raw material, the value of Kapas is written down to net realizable value.

(e) Raw Material i.e. Kapas purchased under the Support Price Operations is valued at average cost calculated quality wise and cotton year wise, since the loss suffered under such operations, if any, is reimbursable by Government of India.

(f) Yellow picking and sample bales are valued at realizable value.

(g) Stock of un-issued hessian/grey cloth, bardanas, gunny bags, iron hoops and pesticides are valued at average cost price.

(h) Tarpaulins are being written off over a period of three years.

1.6 cash flow Statements

Cash Flow Statement, as per Ind AS-7, is prepared using the indirect method, whereby profit for the period is adjusted for the effects of transactions of a non-cash nature, any deferrals or accruals of past or future operating cash receipts or payments and items of income or expenses associated with investing or financing cash flows. The cash flows from operating, investing and financing activities of the company are segregated.

(v) àË¶j IM© Omo ñQ>m°H$ aIr JB© OJh VH$ {H$E JE h¡, H$mo em{‘b H$aHo$ {Z¶m©V ñQ>m°H$ {ZH$mbm J¶m h¡& d¡go hr ~mOma ‘yë¶ IMm] H$mo KQ>mH$a dgybr ¶mo½¶ ‘yë¶ {ZH$mbm OmVm h¡ & BZ IMm] ‘| do IM© ^r em{‘b h¡ Omo Cg ñWmZ go {~H«$s ñWmZ VH$ {H$E

JE h¢ &

J) {~Zm¡bm {~H«$s Ho$ {bE g§{dXmJV ñQ>m°H$ H$m ‘yë¶ AZw~§{YV Xam| na bJm¶m OmVm h¡ VWm {~Zm¡bm H$m AÝ¶ ñQ>m°H$ df© H$s g‘m{á na ewÕ àmß¶ ‘yë¶ / ‘mH}$Q> ‘yë¶ na bJm¶m OmVm h¡ Š¶m|{H$ {~Zm¡bm H$s bmJV H$m ‘yë¶ AbJ go Zht bJm¶m Om gH$Vm h¡ &

K) H$ƒm ‘mb ¶m{Z H$nmg H$m ‘yë¶m§H$Z JwUdÎmm dma, Ho$ÝÐ dma VWm H$nmg df© dma bJm¶m OmVm h¡ & VWm{n O~ H$ƒm ‘mb ¶m{Z H$nmg Ho$ ‘yë¶ ‘| {JamdQ> AmVr h¢ VWm ¶h AZw‘mZ bJm¶m OmVm h¡ {H$ V¡¶ma dñVwAm| ¶m{Z H$s bmJV (¶m{Z nyU© ~§{YV Jm±R>m|) ewÕ àmß¶ ‘yë¶ go A{YH$ hmoJr Vmo H$nmg H$m ‘yë¶ ewÕ àmß¶ ‘yë¶ go H$‘ bJm¶m OmVm h¡ &

S.) H$ƒm ‘mb ¶m{Z Ý¶yZV‘ g‘W©Z ‘yë¶ Ho$ A§VJ©V IarXr JB© H$nmg Ho$ ‘yë¶ H$s JUZm Am¡gV bmJV na JwUdÎmm dma VWm H$nmg df© dma bJm¶r OmVr h¡ & Š¶m|{H$ Bg n[aMmbZ Ho$ A§VJ©V hþB© hm{Z ¶{X hmo, Vmo BgH$s à{Vny{V© ^maV gaH$ma Ûmam H$s OmVr h¡ &

M) ¶obmo {nqH$J VWm Z‘yZm Jm±R>m| H$m ‘yë¶m§H$Z CJmho OmZo dmbo ‘yë¶ na bJm¶m OmVm h¡ &

N>) AZwn¶moJr h¡{g¶Z/J«o Šbm°W, ~maXmZ, JZr ~¡½g, Am¶aZ hÿßg VWm noñQ>rgmB©S²g Ho$ ñQ>m°H$ H$mo Am¡gV bmJV ‘yë¶ na ‘yë¶m§H$Z {H$¶m OmVm h¡ &

O) VrZ dfm] H$s Ad{Y na Vmanmo{bÝg H$mo ~Å>o ImVo ‘| S>mb {X¶m J¶m h¡ &

1.6 ZH$X àdmh {dda{U¶m±

B§S> EEg-7 Ho$ AZwgma ZH$X àdmh {ddaU Ho$ {bE

AàË¶j nÕ{V H$m à¶moJ H$aVo hþE V¡¶ma {H$E OmVo h¡

Ohm± J¡a ZH$X àH¥${V Ho$ boZ XoZ Ho$ à^mdm| Ho$ {bE

bm^ H$s Ad{Y H$m g‘m¶moOZ {H$¶m OmVm h¡ & H§$nZr

Ho$ Am°naoqQ>J, BZdopñQ>§J VWm {dÎmr¶ J{V{d{Y¶m| go

ZH$X àdmh AbJ {H$E OmVo h¢ &

92


93


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

1.7 prior period items

Material prior period errors are corrected retrospectively by restating the comparative amounts for the prior periods presented in which the error occurred. If the error occurred before the earliest period presented, the opening balances of assets, liabilities and equity for the earliest period presented, are restated.

Any items exceeding 0.25% of total revenue for the year shall be considered as material prior period item.

1.8 events after the reporting period

Events after the reporting period are those events, favorable and unfavorable, that occur between the end of the reporting period and the date when the financial statements are approved by the Board of Directors.

Events, those provide evidence of conditions that existed at the end of the reporting period are recognized and adjusted in the financial statements and events those are indicative of conditions that arose after the reporting period are treated as non-adjusting events and are disclosed in notes to accounts.

1.9 income taxes

Income tax expense represents the sum of the tax currently payable and deferred tax.

current tax

The tax currently payable is based on taxable profit for the year. Taxable profit differs from ‘profit before tax’ as reported in the statement of profit or loss and other comprehensive income/statement of profit or loss because of items of income or expense that are taxable or deductible in other years and items that are never taxable or deductible. The Company’s current tax is calculated using tax rates that have been enacted or substantively enacted by the end of the reporting period.

1.7 nydm©d{Y ‘X|

nydm©d{Y ‘| àñVwV VwbZmË‘H$ am{e nwZ: ~VmZo go Ohm±

Ìw{Q> nm¶r JB© h¡, ‘Q>o[a¶b nyd© Ad{Y H$s Ìw{Q>¶m| H$mo

nyd©ì¶mnr ê$n Ûmam R>rH$ {H$¶m OmVm h¡ & ¶{X nyd© Ad{Y

go nhbo Ìw{Q> hþB© h¡ Vmo n[ag§n{Îm¶m| Ho$ Ama§{^H$ eof,

Xo¶VmE°§ d àñVwV H$s JB© nhbo H$s nydm©d{Y Ho$ {bE B{¹$Q>r

H$mo nwZ: ñWm{nV d ~hmb {H$¶m OmE &

Hw$b amOñd Ho$ 0.25% go A{YH$ {H$gr ‘X H$mo

‘Q>r[a¶b nyd©d{Y dñVw ‘mZm OmEJm &

1.8 [anmo{Q>ªJ Ad{Y Ho$ ~mX H$s KQ>Zm

[anmo{Q>ªJ Ad{Y Ho$ ~mX H$s KQ>ZmE§ do KQ>ZmE§ h¢, Omo

AZwHy$b Am¡a à{VHy$b h¢, Omo [anm{Q>ªJ Ad{Y Ho$ A§V

Am¡a Cg VmarI Ho$ ~rM hmoVr h¢ O~ {dÎmr¶ {ddaUm| H$mo

{ZXoeH$ ‘§S>b Ûmam AZw‘mo{XV {H$¶m OmVm h¡&

B©d|Q>, Omo CZ pñW{V¶m| Ho$ à‘mU àXmZ H$aVo h¢, Omo [anmo{Q>ªJ Ad{Y Ho$ A§V ‘| ‘m¡OyX Wo, CÝh| {dÎmr¶ {ddaUm| Am¡a KQ>ZmAm| ‘| nhMmZm Am¡a g‘m¶mo{OV {H$¶m OmVm h¡, Omo CZ pñW{V¶m| Ho$ g§Ho$V h¢ Omo [anmo{Q>ªJ Ad{Y Ho$ ~mX CËnÞ hþB© J¡a-g‘m¶moOZ KQ>ZmAm| Ho$ ê$n ‘| ‘mZr OmVr h¢ Am¡a boIm Ho$ ZmoQ²>g ‘| Iwbmgm {H$¶m OmVm h¡&

1.9 Am¶H$a

Am¶H$a ì¶¶ dV©‘mZ ‘| Xo¶ Am¡a AmñW{JV H$a H$s am{e H$mo Xem©Vm h¡ &

dV©‘mZ H$a

dV©‘mZ ‘| wJVmZ ¶mo½¶ H$a df© Ho$ H$a ¶mo½¶ bm^ na AmYm[aV

h¡ & H$a ¶mo½¶ bm^, bm^ ¶m hm{Z {ddaU Am¡a AÝ¶ ì¶mnH$

Am¶/ bm^ ¶m hm{Z {ddaU ‘| {XIm¶o J¶o H$a go nhbo bm^

go {^Þ hmoVm h¡ Š¶m|{H$ Am¶ ¶m ì¶¶ Omo AÝ¶ dfm] ‘| H$a

¶mo½¶ ¶m H$Q>m¡Vr ¶mo½¶ h¡ Am¡a Omo AmBQ>‘ H$^r ^r H$a ¶mo½¶

¶m H$Q>m¡Vr ¶mo½¶ Zht hmoVr h¡ & H§$nZr Ho$ Mmby H$a H$s JUZm

bmJy H$a H$s Xa go H$s OmVr h¡ Omo hmo ¶m [anmo{Q>ªJ Ad{Y Ho$

A§V VH$ ‘| bmJy hmo &

92


93


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

deferred tax

Deferred tax liabilities are the amounts of income taxes payable in future periods in respect of taxable temporary differences. Deferred tax liabilities are recognized for all taxable temporary differences.

Deferred tax assets are the amounts of income taxes recoverable in future periods in respect of:

(a) deductible temporary differences;

(b) the carry forward of unused tax losses; and

(c) the carry forward of unused tax credits.

Deferred tax assets are recognized for all deductible temporary differences, the carry forward of unused tax losses and carry forward of unused tax credits to the extent that it is probable that taxable profits will be available against which those deductible temporary differences can be utilized.

The carrying amount of deferred tax assets is reviewed at the end of each reporting period and reduced to the extent that it is no longer probable that sufficient taxable profits will be available to allow all or part of the asset to be recovered. Deferred tax liabilities and assets are measured at the tax rates that are expected to apply in the period in which the liability is settled or the asset realized, based on tax rates (and tax laws) that have been enacted or substantively enacted by the end of the reporting period.

minimum Alternate tax (mAt)

Minimum alternative tax (MAT) paid in accordance with tax laws, which gives rise to future economic benefit in form of adjustment of future income tax liability, is considered as an asset if there is convincing evidence that the Company shall pay normal tax in future. Accordingly, it is recognized as an asset in the balance sheet when it is probable that future economic benefit associated with it shall flow to the company and the asset can be measured reliably.

AmñW{JV H$a

AmñW{JV H$a XoZXm[a¶m§ H$a ¶mo½¶ AñWm¶r A§Va Ho$ g§~§Y ‘| ^{dî¶ H$s Ad{Y ‘| Xo¶ Am¶H$a H$s am{e h¢& AmñW{JV H$a XoZXm[a¶m| H$mo g^r H$a ¶mo½¶ AñWm¶r A§Vam| Ho$ {bE ‘mÝ¶Vm

àmá h¡ &

AmñW{JV H$a g§n{Îm ^{dî¶ Ho$ g‘¶ ‘| dgybr ¶mo½¶ Am¶H$a

H$s am{e h¢:

H$) AñWm¶r A§Va H$mo KQ>mH$a

I) Aà¶wº$ H$a ZwH$gmZ H$mo (AmJo bo OmH$a) H¡$ar ’$m°adS>© H$aHo$; VWm

J) Aà¶wº$ H$a H«o${S>Q> H$mo AmJo bo OmZo Ho$ {bE

AmñW{JV H$a n[ag§n{Îm¶m§ g^r H$Q>m¡Vr ¶mo½¶ AñWm¶r A§Vam|

Ho$ {bE nhMmZr OmVr h¢, Aà¶wº$ H$a KmQ>o go AmJo bo OmVr h¢

Am¡a Aà¶wº$ H$a H«o${S>Q>m| H$mo Bg hX VH$ AmJo bo OmVr h¢ {H$

¶h g§^d h¡ {H$ H$a ¶mo½¶ bm^ CnbãY hmoJm, {OgHo$ pIbm’$

CZ H$Q>m¡Vr ¶mo½¶ AñWm¶r A§Vam| H$m Cn¶moJ {H$¶m Om gH$Vm h¡&

AmñW{JV H$a n[ag§n{Îm¶m| H$s ~H$m¶m am{e H$s g‘rjm àË¶oH$

[anmo{Q>ªJ Ad{Y Ho$ A§V ‘| H$s OmVr h¡ Am¡a Bgo Cg gr‘m VH$

H$‘ {H$¶m OmVm h¡ {H$ n¶m©á H$a ¶mo½¶ bm^ dmngr ¶mo½¶ g§n{Îm

Ho$ g^r ¶m Hw$N> {hñgm| na {‘boJm & AmñW{JV H$a Xo¶VmE§ Am¡a

g§n{Îm¶m| H$m ‘yë¶m§H$Z Q>¡Šg Xa go {H$¶m OmVm h¡ Am¡a Eogr Amem

H$s OmVr h¡ {H$ ¶h Cg Ad{Y ‘| bmJy hmoJm {Og‘| Xm{¶Ëd H$m

{Zdm©h hmoVm h¡ ¶m g§n{Îm H$s dgybr hmoVr h¡ & ¶h [anmo{Q>ªJ Ad{Y

Ho$ A§V ‘| bmJy ¶m ‘yb ê$n go bmJy H$a Xam| (Am¡a H$a H$mZyZ)

na AmY[aV hmoVm h¡ &

Ý¶yZV‘ d¡H$pënH$ H$a (‘¡Q>)

Ý¶yZV‘ d¡H$pënH$ H$a (‘¡Q>) H$m H$a Ho$ {Z¶‘m| Ho$ AZwgma

^wJVmZ {H$¶m J¶m h¡, Omo {H$ ^{dî¶ ‘| Am¶ H$a Xo¶VmAm| Ho$

g‘m¶moOZ Ho$ ê$n ‘| Am{W©H$ bm^ H$mo ~‹T>mdm XoVm h¡, {OgH$mo

n[agån{Îm ‘mZm J¶m h¡, ¶{X Eogo àË¶jH$mar gmú¶ h¢ {H$ H§$nZr

^{dî¶ ‘| gm‘mÝ¶ H$a H$m ^wJVmZ H$aVr ahoJr & VX²Zwgma ¶h

g§^m{dV h¡ {H$ BgHo$ gmW Ow‹S>m ^mdr Am{W©H$ bm^ H§$nZr H$mo

~‹T>m¶oJm VWm VwbZ nÌ ‘| n[ag§n{Îm Ho$ ê$n ‘| ‘mÝ¶ {H$¶m Om¶oJm

VWm n[ag§n{Îm H$m {dœñV ‘yë¶m§H$Z {H$¶m Om gHo$Jm &

94


95


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

current and deferred tax for the year

Current and deferred tax are recognized in profit or loss, except when they relate to items that are recognized in other comprehensive income or directly in equity, in which case, the current and deferred tax are also recognized in other comprehensive income or directly in equity respectively.

1.10 property, plant and equipments (ppe)

An item of property, plant and equipment is recognized as an asset if and only if it is probable that future economic benefits associated with the item will flow to the company and the cost of the item can be measured reliably.

The initial cost of property, plant and equipment (PPE) comprises its purchase price, including import duties and non-refundable taxes and any directly attributable costs of bringing an asset to working condition and location for its intended use.

Property, plant and equipment are stated at cost of acquisition or construction less accumulated depreciation and impairment, if any. For this purpose, cost includes deemed cost which represents the carrying value of property, plant and equipment recognized as at 1st April, 2016 (transition date) measured as per the previous GAAP.

Subsequent costs are included in the carrying amount of asset or recognized as a separate asset, as appropriate, only when it is probable that future economic benefits associated with the item will flow to the Company and the cost of the item can be measured reliably. All other repairs and maintenance expenses are charged to the Statement of Profit and Loss during the period in which they are incurred.

Any amount paid/expenditure made in case of Property, plant and equipment which are not ready for intended use as on Balance Sheet date are disclosed as ‘Capital work-in-progress’.

df© Ho$ {bE dV©‘mZ Am¡a ñW{JV H$a

dV©‘mZ Am¡a AmpñWJV H$a H$s nhMmZ bm^ ¶m hm{Z ‘| H$s

OmVr h¡, {gdm¶ BgHo$ H$s O~ do CZ ‘Xm| go Omo‹S>o OmVo h¢

O~ CZH$s nhMmZ H«$‘e: AÝ¶ ì¶mnH$ Am¶ ¶m grYo B{¹$Q>r

‘| H$s OmVr h¡ &

1.10 g§n{Îm, ßbm§Q> Am¡a CnH$aU (nrnrB©)

g§n{Îm, g§¶§Ì Am¡a CnH$aUm| Ho$ EH$ AmBQ>‘ H$mo EH$ n[ag§n{Îm Ho$ ê$n ‘| ‘mÝ¶Vm Xr OmVr h¡ Am¡a Ho$db AJa ¶h g§^m{dV h¡ {H$ AmBQ>‘ go Ow‹S>o ^{dî¶ Ho$ Am{W©H$ bm^ H§$nZr H$mo {‘b|Jo Am¡a AmBQ>‘ H$s bmJV H$mo ‘µO~yVr go ‘mnm Om gH$Vm h¡

g§n{Îm H$s ewéAmVr bmJV ßbm§Q> Am¡a CnH$aUm| ‘| Am¶mV ewëH$ Am¡a J¡a dmngr¶mo½¶ IarX H$a g{hV BgH$s IarX ‘yë¶ em{‘b h¡ Am¡a {H$gr ^r g§n{Îm H$mo H$‘ H$aZo H$s pñW{V Am¡a CgHo$ BpÀN>V Cn¶moJ Ho$ {bE ñWmZ bmZo H$s àË¶j ê$n go {Oå‘oXma bmJV em{‘b h¡&

g§n{Îm, g§¶§Ì Am¡a CnH$aU A{YJ«hU ¶m {Z‘m©U H$‘

g§{MV ‘yë¶õmg Am¡a hm{Z H$s bmJV na H$hm OmVm h¡,

¶{X H$moB© hmo & Bg à¶moOZ Ho$ {bE, bmJV ‘| em{‘b

bmJV em{‘b h¡ Omo 1 Aà¡b, 2016 (g§H«$‘U {V{W) Ho$

ê$n ‘| ‘mÝ¶Vm àmá g§n{Îm, g§¶§Ì Am¡a CnH$aU Ho$ ‘yë¶

H$mo Xem©Vr h¡, Omo {nN>bo GAAP Ho$ AZwgma ‘mnm OmVm

h¡ &

~mX H$s bmJV n[ag§n{Îm¶m| H$s bo OmZo dmbr am{e ‘| em{‘b hmoVr h¡ ¶m EH$ AbJ n[ag§n{Îm Ho$ ê$n ‘| nhMmZm OmVm h¡ O~ C{MV hmo gH$Vm h¡ {H$ AmBQ>‘ Ho$ gmW Ow‹S>o ^{dî¶ Ho$ Am{W©H$ bm^ H§$nZr Ho$ {bE àdmh H$a|Jo Am¡a AmBQ>‘ H$s bmJV {dœgZr¶ ê$n go ‘mnm Om gH$Vm h¡& AÝ¶ g^r ‘aå‘V Am¡a aIaImd ì¶¶ H$mo Cg Ad{Y Ho$ Xm¡amZ bm^ Am¡a hm{Z Ho$ ~¶mZ na bJm¶m OmVm h¡, {Og‘| do IM© {H$E OmVo h¢ &

g§n{Îm g§¶§Ì Am¡a CnH$aU Ho$ ‘m‘bo ‘| {H$E JE {H$gr ^r am{e H$m ^wJVmZ / ì¶¶ Omo ~¡b|g erQ> H$s VmarI Ho$ AZwgma BpÀN>V Cn¶moJ Ho$ {bE V¡¶ma Zht h¡, H$mo ny§Or H$m¶©-àJ{V Ho$ ê$n ‘| àH$Q> {H$¶m J¶m h¡&

94


95


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

An item of PPE is de-recognized upon disposal or when no future economic benefits are expected to arise from the continued use of assets. Any gain or loss arising on disposal/retirement of PPE is determined as the difference between the net sales proceeds and the carrying amount of the asset and recognized in statement of profit and loss.

Depreciation methods, estimated useful lives and residual value:

Depreciation of PPE commences when the assets are ready for their intended use. Depreciation is provided on the straight-line method to allocate the cost of assets, net of their residual values, over their estimated useful lives which are equal to those provided under schedule II of the Companies Act, 2013.

Depreciation on the following assets is provided on their estimated useful life as per schedule II of the Companies Act, 2013 :-

Sr.no. Assets useful life

1. Buildings 60 Years2. Lab Equipments

(excluding Moisture Meters and Micronaire Testers)

10 Years

3. Office Equipment 5 Years4. Furniture & Fixtures 10 Years5. Vehicles 8 Years6. Computer Equipment

(a) Servers and Networks 6 Years(b) End User devices e.g. Desktop, Laptop, Printer etc. 3 Years

7. Electrical installations - Lifts and Elevators 10 Years

8. Railway sidings 15 Years9. Air Condition Plant 10 Years

Freehold land and land under perpetual lease are not depreciated.

{ZñVmaU Ho$ ‘X ‘| A‘mÝ¶ h¢ ¶m O~ H$moB© ^{dî¶ Ho$ Am{W©H$ bm^ H$s Cå‘rX Zht H$s OmVr h¡ Vmo n[ag§n{Îm¶m| Ho$ Cn¶moJ go CËnÞ hmoVr h¡ nrnrB© Ho$ {ZnQ>mZ/ godm{Zd¥{Îm na CËnÞ hmoVr h¡ & nrnrB© Ho$ {ZnQ>mZ/godm{Zd¥{Îm na CËnÞ hmoZodmbo {H$gr ^r bm^ ¶m hm{Z H$mo ewÕ {~H«$s Am¶ Am¡a n[ag§n{Îm H$s dhZ am{e Ho$ ~rM A§Va Ho$ ê$n ‘| {ZYm©[aV {H$¶m OmVm h¡ VWm bm^ Am¡a hm{Z Ho$ AZw^mJ ‘| ‘mÝ¶Vm àmá hmoVr h¡ &

‘yë¶õmg nÕ{V, AZw‘m{ZV Cn¶moJr OrdZ d Ad{eï> ‘yë¶ :

nrnrB© H$m ‘yë¶õmg V~ ewê$ hmoVm h¡ O~ n[ag§n{Îm AnZo BpÀN>V Cn¶moJ Ho$ {bE V¡¶ma hmoVr h¡& àË¶oH$ {dÎmr¶ df© H$s g‘m{á na Cn¶moJr Ad{Y Ho$ AZwgma grYr aoIm nÕ{V na ‘yë¶õmg àXmZ {H$¶m OmVm h¡, Omo H§$nZr A{Y{Z¶‘ 2013 H$s AZwgyMr II Ho$ A§VJ©V àXmZ {H$E JE ‘yë¶õmg Ho$ ~am~a h¡ &

H§$nZr A{Y{Z¶‘, 2013 H$s AZwgyMr II Ho$ AZwgma {ZåZ{bpIV n[ag§n{Îm¶m| na ‘yë¶õmg CZHo$ AZw‘m{ZV Cn¶moJr OrdZ na àXmZ {H$¶m OmVm h¡: -

H«$.

g§.n[ag§n{Îm¶m± Cn¶moJr OrdZ

1. {~pëS§>J 60 df©

2. b¡~ CnH$aU (‘m°Büa ‘rQ>g©

VWm ‘mBH«$moZo¶a Q>oñQ>g© H$mo

N>mo‹S>H$a)

10 df©

3. Am°{’$g CnH$aU 5 df©

4. ’${Z©Ma Ed§ {’$ŠgMg© 10 df©

5. dmhZ 8 df©

6.

$

H§$ß¶yQ>a CnH$aU

H$) gd©a Am¡a ZoQ>dH© 6 df©

I) A§V Cn¶moJH$Vm© CnH$aU

CXm. S>oñH$Q>m°n, b¡nQ>m°n qàQ>a B.3 df©

7. BbopŠQ´>H$b A{YñR>mnZ -

{bâQ> Ed§ BbodoQ>g© 10 df©

8. aobdo gmBqS>½g 15 df©

9. E¶a H§$S>reZ ßbm§Q> 10 df©

’«$shmoëS> ^y{‘ Am¡a ñWm¶r nÅ>o Ho$ VhV ^y{‘ H$m ‘yë¶õmg Zht {H$¶m OmVm h¡&

96


97


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

Estimates useful lives, residual values and depreciation method are reviewed at the end of each reporting period and if necessary, changes in estimates are accounted for prospectively.

Depreciation on additions/deletions to PPE during the year is provided for on pro rata basis with reference to the date of addition / deletion except Micronaire testers and Moisture Meters which are fully depreciated at the time of addition.

Land and building accounted under finance lease is amortized on a straight line basis over the period of lease. Other property, plant and equipment acquired under finance lease are depreciated over the asset’s useful life or over useful life of assets or lease term whichever is lower, if there is reasonable certainty that the Company will obtain ownership at the end of the lease term.

Where the life and/or efficiency of an asset is increased due to renovation, modernization and subsequent expenditure on account of capital improvement or other factors, such expenditure thereon along-with its unamortized depreciable amount is charged prospectively over the revised/remaining useful life of the assets.

1.11 investment properties

Investment properties are properties held to earn rentals and/or for capital appreciation (including property under construction for such purposes). Investment properties are measured initially at cost, including transaction costs. All of the Company’s property interests held under operating leases to earn rentals or for capital appreciation purposes are accounted for as Investment Properties.

Investment properties are stated at cost of acquisition or construction less accumulated depreciation and impairment, if any. For this purpose, cost includes deemed cost which represents the carrying value of Investment properties recognized as at 1st April, 2016

àË¶oH$ [anmo{Qª>J Ad{Y Ho$ A§V ‘| Cn¶moJr OrdZ, Ad{eï> ‘yë¶m| Am¡a ‘yë¶õmg nÕ{V H$s g‘rjm H$s OmVr h¡ Am¡a ¶{X Amdí¶H$ hmo, Vmo AZw‘mZm| ‘| n[adV©Z H$m AZw‘mZ bJm¶m OmVm h¡&

df© Ho$ Xm¡amZ nrnrB© H$mo Omo‹S>Zo /hQ>mZo Ho$ {bE n[adY©Z

/{dbmonZ na ‘yë¶õmg àmoaoQ>m Ho$ AmYma na àXmZ {H$¶m

OmVm h¡, BgHo$ Abmdm ‘m¶H«$moZo¶a Q>oñQ>a Am¡a Z‘r

‘rQ>g© H$mo N>mo‹S>H$a Omo {H$ nyar Vah go ‘yë¶õmg Ho$ g‘¶

‘| hVmg hmoVo h¡ &

{dÎm nÅ>m Ho$ VhV ^y{‘ Am¡a ^dZ H$mo nÅ>o H$s Ad{Y Ho$ AmYma na EH$ grYr aoIm Ho$ AmYma na g§emo{YV {H$¶m OmVm h¡ & {dÎm nÅ>o Ho$ VhV A{O©V AÝ¶ g§n{Îm, g§¶§Ì Am¡a CnH$aU g§n{Îm Ho$ Cn¶moJr OrdZ ¶m g§n{Îm Ho$ Cn¶moJr OrdZ ¶m g§n{Îm Ho$ Cn¶moJr OrdZ ¶m nÅ>o H$s Ad{Y ‘| Omo r H$‘ hmo, H$mo H$‘ H$a {X¶m OmVm h¡, AJa ¶h {Z{üV ê$n go C{MV h¡ {H$ H§$nZr nÅ>o H$s Ad{Y Ho$ A§V ‘| ñdm{‘Ëd àmá H$aoJr &

Ohm° EH$ n[ag§n{Îm H$m OrdZ Am¡a /¶m à^mdH$mar ZdrZrH$aU, AmYw{ZH$sH$aU Am¡a n§OrH¥$V B§àyd‘|Q> ¶m AÝ¶ dmñV{dH$ Ho$ ImVo na ~mX ‘| IM© hmoZo H$maU à^m{dV hmoVm h¡, BZ H$maH$mo na Bg Vah H$m, BgHo$ AZm{YH¥$V ‘yë¶õmg am{e Ho$ gmW Bg Vah H$m ì¶¶ g§n{Îm Ho$ g§emo{YV/eof Cn¶moJr OrdZ na g§^m{dV ê$n go bJm¶m OmVm h¡ &

1.11 {Zdoe g§n{Îm

{Zdoe g§n{Îm¶m± do g§n{Îm h¡ Omo {H$am¶m H$‘mZo Am¡a/¶m

ny±Or ‘| ~‹T>moVar (Eogo CÔoí¶ Ho$ {bE {Z‘m©UmYrZ g§n{Îm

em{‘b h¢) Ho$ {bE hmoVr h¡ & {Zdoe g§n{Îm H$m ‘yë¶m§H$Z

Ama§^ ‘| bmJV Xa na {H$¶m OmVm h¡ {Og‘| boZ-XoZ

bmJV em{‘b h¡& H§$nZr H$s g^r g§n{Îm¶m Am°naoqQ>J

brO Ho$ A§VJ©V {H$am¶m H$‘mZo ¶m ny§Or H$m {dñVma H$aZo

Ho$ CÔoí¶ Ho$ {bE {Zdoe g§n{Îm¶m| Ho$ ê$n ‘| boIm| ‘|

em{‘b H$s OmVr h¡ &

{Zdoe g§n{Îm¶m| H$mo A{YJ«hU ¶m {Z‘m©U na H$‘ g§{MV

‘yë¶õmg Am¡a Ag‘mZVm, ¶{X H$moB© hmo, CgH$s bmJV

na H$hm OmVm h¡ & Bg à¶moOZ Ho$ {bE bmJV ‘| g‘Pm

OmZodmbm ‘yë¶ bmJy hmoVm h¡ Omo {H$ dhZ ‘yë¶ H$m

à{V{Z{YËd H$aVm h¡ {nN>bo OrEEnr Ho$ AZwgma 01

96


97


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

(transition date) measured as per the previous GAAP.

An investment property is derecognized upon disposal or when the investment property is permanently withdrawn from use and no future economic benefits are expected from the disposal. Any gain or loss arising on de-recognition of the property (calculated as the difference between the net disposal proceeds and the carrying amount of the asset) is included in profit or loss in the period in which the property is derecognized.

Investment properties are depreciated in accordance to the class of asset that it belongs and the life of the asset shall be conceived as for the same class of asset.

1.12 intangible Assets

Intangible Assets are stated at cost less accumulated amortization and impairment loss, if any. For this purpose, cost includes deemed cost which represents the carrying value of Intangible Assets recognized as at 1st April, 2016 (transition date) measured as per the previous GAAP.

Intangible Assets, including Enterprise Resource Planning (ERP) project cost and other cost relating to such software which provides significant future economic benefits. These costs comprise of license fees and cost of system integration services.

Development expenditure qualifying as an intangible asset, if any, is capitalized, to be amortized over the economic life of the product.

Intangible assets that have finite lives are amortized over their estimated useful lives/license period by the straight line method unless it is practical to reliably determine the pattern of benefits arising from the asset. An intangible asset with an indefinite useful life is not amortized.

Aà¡b, 2016 (g§H«$‘U {V{W) Ho$ ê$n ‘| ‘mÝ¶Vm àmá

{Zdoe JwU &

O~ H$a {ZnQ>mZ {H$¶m OmVm h¡ ¶m {Zdoe g§n{Îm H$mo nyar

Vah go Cn¶moJ go hQ>m br OmVr h¡ Am¡a CgHo$ {ZnQ>mZ go

^{dî¶ ‘| H$moB© Am{W©H$ bm^ Zht {‘bZo H$s H$moB© Cå‘rX

hmoVr h¡ Vmo Eogr {Zdoe g§n{Îm H$s nhMmZ g‘má hmo OmVr

h¡ & g§n{Îm Ho$ {ZnQ>mZ go {H$gr bm^ ¶m hm{Z H$mo Cg df©

H$s Ad{Y ‘| bm^ hm{Z ‘| {b¶m OmVm h¡ {Og df© BgH$m

{ZnQ>mZ hmoVm h¡ & (BgH$s JUZm ewÕ {ZnQ>mZ Am¶ Am¡a

g§n{Îm H$s ‘yb am{e Ho$ A§Va na H$s OmVr h¡ &)

{Zdoe g§n{Îm na ‘yë¶õmg g§n{Îm H$s Cg loUr Ho$ AZwgma

bJm¶m OmVm h¡ {Oggo dh g§~§Y aIVr h¡ Am¡a g§n{Îm H$s

Ad{Y H$m AZw‘mZ g§n{Îm H$mo Cgr loUr Ho$ {bE bJm¶m

OmVm h¡ &

1.12 A‘yV© n[ag§n{Îm

A‘yV© n[ag§n{Îm¶m| H$m C„oI bmJV na H$‘ g§{MV n[aemoYZ VWm j{V ‘| hþB© hm{Z (¶{X H$moB© hmo) na {H$¶m J¶m h¡ & Bg à¶moOZ Ho$ {bE bmJV ‘| g‘Pm OmZodmbm ‘yë¶ bmJy hmoVm h¡ Om| {H$ dhZ ‘yë¶ H$m à{V{Z{YËd H$aVm h¡ & {nN>bo OrEEnr Ho$ AZwgma 01 Aà¡b, 2016 (g§H«$‘U {V{W) Ho$ ê$n ‘| ‘mÝ¶Vm àmá {Zdoe JwU &

BÝQ>aàmB©O [agmog© ßbmqZJ (B©Amanr) àmoOoŠQ> bmJV ‘|

em{‘b A‘yV© n[ag§n{Îm¶m± VWm AÝ¶ bmJV go g§~§{YV

Eogo gm°âQ>doAa Omo {d{eï> ê$n go Am{W©H$ bm^ XoVo h¡ &

BZ bmJVm| ‘| bmBg|g ’$sg VWm {gñQ>‘ B§Q>rJ«oeZ g{d©g

H$s bmJV H$m g‘mdoe h¡ &

CËnmXZ /Z‘yZo H$s Am{W©H$ OrdZr Ho$ D$na n[aemo{YV H$aZo Ho$ {bE A‘yV© n[ag§n{Îm Ho$ ê$n ‘| ¶mo½¶ {dH$mgmË‘H$ ì¶¶ ¶{X H$moB© hmo ny±OrH$aU {H$¶m OmVm h¡ &

A‘yV© n[ag§n{Îm {OZHo$ nmg n[a{‘V OrdZ h¡, CZHo$ AZw‘m{ZV Cn¶moJr OrdZ /bmBg|g H$s Ad{Y H$mo grYr aoIm {d{Y Ûmam n[aemo{YV {H$¶m OmVm h¡ O~ VH$ {H$ ¶h n[ag§n{Îm go CËnÞ hmoZo dmbo bm^m| Ho$ n¡Q>Z© H$mo ‘µO~yVr go {ZYm©[aV H$aZo Ho$ {bE ì¶mdhm[aH$ Zht h¡& EH$ A{Z{üV Cn¶moJr OrdZ Ho$ gmW EH$ A‘yV© n[ag§n{Îm n[aemoYZ Zht h¡&

98


99


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

All intangible assets are tested for impairment. Amortization expenses and impairment losses and reversal of impairment losses are taken to the Statement of Profit and Loss. Thus, after initial recognition, an intangible asset is carried at its cost less accumulated amortization and/or impairment losses.

The useful lives of intangible assets are reviewed at the end of each reporting period to determine if a reset of such useful life is required for assets with finite lives and to confirm that business circumstances continue to support an indefinite useful life assessment for assets so classified. Based on such review, the useful life may change or the useful life assessment may change from indefinite to finite. The impact of such changes is accounted for as a change in accounting estimate.

1.13 impairment of Assets

The carrying amount of assets is reviewed at the end of reporting period to assess if there is any indication of impairment based on internal/external factors. An impairment loss on such assessment will be recognized wherever the carrying amount of an asset exceeds its recoverable amount. The recoverable amount of the assets is net selling price (fair value less cost of disposal) or carrying value, whichever is higher.

While assessing value in use, the estimated future cash flows are discounted to the present value by using weighted average cost of capital. A previously recognized impairment loss is further provided or reversed depending on changes in the circumstances and to the extent that carrying amount of the assets does not exceed the carrying amount that will be determined if no impairment loss had previously been recognized.

1.14 Assets held for Sale

Non-current assets are classified as held for sale if its sale is highly probable. Assets that

hm{Z Ho$ {bE g^r A‘yV© g§n{Îm H$m narjU {H$¶m OmVm h¡& n[aemoYZ ì¶¶ Am¡a hm{Z hm{Z Am¡a hm{Z hm{Z H$m CbQ> bm^ Am¡a hm{Z Ho$ ~¶mZ Ho$ {bE bo Om¶m OmVm h¡& Bg àH$ma, àma§{^H$ ‘mÝ¶Vm Ho$ ~mX, EH$ A‘yV© g§n{Îm H$mo CgH$s bmJV H$‘ g§{MV n[aemoYZ Am¡a / ¶m hm{Z hm{Z na {H$¶m OmVm h¡&

A‘yV© g§n{Îm Ho$ Cn¶moJr OrdZ H$s g‘rjm àË¶oH$ g‘rjmYrZ Ad{Y Ho$ A§V ‘| H$s OmVr h¡ Vm{H$ ¶h {ZYm©[aV {H$¶m Om gHo$ {H$ n[a{‘V OrdZ Ho$ gmW g§n{Îm Ho$ {bE Eogo Cn¶moJr OrdZ H$m argoQ> Amdí¶H$ h¡ ¶m Zht Am¡a ¶h nw{ï> H$aZo Ho$ {bE {H$ ì¶mdgm{¶H$ n[apñW{V¶m± BVZr dJuH¥$V g§n{Îm Ho$ {bE A{Z{üV Cn¶moJr OrdZ ‘yë¶m§H$Z H$m g‘W©Z H$aZm Omar aIVr h¢& Bg Vah H$s g‘rjm Ho$ AmYma na, Cn¶moJr OrdZ ~Xb gH$Vm h¡ ¶m Cn¶moJr OrdZ ‘yë¶m§H$Z A{Z{üV H$mb go n[a{‘V ‘| ~Xb gH$Vm h¡& Eogo n[adV©Zm| Ho$ à^md H$mo boIm§H$Z AZw‘mZ ‘| n[adV©Z Ho$ ê$n ‘| XoIm OmVm h¡&

1.13 n[ag§n{Îm¶m| H$s j{V

Am§V[aH$/~mhar KQ>H$ na AmYm[aV H$moB© j{V Ho$ g§Ho$V

{ZYm©aU H$aZo Ho$ {bE àË¶oH$ VwbZ-nÌ H$s VmarI na

n[ag§n{Îm¶m| H$s dV©‘mZ am{e na g‘rjm H$s OmVr h¡&

Ohm± H$ht n[ag§n{Îm¶m| H$s dV©‘mZ am{e dgybr ¶mo½¶

am{e go A{YH$ h¡ Vmo ¶{X Eogo {ZYm©aU na hþB© j{V H$s

hm{Z H$mo ‘mÝ¶Vm Xr OmVr h¡ & n[ag§n{Îm¶m| H$s Cn¶moJ

‘| dgybr ¶mo½¶ am{e ewÕ {~H«$s ‘yë¶ ({ZnQ>mZ H$m C{MV

‘yë¶ H$‘ bmJV) AWdm d¡ë¶y h¡ Omo A{YH$ h¡ &

Cn¶moJ ‘| ‘yë¶ {ZYm©aU H$aVo g‘¶ ny±Or H$s doQ>oO Am¡gV bmJV Ho$ Cn¶moJ Ûmam AZw‘m{ZV ^mdr ZH$X àdmh H$mo dV©‘mZ ‘yë¶ VH$ Ny>Q> Xr OmVr h¡ & nhbo ‘mÝ¶Vm àmá j{V H$s hm{Z H$mo AmJo àmdYmZ {H$¶m Om¶o AWdm [adg© {H$¶m Om¶oJm ¶h n[apñW{V¶m| na AmYm[aV h¡ VWm n[ag§n{Îm¶m| H$s dV©‘mZ am{e Cg gr‘m VWm dV©‘mZ am{e Ho$ A{YH$ Z hmo Ho$ {ZYm©aU Ho$ {bE ¶{X {nN>br j{V ‘| hm{Z H$mo ‘mÝ¶Vm àmá Zht hþB© h¡ Vmo Bg na ‘mÝ¶Vm Xr Om¶oJr &

1.14 {~H«$s Ho$ {bE Am¶mo{OV g§n{Îm

J¡a dV©‘mZ n[ag§n{Îm¶m| H$mo {~H«$s Ho$ {bE Am¶mo{OV {H$¶m

OmVm h¡ & ¶{X Xÿgar {~H«$s AË¶m{YH$ g§^m{dV h¡ &

98


99


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

meet the criteria to be classified as held for sale are measured at the lower of carrying amount and fair value less costs to sell and depreciation on such assets to be ceased.

On the event of change in plan to sale of assets, the same is reclassified as non-current assets accordance to the class of asset that it belongs to. Financial statements for the periods since classification as held for sale shall be amended accordingly.

1.15 leases:

A lease is an agreement whereby the lessor

conveys to the lessee in return for a payment or

series of payments the right to use an asset for

an agreed period of time.

A finance lease is a lease that transfers substantially all the risks and rewards incidental to ownership of an asset. Title may or may not eventually be transferred. All other leases are classified as operating leases.

company as a lessee

finance lease

Assets used under finance leases are recognised as property, plant and equipment in the balance sheet for an amount that corresponds to the lower of fair value and the present value of minimum lease payments determined at the inception of the lease and a liability is recognised for an equivalent amount. The minimum lease payments are apportioned between finance charges and reduction of the lease liability so as to achieve a constant rate of interest on the remaining balance of the liability. Finance charges are recognized in the Statement of Profit and Loss. Rentals payable under operating leases are charged to the Statement of Profit and Loss on a straight-line basis over the term of the relevant lease unless the payments to the lessor are structured to increase in line with expected general inflation to compensate for the lessor’s expected inflationary cost increases.

{~H«$s Ho$ {bE aIo OmZodmbo ‘mZmX§S>m| H$mo nyam H$aZodmbr

n[ag§n{Îm¶m| H$mo dhZ H$aZo H$s ‘mÌm Ho$ AmYma na ‘mnm

OmVm h¡ Am¡a Eogr n[ag§n{Îm¶m| H$mo ~oMZo Am¡a ‘yë¶õmg

Ho$ {bE C{MV ‘yë¶ &

n[ag§n{Îm¶m| H$s {~H«$s H$s ¶moOZm ‘| ~Xbmd H$s pñW{V

‘|, ¶h Cgr g§n{Îm Ho$ dJ© Ho$ AZwgma J¡a-dV©‘mZ g§n{Îm

Ho$ ê$n ‘| nwZd©JuH¥$V h¡& {~H«$s Ho$ {bE dJuH$aU Ho$ ~mX

go Ad{Y Ho$ {bE {dÎmr¶ {ddaU VXZwgma g§emo{YV {H$E

OmE§Jo &

1.15 nÅ>m (brO) :

¶h nÅ>m dh g‘Pm¡Vm H$aVm h¡ {OgHo$ VhV nÅ>oXma ^wJVmZ Ho$ ~Xbo ‘| nÅ>o na XoZo ¶m ^wJVmZ H$aZo H$s l¥§Ibm Ho$ {bE g§ào{fV H$aVm h¡ {H$gr gh‘V g‘¶ Ho$ {bE {H$gr g§n{Îm H$m Cn¶moJ H$aZo H$m Cgo A{YH$ma hmoVm h¡ &

{dÎm nÅ>m EH$ Eogm nÅ>m h¡ Omo {H$gr ^r n[ag§n{Îm Ho$ ñdm{‘Ëd Ho$ {bE g^r OmopI‘m| Am¡a nwañH$mam| H$mo n¶m©á ê$n go ñWmZm§V[aV H$aVm h¡& erf©H$ A§VV: hñVm§V[aV hmo ^r gH$Vm h¡ Am¡a Zht ^r& AÝ¶ g^r nÅ>| g§MmbZerb nÅ>m| Ho$ ê$n ‘| dJuH¥$V h¢&

H§$nZr nÅ>mXmVm Ho$ ê$n ‘|

{dÎmr¶ brO

{dÎm nÅ>m| Ho$ VhV Cn¶moJ H$s OmZo dmbr g§n{Îm¶m| H$mo ~¡b|g erQ>

‘| g§n{Îm, g§¶§Ì Am¡a CnH$aU Ho$ ê$n ‘| ‘mÝ¶Vm Xr OmVr h¡,

Omo C{MV ‘yë¶ Ho$ {ZMbo ñVa go ‘ob ImVr h¡ Am¡a nÅ>o Ho$ A§V

‘| {ZYm©[aV Ý¶yZV‘ nÅ>m ^wJVmZ Ho$ dV©‘mZ ‘yë¶ Am¡a Xo¶Vm

Ho$ {bE ‘mÝ¶Vm àmá ~am~a am{e h¡& & Ý¶yZV‘ brO ^wJVmZ

{dÎm à^ma Am¡a brO Xo¶Vm ‘| H$‘r Ho$ ~rM {H$¶m OmVm h¡ Vm{H$

Xo¶Vm Ho$ eof am{e na ã¶mO H$s {Za§Va Xa àmá hmo gHo$& {dÎm

à^ma bm^ Am¡a hm{Z Ho$ {ddaU ‘| ‘mÝ¶Vm àmá h¢& n[aMmbZ

nÅ>m| Ho$ A§VJ©V Xo¶ {H$am¶m, àmg§{JH$ nÅ>o H$s Ad{Y Ho$ AmYma

na EH$ grYr aoIm Ho$ AmYma na bm^ Am¡a hm{Z Ho$ ñQ>oQ>‘|Q>

Ho$ {bE MmO© {H$E OmVo h¢, O~ VH$ {H$ nÅ>oXma H$mo ^wJVmZ H$mo

H$‘ gm‘mÝ¶ ‘wÐmñ’$s{V H$s j{Vny{V© Ho$ {bE Ano{jV gm‘mÝ¶

‘wÐmñ’$s{V Ho$ AZwê$n ~‹T>mZo Ho$ {bE g§a{MV Zht {H$¶m OmVm h¡

bmJV ~‹T> OmVr h¡ &

100


101


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

operating lease

Leases in which a substantial portion of the risks and rewards of ownership are retained by the lessor are classified as operating leases.

Payments under such lease are recognized to the Statement of Profit and Loss on a straight-line basis over the term of the lease unless the lease payments to the lessor are structured to increase in line with expected general inflation to compensate for the lessor’s expected inflationary cost increases, in which case the same are recognized as an expense in line with the contractual term.

company as a lessor

operating lease

Lease income from operating leases where the company is a lessor is recognized as income on a straight-line basis over the lease term unless the receipts are structured to increase in line with expected general inflation to compensate for the expected inflationary cost increases. The respective leased assets are included in the Balance Sheet based on their nature.

1.16 Employee Benefits:

Short term employee benefits

All employee benefits payable within 12 months of service such as salaries, wages, bonus, ex-gratia, medical benefits etc. are recognized in the year in which the employees render the related service and are presented as current employee benefit obligations within the Balance Sheet. Termination benefits are recognized as an expense as and when incurred. Short-term leave encashment is provided at undiscounted amount during the accounting period based on service rendered by employees.

Other Long term employee benefits

The liabilities for earned leave and sick leave are not expected to be settled wholly within 12 months after the end of the period in which the employees render the related service. They

Am°naoqQ>J brO

nÅ>m| {OZ‘| ñdm{‘Ëd Ho$ OmopI‘m| Am¡a nwañH$mam| H$m EH$ ~‹S>m {hñgm H$‘ aIm OmVm h¡, n[aMmbZ nÅ>m| Ho$ ê$n ‘| dJuH¥$V {H$¶m OmVm h¡&

Eogo nÅ>o Ho$ VhV ^wJVmZ H$mo nÅ>o H$s Ad{Y Ho$ AmYma na EH$ grYr aoIm Ho$ AmYma na bm^ Am¡a hm{Z Ho$ dº$ì¶ Ho$ {bE ‘mÝ¶Vm Xr OmVr h¡ O~ VH$ {H$ nÅ>oXma H$mo nÅ>o na ^wJVmZ H$mo Ano{jV gm‘mÝ¶ ‘wÐmñ’$s{V Ho$ AZwê$n ~‹T>mZo Ho$ {bE g§a{MV Zht {H$¶m OmVm h¡, Vm{H$ nÅ>oXma H$s Ano{jV ‘wÐmñ’$s{V bmJV H$s ^anmB© hmo gHo$ ~‹T> OmVr h¡, {Og pñW{V ‘| Cgr H$mo AZw~§Y

Ad{Y Ho$ AZwê$n ì¶¶ Ho$ ê$n ‘| ‘mÝ¶Vm Xr OmVr h¡&

H§$nZr nÅ>mXmVm Ho$ ê$n ‘|

Am°naoqQ>J brO

Am°naoqQ>J nÅ>o go brO Am¶ Ohm± H§$nZr nÅ>mXmVm Ho$ ê$n

‘| h¡ brO Ad{Y Ho$ Xm¡amZ grYr aoIm nÕ{V H|$ AmYma na

Am¶ Ho$ ê$n ‘| nhMmZm OmVm h¡ O~ VH$ {H$ Ano{jV gm‘mÝ¶

‘wÐmñ’$s{V H$s VwbZm ‘| agrXm| H$mo V¡¶ma Zht {H$¶m OmVm Vm{H$

g§^m{dV ‘wÐmñ’$s{V bmJV ‘| d¥{Õ H$s Om gH|$ & g§~§{YV brÁS>

n[ag§n{Îm¶m| H$mo CZH$s àH¥${V na AmYm[aV VwbZ nÌ ‘| em{‘b

{H$¶m J¶m h¡ &

1.16 H$‘©Mmar bm^

AënH$m{bH$ H$‘©Mmar bm^

doVZ, nm[al{‘H$, ~moZg, EŠgJ«o{e¶m, {M{H$Ëgm bm^ BË¶m{X O¡gr godm Ho$ 12 ‘hrZm| Ho$ rVa g^r H$‘©Mm[a¶m| Ho$ ^wJVmZ ¶mo½¶ bm^ H$mo {Og‘| H$‘©Mmar g§~§{YV godm XoVo h¢ CZH$mo Cg df© ‘| ‘mÝ¶Vm Xr OmVr h¡ VWm VwbZ nÌ ‘| dV©‘mZ H$‘©Mmar bm^ Xm{¶Ëd Ho$ ê$n ‘| àñVwV {H$¶m OmVm h¡ & g‘m{á bm^ O~ IM© {H$¶m J¶m hmo ì¶¶ Ho$ ê$n ‘| ‘mÝ¶Vm Xr OmVr h¡ & AënH$m{bH$ Nw>Å>r ZH$XrH$aU H$‘©Mm[a¶m| Ûmam Xr JB© g§~Õ godmAm| na boIm Ad{Y Ho$ Xm¡amZ Ny>Q> am{e Ho$ AmYma na àmdYmZ {H$¶m J¶m h¡ &

AÝ¶ XrKm©d{Y H$‘©Mmar bm^

A{O©V Nw>Å>r d {gH$ brd hoVw XoZXm[a¶m| H$mo {Z¶V

godmE°§ àñVwV H$aZo Ho$ Xm¡amZ df© H$s g‘m{á na {Og‘|

H$‘©Mm[a¶m| Ho$ g~§Õ godmE°§ Xr h¡ 12 ‘hrZm| Ho$ ^rVa nyU©

100


101


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

are therefore measured as the present value of expected future payments to be made in respect of services provided by employees up to the end of the reporting period using the projected unit credit method. The benefits are discounted using the market yields at the end of the reporting period that have terms approximating to the terms of the related obligation. Re-measurements as a result of experience adjustments and changes in actuarial assumptions are recognized in profit or loss.

Defined Contribution Plan

Contributions to defined contribution schemes such as contribution to Provident Fund and Superannuation Fund are charged as an expense to the Statement of Profit and Loss based on the amount of contribution required to be made as and when services are rendered by the employees. The above benefits are classified as Defined Contribution Schemes as the Cotton Corporation of India Limited has no further defined obligations beyond the monthly contributions.

Defined Benefit Plan

Gratuity:

The company makes annual contributions under the Employees Gratuity scheme to a fund administered by trustees covering all eligible employees. The plan provides for lumpsum payments to employees whose right to receive gratuity has vested at the time of resignation, retirement, death while in employment or on termination of employment of an amount equivalent to 15 days salary for each completed year of service or part thereof in excess of six months. Vesting occurs upon completion of five years of service except in case of death.

Gratuity liability is a defined benefit obligation and is computed on the basis of an actuarial valuation by an actuary appointed for the purpose as per projected unit credit method at the end of each financial year. The liability or asset recognized in

ê$n go {ZnQ>mZo H$s Anojm Zht h¡ Bgr{bE BZH$mo àmoOoŠQ>oS> ¶y{ZQ> H«o${S>Q> ‘oWS> H$m Cn¶moJ H$aVo hþE [anmo{Qª>J Ad{Y H$s g‘m{á na H$‘©Mm[a¶m| Ûmam Xr JB© godmAm| Ho$ ~mao ‘| {H$E OmZo dmbo Ano{jV ^mdr ^wJVmZ Ho$ dV©‘mZ ‘yë¶ go AmH$bZ {H$¶m OmVm h¡ & CZ bm^m| H$mo [anmo{Qª>J Ad{Y H$s g‘m{á na ‘mH}$Q> CnO H$m Cn¶moJ H$aVo hþE bm^m| H$mo Ny>Q> Xr OmVr h¡ {Og‘| g§~§{YV Xm{¶Ëd Ho$ ‘m‘bo AZw‘m{ZV hmoVo h¢ & AZw^d g‘m¶moOZ VWm ~r‘m§{H$H$ AZw‘mZm| ‘| n[adV©Z Ho$ n[aUm‘ ñdê$n nwZ: AmH$bZ H$mo

bm^ Am¡a hm{Z ‘| ‘mÝ¶Vm Xr JB© h¢ &

n[a^m{fV A§eXmZ `moOZm

n[a^m{fV A§eXmZ `moOZm, `moOZm Ho$ A§eXmZ O¡go

^{dî` {Z{Y d A{Yd{f©Vm {Z{Y ‘| A§eXmZ H$‘©Mm[a`m|

Ûmam Xr JB© godmAm| ‘| Amdí`H$ A§eXmZ H$s am{e Ho$

AmYma na bm^ d hm{Z {ddaUr ‘| ì`` Ho$ ê$n ‘| MmO©

{H$`m J`m h¡ & Cn w©ŠV bm^m| H$mo n[a^m{fV A§eXmZ

`moOZm Ho$ ê$n ‘| dJuH¥$V {H$`m J`m h¡ & Š`m|{H$ ^maVr`

H$nmg {ZJ‘ {b{‘Q>oS> ‘| ‘m{gH$ A§eXmZ Ho$ Abmdm AmJo

n[a^m{fV Xm{`Ëd Ho$ ê$n ‘| Hw$N> Zht h¡

n[a^m{fV bm^ ¶moOZm

CnXmZ {Z{Y

g^r nmÌ H$‘©Mm[a¶m| H$mo em{‘b H$aVo hþE Ý¶mg Ûmam

àem{gV {Z{Y ‘| H$‘©Mmar CnXmZ {Z{Y ¶moOZm Ho$

A§VJ©V H§$nZr Ûmam dm{f©H$ A§eXmZ {H$¶m OmVm h¡ & Bg

¶moOZm ‘| H$‘©Mm[a¶m| H$mo EH$ ‘wíV am{e Ho$ ^wJVmZ H$m

àmdYmZ h¡ & Bg ¶moOZm ‘| {Z¶moº$m H$mo Ë¶mJ nÌ XoZo,

godm{Zd¥{Îm na, ‘¥Ë¶w Ho$ g‘¶ CnXmZ {Z{Y àmá H$aZo

H$m hH$ {Z{hV h¡ {Og‘| H$‘©Mm[a¶m| H$mo EH$‘wíV am{e Ho$

^wJVmZ H$m Omo N>: ‘hrZm| go A{YH$ àË¶oH$ nyU© df© d

{H$gr godm Ho$ ^mJ Ho$ {bE 15 {XZm| Ho$ g‘Vwë¶ doVZ

H$s am{e H$m àmdYmZ h¡ & ‘¥Ë¶w H$mo N>mo‹S>H$a nm±M dfm] H$s

godm nyU© hmoZo na CnXmZ {Z{Y Xmdo H$m hH$ {Z{hV h¡ &

CnXmZ {Z{Y Xm{¶Ëd n[a^m{fV bm^ ~mÜ¶Vm h¡ VWm àË¶oH$ {dÎmr¶ df© H$s g‘m{á na àmoOoŠQ>oS> BH$mB© H«o${S>Q> nÕ{V Ho$ AZwgma Bg CÔoí¶ Ho$ {bE {Z¶wº$ EŠMwAar Ûmam ~r‘m§H$H$ ‘yë¶m§H$Z Ho$ AmYma na BgH$s JUZm H$s OmVr h¡ & n[a^m{fV bm^ CnXmZ {Z{Y ¶moOZm Ho$ ~mao ‘|

102


103


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

the Balance Sheet in respect of defined benefit Gratuity plan is the present value of the defined benefit obligation at the end of the reporting period less the fair value of plan assets.

The present value of the defined benefit obligation is determined by discounting the estimated future cash outflows by reference to market yields at the end of the reporting period on Government bonds that have terms approximating to the terms of the related obligation.

The net interest cost is calculated by applying the discount rate to the net balance of the defined benefit obligation and the fair value of plan assets. This cost is included in employee benefit expense in the Statement of Profit and Loss.

Re-measurement gains and losses arising from experience adjustments and changes in actuarial assumptions are recognized in the period in which they occur directly in Other Comprehensive Income. They are included in retained earnings in the Statement of changes in equity and in the Balance Sheet.

Post Retirement Medical Benefit Scheme

Post-retirement medical benefits are recognized based on the present value of defined benefit obligation which is computed using the projected unit credit method as per IND AS 19, with actuarial valuations being carried out at the end of each annual reporting period. Any actuarial losses/gains are recognized immediately in the statement of profit and loss account as an income or expense.

others

(i) Productivity Linked Incentive:

The productivity linked incentive scheme is based on overall performance i.e. Financial Performance for the Financial Year and Physical Performance for the Cotton Year. The Financial performance is based on the Financial Results for the Financial Year and the Physical performance is based on the performance during the Cotton Year. The

VwbZ nÌ ‘| n[ag§n{Îm AWdm Xo¶Vm H$mo ‘mÝ¶Vm Xr JB© h¡ Omo [anmo{Qª>J Ad{Y H$s g‘m{á na ßbmZ n[ag§n{Îm Ho$ C{MV ‘yë¶ go H$‘ dV©‘mZ ‘yë¶ h¡ &

nm[a^m{fV bm^ ~mÜ¶Vm H$m dV©‘mZ ‘yë¶ gaH$mar ~m°ÝS>g

na [anmo{Qª>J Ad{Y H$s g‘m{á na ‘mH}$Q> CËnmXH$Vm Ho$

g§X^© ‘| AZw‘m{ZV ^mdr ZH$X ~{hdm©h ‘| Ny>Q> XoH$a

{ZYm©aU {H$¶m OmVm h¡ & {Og‘| g§~§{YV ~mÜ¶Vm Ho$ Q>‘©g

H$s eV} h¢ &

nm[a^m{fV bm^ Xm{¶Ëd Ho$ {Zdb eof VWm C{MV ‘yë¶

H$s ¶moOZm n[ag§n{Îm na {S>ñH$mD$§Q> aoQ> Ûmam ewÕ ã¶mO

bmJV H$s JUZm H$s OmVr h¡ & bm^ d hm{Z {ddaUr ‘|

H$‘©Mmar bm^ ì¶¶ ‘| Bg bmJV H$mo em{‘b {H$¶m J¶m

h¡&

AZw^d g‘m¶moOZ VWm ~r‘m§H$H$ YmaUmAm| go CËnÞ

bm^ d hm{Z¶m| H$m nwZ©‘yë¶m§H$Z Cg Ad{Y ‘| {Og‘|

K{Q>V hþB© h¢ CÝh| AÝ¶ ì¶mnH$ Am¶ ‘| ‘mÝ¶Vm Xr JB©

h¡& BÝh| B{¹$Q>r ‘| n[adV©Z H$s {ddaUr VWm VwbZ nÌ ‘|

[aQ>|S> AO©Z ‘| em{‘b {H$¶m J¶m h¡ &

godm{Zd¥{Îm nümV {M{H$Ëgm bm^ ¶moOZm

godm {Zd¥{Îm nümV {M{H$Ëgm bm^ H$mo n[a^m{fV bm^

~mÜ¶Vm Ho$ dV©‘mZ ‘yë¶ Ho$ AmYma na ‘mÝ¶Vm Xr JB©

h¡& {OgH$s àË¶oH$ dm{f©H$ [anmo{Qª>J Ad{Y H$s g‘m{á na

br OmZodmbr ~r‘m§{H$H$ ‘yë¶m§H$Z go B§S> E Eg 19 Ho$

AZwgma àmoOoŠQ>oS> ¶y{ZQ> H«o${S>Q> nÕ{V H$m Cn¶moJ H$aVo

hþE JUZm H$s JB© h¡ & {H$gr ^r ~r‘m§{H$H$ hm{Z/bm^ H$mo

bm^ d hm{Z {ddaUr ImVo ‘| Am¶ AWdm ì¶¶ Ho$ ê$n ‘|

Vwa§V ‘mÝ¶Vm Xr OmVr h¡ &

AÝ¶

(i) CËnmXH$Vm gh~Õ àmoËgmhZ:

CËnmXH$Vm gh~Õ àmoËgmhZ ¶moOZm g§nyU©

H$m¶©{ZînmXZ na AmYm[aV h¡ ¶m{Z {dÎmr¶ df©

Ho$ {bE {dÎmr¶ {ZînmXZ Am¡a H$nmg df© Ho$ {bE

dmñV{dH$ {ZînmXZ & {dÎmr¶ {ZînmXZ {dÎmr¶ df©

Ho$ n[aUm‘ na AmYm[aV h¡ Am¡a dmñV{dH$ {ZînmXZ

102


103


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

Financial Year ends on 31st March and the Cotton Year ends on 30th September i.e. after 6 months of close of the Financial Year. Since it involves two financial years, hence the Optimum Productivity Index under the Productivity Linked Incentive Scheme, can be worked out only at the end of the Cotton Year i.e. after 30th September each year. Therefore, the Company follows the practice consistently of working out the eligibility and quantum of PLI at the end of the Cotton Year and debiting the expenditure in the ensuing Financial Year in which the same is approved by the Board.

(ii) Payment of Ex-Gratia and notice pay on voluntary retirement are recognized in the Statement of Profit and Loss in the year in which payment is made.

(iii) Employees cost that would arise on discounting of future cash flows of loans given to employees are recognized in the accounts if the net impact in the reporting financial year exceeds 0.25% of total revenue of the financial year and loans given to employees are measured at fair value.

1.17 Government Grants

Government grants are assistance by government in the form of transfers of resources to an entity in return for past or future compliance with certain conditions relating to the operating activities of the entity.

Government grants are recognized at their fair value where there is a reasonable assurance that the grant will be received and the company will comply with all attached conditions.

Government grants relating to purchase of property, plant and equipment are included in non-current liabilities as deferred income and are credited to profit or loss in proportion to depreciation over the expected lives of the related assets and presented within other income.

H$nmg df© Ho$ Xm¡amZ {ZînmXZ na AmYm[aV h¡ &

{dÎmr¶ df© 31 ‘mM© H$mo g‘má hmoVm h¡ Am¡a H$nmg

df© 30 {gV§~a H$mo g‘má hmoVm h¡ ¶m{Z {dÎmr¶

df© g‘m{á Ho$ N>: ‘mh Ho$ ~mX nrEbAmB© ¶moOZm

Ho$ A§VJ©V gdm}Îm‘ CËnmXH$Vm gyMH$m§H$ H$s JUZm

Ho$db H$nmg df© ¶m{Z àË¶oH$ df© 30 {gV§~a Ho$

~mX H$s Om gH$Vr h¡ & AV: nrEbAmB© Ho$ {bE

Cgr {dÎmr¶ df© ‘| BgH$m àmdYmZ H$aZm g§^d Zht

h¡ & AV: H§$nZr H$nmg df© Ho$ A§V ‘o nrEbAmB©

H$s J«møVm VWm ‘mÌm H$s JUZm H$aZo H$s àWm H$m

AZwnmbZ H$aVr h¡ Am¡a AJbo {dÎmr¶ df© ‘| ì¶¶

H$mo Zm‘o H$aVr h¡ &

(ii) EŠgJ«o{e¶m H$m ^wJVmZ VWm E¡pÀN>H$ godm{Zd¥{Îm na Zmo{Q>g no H$mo {Og df© ‘| ^wJVmZ {H$¶m J¶m h¡ Cg df© Ho$ bm^ d hm{Z H$s {ddaUr ‘| ‘mÝ¶Vm Xr OmVr h¡ &

(iii) H$‘©Mm[a¶m| H$mo {XE JE F$U Ho$ ^mdr àdmh ‘| ¶{X

[anmo{Qª>J {dÎmr¶ df© ‘| ewÕ àdmh {dÎmr¶ df© Ho$

Hw$b amOñd H$m 0.25% VWm H$‘©Mm[a¶m| H$mo {XE

JE F$U H$m ‘yë¶m§H$Z C{MV ‘yë¶ na bJm¶m OmVm

h¡ Vmo Ny>Q> go CËnÞ H$‘©Mmar bmJV H$mo boIm ‘|

‘mÝ¶Vm Xr OmVr h¡ &

1.17 gaH$mar AZwXmZ

gaH$mar AZwXmZ, gaH$ma Ûmam BH$mB© Ho$ g§MmbZ

J{V{d{Y¶m| go g§~§{YV Hw$N> eVm] Ho$ gmW AVrV ¶m

^{dî¶ Ho$ AZwnmbZ Ho$ ~Xbo ‘| {H$gr g§ñWm H$mo g§gmYZm|

Ho$ hñVm§VaU Ho$ ê$n ‘| ghm¶Vm H$aVo h¢ &

gaH$mar AZwXmZ H$mo CZHo$ C{MV ‘yë¶ na ‘mÝ¶Vm Xr OmVr h¡ Ohm± C{MV AmœmgZ {X¶m OmVm h¡ {H$ AZwXmZ àmá hmoJm Am¡a H§$nZr g^r g§b¾ eVm] H$m AZwnmbZ

H$aoJr &

g§n{Îm, ßbm§Q> d CnH$aU H$s IarXr go g§~§{YV gaH$mar AZwXmZ AmñW{JV Am¶ Ho$ ê$n ‘| J¡a-Mmby Xo¶VmAm| ‘| em{‘b {H$¶m J¶m h¡ VWm n[ag§n{Îm¶m| H$s Ano{jV Am¶ na ‘yë¶õmg Ho$ AZwnmV ‘| bm^ AWdm hm{Z ‘| O‘m {H$¶m J¶m h¡ VWm AÝ¶ Am¶ Ho$ ^rVa àñVwV {H$¶m J¶m h¡ &

104


105


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

Government grants relating to income are deferred and recognized in the Statement of Profit and Loss over the period necessary to match them with the costs that they are intended to compensate and presented within other income.

1.18 foreign currency translation

Foreign currency transactions are translated into the functional currency using the exchange rates at the dates of the transactions. Foreign exchange gains and losses resulting from the settlement of such transactions and from the translation of monetary assets and liabilities denominated in foreign currencies at year end exchange rates are generally recognized in profit or loss.

1.19 Borrowing costs

Borrowings are initially recognized at fair value, net of transaction costs incurred. Borrowings are subsequently measured at amortized cost. Any difference between the proceeds (net of transaction costs) and the redemption amount is recognized in profit or loss over the period of the borrowings using the effective interest method.

Borrowings are classified as current liabilities unless the Company has an unconditional right to defer settlement of the liability for at least 12 months after the reporting period.

1.20 earnings per Share

Basic Earnings Per Share (EPS) are calculated by dividing the net profit or loss for the period attributable to Equity Shareholders by the weighted average number of Equity shares outstanding during the period. Earnings considered in ascertaining the EPS is the net profit for the period after deducting attributable tax thereto for the period.

Am¶ go g§~§{YV gaH$mar AZwXmZ H$s j{Vny{V© Ho$ CÔoí¶

go bmJV go Amdí¶H$ ‘¡M H$aZo H$s Ad{Y na bm^ d

hm{Z {ddaUr ‘| AmñW{JV ‘mÝ¶Vm Xr OmVr h¡ VWm AÝ¶

Am¶ Ho$ ^rVa àñVwV {H$¶m OmVm h¡ &

1.18 {dXoer ‘wÐm A§VaU

{dXoer ‘wÐm ‘| boZ XoZ H$m {H«$¶mË‘H$ ‘wÐm ‘| A§VaU

boZ XoZ H$s VmarIm| na {d{Z‘¶ Xa go {H$¶m OmVm h¡

& Eogo boZ XoZ Ho$ {ZnQ>mZ Ho$ n[aUm‘ñdê$n {dXoer

{d{Z‘¶ Ho$ bm^ d hm{Z¶m| VWm {dXoer ‘wÐm ‘| A§{H$V

‘yë¶ na ‘m¡{ÐH$ n[ag§n{Îm¶m| d Xo¶VmAm| Ho$ A§VaU go

df© H$s g‘m{á na {d{Z‘¶ Xa H$mo gm‘mÝ¶V: bm^ VWm

hm{Z ‘| ‘mÝ¶Vm Xr OmVr h¡ &

1.19 CYma bmJV

CYma bmJV H$mo àma§^ ‘| boZ XoZ H$s ewÕ bmJV IM© na C{MV ‘yë¶ ‘| ‘mÝ¶Vm Xr JB© h¡ & BgHo$ nümV CYma H$mo n[aemoYZ bmJV na AmH$bZ {H$¶m J¶m h¡ & Bg à{H«$¶m VWm (boZ XoZ H$s ewÕ bmJV) am{e ‘| Ny>Q> Ho$ ~rM A§Va H$mo à^mdembr ã¶mO nÕ{V H$m Cn¶moJ H$aVo hþE CYma H$s Ad{Y na bm^ AWdm hm{Z ‘| ‘mÝ¶Vm Xr JB© h¡ & CYmar H$mo [anmo{Qª>J Ad{Y Ho$ nümV Ý¶yZV‘ 12 ‘hrZm| Ho$ {bE Xo¶VmAm| Ho$ AmpñWJV {ZnQ>mZ Ho$ AZH§$S>reZb hH$ &

O~ VH$ H§$nZr Ho$ nmg [anmo{Qª>J Ad{Y Ho$ nümV Ý¶yZV‘ 12 ‘hrZm| Ho$ {bE XoZXm[a¶m| Ho$ {ZnQ>mZ H$mo AñW{JV aIZo H$m AeV© A{YH$ma Z hmo, CYma H$mo Mmby Xo¶VmAm| Ho$ ê$n ‘| dJuH¥$V {H$¶m OmVm h¡ &

1.20 à{V eo¶a AO©Z

~o{gH$ B{¹$Q>r à{V eo¶a (B©nrEg) H$mo gH$b bm^

AWdm hm{Z H$mo Ad{Y Ho$ Xm¡amZ ~H$m¶m B{¹$Q>r eo¶a

H$s ^m[aV Am¡gV g§»¶m go ^mJ XoH$a ~o{gH$ à{V eo¶a

Ho$ AO©Z H$s JUZm H$s OmVr h¡& B© nrEg Ho$ {ZYm©aU ‘|

AO©Z VWm Cg Ad{Y Ho$ {bE {XE JE {H$gr H$a H$m

ewÕ bm^ h¢ &

104


105


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

1.21 provisions, contingent liabilities & Assets

a) Provisions are recognized when the Company has a present legal or constructive obligation as a result of past events, it is probable that an outflow of resources will be required to settle the obligation and the amount can be reliably estimated. These are reviewed at each year end and reflect the best current estimate.

b) Provisions are measured at the present value of best estimate of the Management of the expenditure required to settle the present obligation at the end of the reporting period. The discount rate used to determine the present value is a pre-tax rate that reflects current market assessments of the time value of money and the risks specific to the liability. The increase in the provision due to the passage of time is recognized as interest expense.

c) Contingent liabilities are disclosed when there is a possible obligation arising from past events, the existence of which will be confirmed only by the occurrence or non-occurrence of one or more uncertain future events not wholly within the control of the Company or a present obligation that arises from past events where it is either not probable that an outflow of resources will be required to settle the obligation or a reliable estimate of the amount cannot be made.

d) Contingent Assets are not recognized in the financial statements. Such contingent assets are assessed continuously and are disclosed in notes when the inflow of economic benefits becomes probable. If it is virtually certain that inflow of economic benefits will arise then such assets and the relative income will be recognized in the financial statements.

1.22 financial instruments

A financial instrument is a contract that gives rise to a financial asset of one entity and a financial liability or equity instrument of another entity. Financial instruments also include derivative contracts such as foreign currency forward

1.21 àmdYmZm|, g‘m{lV Xo¶VmE°§ Ed§ n[ag§n{Îm¶m±

H$) {nN>br KQ>Zm Ho$ ’$bñdê$n H§$nZr Ho$ dV©‘mZ Xm{¶Ëd ({d{YH$ Am¡a aMZmË‘H$) hmoZo na àmdYmZm| H$s nhMmZ H$s OmVr h¡, ¶h g§^d h¡ {H$ Xm{¶Ëdm| Ho$ g‘m¶moOZ Ho$ {bE Am{W©H$ bm^m| Ho$ ~{h©^md H$s Amdí¶H$Vm hmo Am¡a Xm{¶Ëdm| H$s am{e go {dœgZr¶ AmH$bZ V¡¶ma {H$¶m Om gHo$ &

I) àmdYmZm| H$m AmH$bZ ì¶¶ Ho$ à~§Y Ho$ loð> AmH$bZ dV©‘mZ ‘yë¶ Ûmam hr {H$¶m OmVm h¡ Omo [anmo{Qª>J Ad{Y H$s g‘m{á na dV©‘mZ Xm{¶Ëd Ho$ {ZnQ>mZ Ho$ {bE Amdí¶H$ hmo & dV©‘mZ ‘yë¶ {ZYm©aU H$aZo Ho$ {bE Cn¶moJ H$s OmZodmbr Ny>Q> Xa EH$ nyd© H$aXmVm h¡ Omo ‘wÐm Ho$ g‘¶ ‘yë¶ Am¡a Xo¶Vm Ho$ {bE {Z{X©ï> OmopI‘m| Ho$ dV©‘mZ ~mOma {ZYm©aU H$mo Xem©Vm h¡ & g‘¶ ~rVZo Ho$ H$maU àmdYmZ ‘| d¥{Õ H$mo ã¶mO ì¶¶ Ho$ ê$n ‘| ‘mÝ¶Vm Xr OmVr h¡ &

J) O~ H§$nZr H$m {nN>br KQ>ZmAm| go g§^m{dV Xm{¶Ëd

H$s {dÚ‘mZVm Omo ^{dî¶ H$s KQ>ZmAm| H$s nwZamd¥{Îm

Am¡a J¡a nwZamd¥{Îm H$s nw{ï> H$aVm h¡, Omo H§$nZr Ho$ nyU©

{Z¶§ÌU ‘| Zht hmoVo, Omo {nN>br KQ>ZmAm| go CËnÞ hmoVo

h¢ Ohm± ¶m Vmo ¶h g§^d Zht h¡ {H$ ómoVmo Ho$ ~{hdm©h

na Xm{¶Ëd Ho$ {ZnQ>mZ H$s Amdí¶H$Vm hmo AWdm am{e

H$m {dœgZr¶ AmH$bZ Zht {H$¶m Om gH$Vm &

K) AmH$pñ‘H$ n[ag§n{Îm¶m| H$s nhMmZ {dÎmr¶ {ddaUm| ‘| Zht H$s OmVr h¡ Bg Vah H$s AmH$pñ‘H$ g§n{Îm H$m ‘yë¶m§H$Z {H$¶m OmVm h¡ Am¡a Am{W©H$ bm^m| H$m àdmh g§^d hmoZo na ZmoQ²g ‘| {Q>ßn{U¶m| ‘| {XIm¶m OmVm h¡& AJa ¶h dmñVd ‘| {Z{üV h¡ {H$ Am{W©H$ bm^m| H$m àdmh CËnÞ hmoJm Vmo Eogr g§n{Îm¶m§ Am¡a g§~§{YV Am¶ H$s nhMmZ {dÎmr¶ {ddaUm| ‘| H$s OmVr h¡ &

1.22 {dÎmr¶ XñVmdoO

{dÎmr¶ XñVmdoO H$moB© Eogr g§{dXm h¡ Omo EH$ BH$mB© H$s

{dÎmr¶ n[ag§n{Îm H$mo Xÿgar BH$mB© H$s {dÎmr¶ Xo¶VmE°§

AWdm B{¹$Q>r XñVmdoO ‘| d¥{Õ XoVm h¡ & {dÎmr¶ XñVmdoO

A‘m¡{bH$ (S>oardo{Q>d) g§{dXmE°§ O¡go {dXoer ‘wÐm ’$m°adS>©

106


107


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

contracts, cross currency interest rate swaps, interest rate swaps and currency options; and embedded derivatives in the host contract.

financial Assets

initial recognition and measurement

All financial assets are recognized initially at fair value plus, in the case of financial assets not recorded at fair value through profit and loss, transaction cost that are attributable to the acquisition of the financial asset.

Classification and subsequent measurement

Classifications

The Company classify financial asset as subsequently measured at either amortized cost or fair value depending on the Company’s business model for managing the financial assets and the contractual cash flow characteristics of the financial assets.

Business model Assessment

The company makes an assessment of the objective of a business model in which an asset is held at a portfolio level because this best reflects the way business is managed and information is provided to us.

financial Assets at amortized cost

A financial asset is measured at amortized cost only if both the following conditions are met:

It is held within a business model whose objective is to hold assets in order to collect contractual cash flows

The contractual terms of the financial asset give rise on specified dates to cash flows that are solely payments of principal and interest on the principal amount outstanding.

After initial measurement, such financial assets are subsequently measured at amortized cost using the effective interest rate method. Amortized cost is calculated by taking into account any discount or premium on acquisition and fees or cost that are an integral part of the effective interest rate. The effective

H$m§Q´>¡ŠQ>g, H«$mg H$a§gr ã¶mO Xa ñd¡n, ã¶mO Xa ñd¡n

VWm ‘wÐm {dH$ën VWm hmoñQ> H$m§Q´>¡ŠQ> ‘| Eå~oS>oS> S>oardo{Q>d

^r em{‘b h¡ &

{dÎmr¶ n[ag§n{Îm¶m±

àma§{^H$ ‘mÝ¶Vm d AmH$bZ

g^r {dÎmr¶ n[ag§n{Îm¶m| H$mo àma§^ ‘| C{MV ‘yë¶ na ‘mÝ¶Vm Xr

OmVr h¡ VWm CZ {dÎmr¶ n[ag§n{Îm¶m| Ho$ ‘m‘bo ‘| Omo bm^ d

hm{Z boZXoZ bmJV go C{MV ‘yë¶ na [aH$m°S>© Zht H$s JB© h¡, do

{dÎmr¶ n[ag§n{Îm¶m| Ho$ A{YJ«hU Ho$ {bE AmamonZr¶ h¡ &

dJuH¥$V Ed§ AZwdVu AmH$bZ

dJuH¥$V

H§$nZr {dÎmr¶ n[ag§n{Îm¶m| H$m dJuH$aU n[aemoYZ bmJV AWdm

{dÎmr¶ n[ag§n{Îm¶m| Ho$ à~§YZ Ho$ {bE H§$nZr Ho$ {~OZog ‘m°S>b

na Am{lV C{MV ‘yë¶ VWm {dÎmr¶ n[ag§n{Îm¶m| Ho$ g§{dXmJV

ZH$X àdmh {deofVmAm| na AmH$bZ {H$¶m OmVm h¡ &

{~OZog ‘m°S>b {ZYm©aU

H§$nZr {~OZog ‘m°S>b {Og‘| n[ag§n{Îm¶m| H$mo nmoQ>©’$mo{b¶m| ñVa

H$mo {Z‘§{ÌV {H$¶m OmVm h¡ CgHo$ ‘yb CÔoí¶ H$mo {ZYm©aU H$aVr

h¡ Š¶m|{H$ ¶o loð> {~OZog H$m à{Vq~~ h¡ d h‘| CgH$s OmZH$mar

àmá hmoVr h¡ &

A‘yV© bmJV na {dÎmr¶ n[ag§n{Îm¶m±

¶{X {ZåZ{bpIV XmoZm| eV} ‘ob ImVr h¡ Vmo hr A‘yV© bmJV na

{dÎmr¶ n[ag§n{Îm H$m AmH$bZ {H$¶m OmVm h¡:

n[ag§n{Îm¶m| H$mo amoH$Zo Ho$ CÔoí¶ go AZw~§{YV ZJX àdmh H$mo

EH$Ì H$aZo Ho$ {bE ì¶mnma ‘m°S>b Ho$ ^rVa {H$¶m OmVm h¡ &

{dÎmr¶ n[ag§n{Îm Ho$ AZw~§Y H$s eVm] ‘| ZH$Xr àdmh Ho$ {bE

{Z{X©ï> {V{W¶m| na d¥{Õ hmoVr h¡ Omo ‘yb ê$n go ‘yb am{e na

‘ybYZ Am¡a ã¶mO H$m ^wJVmZ H$aVr h¢&

àma§{^H$ AmH$bZ Ho$ nümV Eogr {dÎmr¶ nag§n{Îm¶m| na à^mdr

ã¶mO Xa nÕ{V AnZmH$a n[aemoYZ bmJV na AmH$bZ {H$¶m

OmVm h¡ & n[aemoYZ bmJV H$s H$moB© Ny>Q> AWdm YmaU na

àr{‘¶‘ d ’$sg AWdm bmJV Omo à^mdr ã¶mO Xa Ho$ A{^Þ

A§J h¡ CZH$mo Ü¶mZ ‘| aIVo hþE JUZm H$s OmVr h¡ & n[aemoYZ

106


107


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

interest rate amortization is included as finance in the profit and loss. The losses arising from the impairment are recognized in profit and loss.

financial Assets at fair value through other comprehensive income (oci)

Financial Assets with contractual cash flow characteristics that are solely payments are principal and interest and held in a business model whose objective is achieved by both collecting contractual cash flows and selling financial assets are classified to be measured at FVOCI.

Financial Assets at fair value through profit and loss (fVtpl)

Any financial assets, which does not meet the criteria for categorization as at amortized cost or as FVOCI, is classified as at FVTPL.

In addition, the company may elect to classify a debt instrument, which otherwise meets amortized cost or FVCOI criteria, as at FVTPL. However, such selection is allowed only if doing so reduces or eliminates a measurement or recognition inconsistency (referred to as ‘accounting mismatch’)

Financial assets included within the FVTPL category are measured at fair value with all changes recognized in profit and loss.

equity instruments

All equity instruments in scope of Ind AS 109 are measured at fair value. On initial recognition an equity investment that is not held for trading, the Company may irrevocably elect to present subsequent changes in fair value in OCI. This election is made on an investment-by-investment basis.

All other financial instruments are classified as measured at FVTPL.

à^mdr ã¶mO Xa H$mo bm^ d hm{Z ‘| {dÎm Ho$ ê$n ‘| em{‘b {H$¶m OmVm h¡ & j{V go CËnÞ hm{Z H$mo bm^ d hm{Z ‘| ‘mÝ¶Vm Xr OmVr h¡ &

AÝ¶ ì¶mnH$ Am¶ go C{MV ‘yë¶ na {dÎmr¶ n[ag§n{Îm¶m±

AZw~§{YV ZH$X àdmh go (AmogrAmB©)

g§{dXmJV ZH$X àdmh Ho$ gmW {dÎmr¶ n[ag§n{Îm¶m| H$s {deofVmAm| {OZH$m ‘yb am{e d ã¶mO ‘| nyU©V: ^wJVmZ {H$¶m J¶m h¡ Am¡a {~OZog ‘m°S>b ‘| amoH$m J¶m h¡ CZH$m ‘yb CÔoí¶ AZw~§{YV ZH$X àdmh H$mo EH$Ì H$aZo VWm {dÎmr¶ n[ag§n{Îm¶m| H$s {~H«$s XmoZm| Ho$ Ûmam àmá {H$¶m J¶m h¡ & E’$drAmogrAmB© na

AmH$bZ dJuH¥$V {H$¶m J¶m h¡ &

bm^ d hm{Z go C{MV ‘yë¶ na {dÎmr¶ n[ag§n{Îm¶m±

(E’$drQ>rnrEb)

{dÎmr¶ n[ag§n{Îm¶m± Omo n[aemoYZ bmJV na dJuH¥$V bmJV Ho$ ê$n

‘| ¶m E’$drAmogrAmB© Ho$ ê$n ‘| dJuH$aU Ho$ ‘mZX§S>mo H$mo nyU© Zht

H$aVm h¡ CZH$mo E’$drQ>rnrEb ‘| dJuH¥$V {H$¶m J¶m h¡ &

BgHo$ A{V[aº$, H§$nZr F$U XñVmdoO H$mo dJuH$aU H$aZo Ho$

{bE Omo E’$drQ>rnrEb na AÝ¶Wm n[aemoYZ bmJV AWdm

E’$drgrAmoAmB© ‘mZX§S> Ho$ AZwHy$b h¡ & VWm{n, ¶{X KQ>m¡{V

AWdm AmH$bZ H$mo {dbwá H$aZo AWdm ‘mÝ¶Vm ‘| ‘ob Z hmo

Vmo BgHo$ M¶Z H$s AZw‘{V Xr Om gH$Vr h¡ & (boIm {‘g‘¡M

Ho$ ê$n ‘| g§X{^©V)

{dÎmr¶ n[ag§n{Îm¶m| H$mo E’$drQ>rnrEb Ho$ ^rVa em{‘b loUr H$mo

bm^ d hm{Z ‘| ‘mÝ¶Vm àmá g^r n[adV©Zm| go C{MV ‘yë¶ na

AmH$bZ {H$¶m J¶m h¡ &

B{¹$Q>r XñVmdoO

B§S>EEg 109 Ho$ Xm¶ao ‘| B{¹$Q>r XñVmdoO H$mo C{MV ‘yë¶ na AmH$bZ {H$¶m J¶m h¡ & àma§{^H$ ‘mÝ¶Vm na B{¹$Q>r {Zdoe Omo ì¶mnm[aH$ Zht h¡, H§$nZr AmogrAmB© ‘| C{MV ‘yë¶ ‘| hmoZodmbo n[adV©Zm| H$mo àñVwV H$aZo Ho$ {bE An[adV©Zr¶ ê$n go MwZmd H$a gH$Vr h¡ & ¶h MwZmd {Zdoe na {Zdoe AmYma na {H$¶m

Om¶oJm &

eof g^r XñVmdoO E’$drQ>rnrEb na AmH$bZ Ho$ AZwgma

dJuH¥$V {H$E JE h¡ &

108


109


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

De-recognition of financial asset

A financial asset (or, where applicable, a part of financial asset or part of a group is similar financial assets) is primarily derecognized (i.e. removed from the Company’s balance sheet) when:

- The right to receive cash flows from the asset have expired, or

- The Company has transferred its rights to receive cash flows from the asset or has assumed obligation to pay the received cash flows in the full without material delay to a third party under a ‘pass-through’ arrangement; and either (a) the company has transferred substantially all the risks and rewards of the asset, or (b) the company has neither transferred nor retained substantially all the risks and rewards of the asset, but has transferred control of the asset

When the Company has transferred its right to receive cash flows from an asset or has entered into a ‘pass-through’ arrangement, it evaluates if and to what extent it has retained the risk and reward of ownership. When it has neither transferred nor retained substantially all of the risk and rewards of the asset, nor transferred control of the asset, the company continues to recognize the transferred asset to the extent of the Company’s continuing involvement. In that case, the Company also recognizes an associated liability. The transferred asset and associated liability are measured on a basis that reflects the rights and obligation that company has retained.

Continuing involvement that takes the form of a guarantee over the transferred asset is measured at the lower of the original carrying amount of the asset and the maximum amount of consideration that the company could be required to repay.

On de-recognition of a financial asset, the difference between the carrying amount of the asset (or the carrying amount allocated to the portion of the asset derecognized) and the sum of (i) the consideration received (including any new asset obtained less any new liability assumed) and (ii) any cumulative gain or loss that had been recognized in OCI is recognized in profit or loss.

{dÎmr¶ n[ag§n{Îm¶m| H$mo A‘mÝ¶Vm

{dÎmr¶ n[ag§n{Îm (AWdm, Ohm± bmJy hmo, {dÎmr¶ n[ag§n{Îm H$m ^mJ AWdm g‘yh H$m ^mJ ^r {dÎmr¶ n[ag§n{Îm) H$mo ‘w»¶ ê$n go A‘mÝ¶Vm Xr JB© hmo (¶m{Z H§$nZr Ho$ VwbZ-nÌ go {ZH$mbm hþAm) O~

- g‘má hmoZodmbr n[ag§n{Îm go ZH$X àdmh àm{á H$m A{YH$ma, AWdm

- H§$nZr Zo n[ag§n{Îm go ZH$X àdmh àmá H$aZo H$m AnZm A{YH$ma ñWmZm§V[aV {H$¶m hmo AWdm "nmg W«w' ì¶dñWm Ho$ A§VJ©V Vrgar nmQ>u H$mo A{db§~ ‘Q>r[a¶b nyU© ZH$X àm{á H$m ^wJVmZ H$aZo Ho$ {bE Xm{¶Ëd J«hU {H$¶m hmo, Am¡a ¶m Vmo (H$) H§$nZr Zo n[ag§n{Îm Ho$ g^r OmopI‘ d [adm°S>©g Ho$ n¶m©á ê$n go ñWmZm§V[aV H$a {XE hmo, (I) H§$nZr Zo n[ag§n{Îm Ho$ g^r OmopI‘ d [adm°S>©g H$mo n¶m©á ê$n go Z ñWmZm§V[aV {H$E hmo Am¡a Z hr amoH$H$a aIo JE hmo na§Vw n[ag§n{Îm Ho$ {Z¶§ÌU H$mo ñWmZm§V[aV H$a {X¶m hmo &

H§$nZr Zo O~ n[ag§n{Îm go ZH$X àdmh àmá H$aZo H$m A{YH$ma

ñWmZm§V[aV H$a {X¶m hmo AWdm "nmg W«w' ì¶dñWm ‘| à{d{ï>

H$s hmo, Vmo ¶h ‘yë¶m§H$Z {H$¶m OmVm h¡ {H$ {H$g hX VH$ CgZo

ñdm{‘Ëd Ho$ OmopI‘ d [aH$m°S>© H$mo amoH$H$a aIm h¡ & O~ H§$nZr Zo

n[ag§n{Îm Ho$ OmopI‘ d [aH$m°S>© H$mo Z Vmo ñWmZm§VaU {H$¶m h¡ Am¡a

Zm hr n¶m©á ‘mÌm ‘| amoH$H$a aIm h¢ Am¡a Zm hr n[ag§n{Îm H$m

{Z¶§ÌU ñWmZm§V[aV {H$¶m h¡, Vmo H§$nZr ñWmZm§V[aV n[ag§n{Îm

H$mo gVV ê$n go gpå‘{bV H$a ‘mÝ¶Vm Xo ahr h¡ & Eogo ‘m‘bo ‘|

H§$nZr g§~§Õ Xo¶Vm H$mo r ‘mÝ¶Vm àXmZ H$a ahr h¡ & ñWmZm§V[aV

n[ag§n{Îm VWm g§~§Õ Xo¶Vm H$mo CZHo$ A{YH$ma d Am¡{MË¶ H$s

à{Vð>m Ho$ AmYma na AmH$bZ H$a ahr h¡ Omo H§$nZr Zo amoH$s h¡ &

ñWm§V[aV n[ag§n{Îm na gVV Ow‹S>md Omo Jma§Q>r H$m ê$n boVm h¡ CgH$m n[ag§n{Îm Ho$ ‘yb am{e Ho$ ZrMo AmH$bZ {H$¶m OmVm h¡ VWm A{YH$V‘ am{e Xa nwZ: ^wJVmZ H$aZo H$s Amdí¶H$Vm h¡ &

{dÎmr¶ n[ag§n{Îm¶m| H$s ‘mÝ¶Vm Ho$ AmYma na, n[ag§n{Îm¶m| H$s

dhZ (am{e ¶m àmßV g§n{Îm Ho$ {hñgo H$mo Am~§{Q>V H$s JB© am{e

Ho$ ~rM H$m A§Va) Am¡a àmßV H$s JB© am{e (i) na {dMma {H$¶m

J¶m ({H$gr ^r ZB© g§n{Îmg{hV) ZB© Xo¶Vm ‘mZbr JB© (ii)

{H$gr ^r g§M{¶ bm^ ¶m hm{Z {Ogo AmogrAmB© ‘| ‘mÝ¶Vm Xr JB©

Wr, bm^ ¶m hm{Z ‘| ‘mÝ¶Vm àmá h¡ &

108


109


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

Impairment of financial assetsThe Company assesses on a forward looking basis the expected credit losses associated with its assets carried at amortized cost and fair value through other comprehensive income for financial assets. The impairment methodology applied depends on whether there has been a significant increase in expected credit risk.

With regards to trade receivable, the Company applies the simplified approach as permitted by Ind AS 109, Financial Instruments, which requires expected lifetime losses to be recognized from the initial recognition of the trade receivables.

financial liabilities

initial recognition and measurement

Financial liabilities are classified, at initial recognition, as financial liabilities at fair value through profit or loss, amortized cost, as appropriate.

All financial liabilities are recognized initially at fair value and in the case of amortized cost, net of directly attributable transaction costs.

Subsequent measurement

The measurement of financial liabilities depends o their classification, as described below:

financial liabilities measured at amortized cost

After initial recognition, interest bearing loans and borrowings are subsequently measured at amortized cost using the effective interest method. Gains and losses are recognized in profit or loss when the liabilities are derecognized as well as through the EIR amortization process.

Amortized cost is calculated by taking into account any discount or premium on acquisition and fees or cost that are integral part of the effective interest rate. The effective interest rate amortization is included as finance costs in the statement of profit and loss.

Financial liabilities at fair value through profit or loss (fVtpl)

Financial liabilities at fair value through profit or loss include financial liabilities held for trading and financial

{dÎmr¶ n[ag§n{Îm¶m| H$s j{V

H§$nZr n[aemo{YV bmJV d E’$drAmogrAmB© {dÎmr¶ n[ag§n{Îm¶m|

na H¡$[aS> n[ag§n{Îm¶m| go Ow‹S>r Ano{jV O‘m hm{Z¶m| Ho$ AmYma

na AmJo ‘yë¶m§H$Z H$aVr h¡ & ¶{X H«o${S>Q> OmopI‘ ‘| {d{eï>

d¥{Õ hmo Vmo Cg na {Z^©a j{V H$s H$m¶©àUmbr bmJy H$s OmVr

h¡ &

ì¶mnma àmß¶ Ho$ ~mao ‘|, H§$nZr B§S>EEg 109, Ûmam bmJy gab

Ñ{ï>H$moU AnZmVr h¡ Omo {dÎmr¶ XñVmdoO {Og‘| ì¶mnma àmß¶

H$s àma§{^H$ nhMmZ go Ano{jV AmOrdZ hm{Z¶m| H$mo ‘mÝ¶Vm XoZo

H$s Amdí¶H$Vm h¡ &

{dÎmr¶ Xo¶VmE°§

àma§{^H$ ‘mÝ¶Vm Ed§ AmH$bZ

C{MV bm^ AWdm hm{Z, n[aemo{YV bmJV go C{MV ‘yë¶ na {dÎmr¶ Xo¶VmAm| Ho$ AZwgma àma§{^H$ ‘mÝ¶Vm na {dÎmr¶ Xo¶VmAm|

H$mo dJuH¥$V {H$¶m OmVm h¡ &

g^r {dÎmr¶ Xo¶VmAm| H$mo àma§{^H$ ê$n go C{MV ‘yë¶ na ‘mÝ¶Vm Xr OmVr h¡ VWm n[aemoYZ bmJV Ho$ ‘m‘bo ‘| grYo Amamo{nV

Q´>mÝOoŠeZ bmJV Ho$ {Zdb na ‘mÝ¶ {H$¶m OmVm h¡ &

AmJm‘r AmH$bZ

{dÎmr¶ Xo¶VmAm| H$m AmH$bZ CZHo$ dJuH$aU na {Z^©a hmoVm h¡

Omo {ZåZmZwgma h¡:

n[aemoYZ bmJV na {dÎmr¶ Xo¶VmAm| H$m AmH$bZ

àma§{^H$ ‘mÝ¶Vm Ho$ nümV F$U Am¡a CYma na ã¶mO H$s à^mdr

ã¶mO nÕ{V AnZmH$a n[aemoYZ bmJV na AmH$bZ {H$¶m OmVm

h¡ & bm^ AWdm hm{Z H$mo O~ Xo¶VmAm| H$mo A‘mÝ¶ VWm B© AmB©

Ama n[aemo{YV à{H«$¶m Ho$ ‘mÜ¶‘ go bm^ d hm{Z ‘| ‘mÝ¶Vm

Xr OmVr h¡ &

n[aemoYZ bmJV H$s Ny>Q> AWdm YmaU H$aZo na àr{‘¶‘ d ’$sg AWdm bmJV Omo à^mdr Xa Ho$ A{^Þ A§J h¡ CZH$mo Ü¶mZ ‘| aIVo hþE JUZm H$s OmVr h¡ & à^mdr ã¶mOXa na A‘yV©H$aU H$mo bm^ d hm{Z {ddaUr ‘| {dÎmr¶ bmJV Ho$ ê$n ‘| em{‘b {H$¶m

OmVm h¡ &

bm^ AWdm hm{Z go C{MV ‘yë¶ na {dÎmr¶ Xo¶VmE°§

(E’$drQ>rnrEb)

Q´>oqS>J d {dÎmr¶ Xo¶VmAm| hoVw amoH$s JB© {dÎmr¶ Xo¶VmAm| ‘| em{‘b bm^ AWdm hm{Z go C{MV ‘yë¶ na {dÎmr¶ Xo¶VmAm| Ho$ bm^

110


111


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

liabilities designated upon initial recognition as at fair value through profit or loss. Financial liabilities are classified as held for trading if they are incurred for the purpose of repurchasing in the near term.

Gains and losses on liabilities held for trading are recognized in the profit or loss.

Financial liabilities designated upon initial recognition at fair value through profit or loss are designated as such at the initial date of recognition, and only if the criteria in Ind AS 109 are satisfied. For liabilities designated at FVTPL, fair value gains/losses attributable to changes in own credit risks are recognized in OCI. These gains/loss are not subsequently transferred to P&L. However, the group may transfer the cumulative gain or loss within equity. All other changes in fair value of such liability are recognized in the statement of profit or loss.

De-recognition of financial liabilities

The company derecognizes a financial liability when its contractual obligations are discharged or cancelled or expire.

Modification of financial assets and financial liabilities

financial Assets

If the terms of a financial asset are modified, the company evaluates whether the cash flows of the modified assets are subsequently different. If the cash flows are subsequently different, then the contractual rights to cash flows from the original financial assets are deemed to have expired. In this case, the original financial asset is derecognized and a new financial asset is recognized at fair value.

If the cash flows of the modified asset carried at amortized cost are not substantially different, then the modification does not result in de-recognition of the financial asset.

In this case, the company recalculates the gross carrying amount of the financial asset and recognizes the amount arising from adjusting the gross carrying amount as a modification gain or loss in profit or loss. If such a modification is carried out because of financial difficulties of the borrower, then the gain or

AWdm hm{Z go C{MV ‘yë¶ na àma§{^H$ ê$n go nhMmZZo Ho$ AZwgma Zm{‘V {H$¶m J¶m h¡ & ¶{X ZOXrH$s Ad{Y ‘| nwZ: {~H«$s Ho$ bú¶ Ho$ {bE {H$E JE Q´>oqS>J H$a Ho$ AZwgma {dÎmr¶ Xo¶VmAm| H$m dJuH$aU {H$¶m J¶m h¡ &

Q´>oqS>J Ho$ {bE H$s JB© Xo¶VmAm| na bm^ d hm{Z¶m| H$mo bm^ AWdm

hm{Z ‘| ‘mÝ¶Vm

bm^ AWdm hm{Z Ho$ ‘mÜ¶‘ go C{MV ‘yë¶ na àma§{^H$ ‘mÝ¶Vm

na Zm{‘V {dÎmr¶ Xo¶VmAm| H$mo nhMmZZo H$s àma§{^H$ VmarI Ho$

ê$n ‘| Zm{‘V {H$¶m OmVm h¡ Am¡a ¶{X do Ho$db B§S>EEg 109 ‘|

‘mZX§S> g§Vwï> hmoVo h¢ & E’$drQ>rnrEb na Zm{‘V Xo¶VmAm| hoVw

H«o${S>Q> OmopI‘ ‘| n[adV©Z go {H$E JE C{MV ‘yë¶ na bm^/

hm{Z¶m± H$mo AmogrAmB© ‘| ‘mÝ¶Vm Xr JB© h¡ & VËnümV BZ bm^/

hm{Z H$mo nrE§S>Eb ‘| ñWmZm§VaU Zht {H$¶m J¶m h¡ & VWm{n

J«wn B{¹$Q>r Ho$ ^rVa g§{MV bm^ AWdm hm{Z H$mo ñWmZm§VaU

{H$¶m Om gH$Vm h¡ & BZ Xo¶VmAm| Ho$ C{MV ‘yë¶ ‘| AÝ¶ g^r

n[adV©Zm| H$mo bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ¶Vm Xr JB© h¡ &

{dÎmr¶ Xo¶VmAm| H$mo A‘mÝ¶

O~ g§{dXmJV Xm{¶Ëd {S>ñMmO© AWdm aÔ AWdm g‘má {H$E

OmVo h¡ Vmo {dÎmr¶ Xo¶VmAm| H$mo H§$nZr A‘mÝ¶ H$aVr h¡ &

{dÎmr¶ n[ag§n{Îm¶m| VWm {dÎmr¶ Xo¶VmAm| ‘| g§emoYZ

{dÎmr¶ n[ag§n{Îm¶m±

¶{X {dÎmr¶ n[ag§n{Îm¶m| H$m Q>‘© g§emo{YV {H$¶m OmVm h¡ Vmo

H§$nZr ~VmVr h¡ {H$ g§emo{YV n[ag§n{Îm¶m| H$m ZH$X àdmh AbJ

h¡ ¶m Zht & ¶{X ZH$X àdmh AbJ h¡ Vmo ‘yb {dÎmr¶ n[ag§n{Îm¶m|

go ZH$X àdmh Ho$ g§{dXmJV A{YH$ma g‘má g‘Po OmVo h¡ & Bg

‘m‘bo ‘| ‘yb {dÎmr¶ n[ag§n{Îm H$mo A‘mÝ¶ {H$¶m OmVm h¡ VWm

ZE {dÎmr¶ n[ag§n{Îm H$mo C{MV ‘yë¶ na ‘mÝ¶Vm Xr OmVr h¡&

¶{X n[aemo{YV bmJV na g§emo{YV n[ag§n{Îm Ho$ ZH$X àdmh

AbJ Z hmo Vmo {dÎmr¶ n[ag§n{Îm H$mo g§emoYZ Ho$ n[aUm‘ñdê$n

A‘mÝ¶ {H$¶m OmVm h¡ &

Bg ‘m‘bo ‘| H§$nZr {dÎmr¶ n[ag§n{Îm H$s gH$b dV©‘mZ am{e H$s

nwZ: JUZm H$aVr h¡ VWm gH$b dV©‘mZ am{e Ho$ g‘m¶moOZ go

CËnÞ am{e H$mo bm^ AWdm hm{Z ‘| g§emo{YV bm^ AWdm hm{Z

Ho$ ê$n ‘| ‘mÝ¶Vm XoVr h¡ & Eogo g§emoYZ ¶{X CYma boZodmbo H$s

{dÎmr¶ H${R>ZmB© Ho$ H$maU hþB© h¡ Vmo hm{Z¶m| H$s j{V g{hV bm^

110


111


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

loss is presented together with impairment losses. In other cases, it is presented as interest income.

cash and cash equivalents

Cash and cash equivalents include cash on hand, cash at banks, other short term deposits with banks with an original maturity of three months or less and highly liquid investments, that are readily convertible to known amount of cash and which are subject to insignificant risk of changes in value and Bank overdrafts.

trade Receivables

Trade receivables are initially recognized at fair value. Trade receivables for more than 12 months are shown under non current financial assets and are held at amortized cost, using the effective interest rate (EIR) method, less provision for impairment.

trade and other payables

These amounts represent liabilities for goods and services provided to the Company prior to the end of financial year which are unpaid. Trade and other payables are presented as current liabilities unless payment is not due within 12 months after the reporting period. They are recognized initially at their fair value and subsequently measured at amortized cost using the EIR method.

1.23 Segment Reporting

An operating segment is a component of an entity:

(a) that engages in business activities from which it may earn revenues and incur expenses (including revenues and expenses relating to transactions with other components of the same entity),

(b) whose operating results are regularly reviewed by the entity’s chief operating decision maker to make decisions about resources to be allocated to the segment and assess its performance, and

(c) for which discrete financial information is available.

d hm{Z àñVwV: H$s OmVr h¡ & AÝ¶ ‘m‘bm| ‘| ã¶mO Am¶ Ho$ ê$n

‘| àñVwV H$s OmVr h¡ &

amoH$‹S> Ed§ amoH$‹S> g‘H$j

ZH$X Ed§ ZH$X g‘Vwë¶ {Og‘| H¡$e Am°Z h¢S>, ~¢Šg ‘| H¡$e,

~¢Šg ‘| VrZ ‘mh AWdm Cggo H$‘ AmoarOZb H$s ‘¡À¶w[aQ>r Ho$

gmW AÝ¶ em°Q>© Q>‘© {S>nm°{OQ> VWm hm¶br {b{¹$S> {Zdoe Omo

ZH$X OmZZo Ho$ {bE AmgmZr go n[adV©Zr¶ h¡ Am¡a Omo ‘yë¶ Am¡a

~¢H$ AmodaS´>mâQ²g ‘| n[adV©Z Ho$ ‘hËdhrZ OmopI‘ Ho$ AYrZ h¡ &

ì¶mnma àmß¶

àma§^ ‘| ì¶mnma àmß¶ H$mo C{MV ‘yë¶ na ‘mÝ¶Vm Xr OmVr h¡ & 12 ‘mh go A{YH$ ì¶mnma àmß¶ H$mo J¡a Mmby {dÎmr¶ n[ag§n{Îm¶m| Ho$ A§VJ©V Xem©¶o OmVo h¡ Omo hm{Z hoVw àmdYmZ H$s KQ>m¡Vr go à^mdr ã¶mO Xa (B©AmB©Ama) nÕ{V H$m Cn¶moJ H$aHo$ n[aemo{YV bmJV na Am¶mo{OV {H$¶m OmVm h¡ &

ì¶mnma Ed§ AÝ¶ ^wJVmZ ¶mo½¶

¶o am{e¶m° {dÎmr¶ df© H$s g‘m{á go nyd© H§$nZr H$mo Xr JB© dñVwAm| d godmAm| Ho$ {bE Xo¶VmAm| H$m à{V{Z{YËd H$aVr h¡ {OZH$m ^wJVmZ Zht {H$¶m J¶m h¡ & ì¶mnma d AÝ¶ ^wJVmZ ¶mo½¶ H$mo Mmby Xo¶VmAm| Ho$ ê$n ‘| àñVwV {H$¶m J¶m h¡ & {OZH$m ^wJVmZ [anmo{Qª>J Ad{Y Ho$ nümV 12 ‘hrZm| Ho$ rVa Xo¶ Zht h¡ & CZH$mo àma§^ ‘| C{MV ‘yë¶ na ‘mÝ¶Vm Xr JB© h¡ VËnümV B©AmB©Ama nÕ{V H$m Cn¶moJ H$aHo$ n[aemo{YV bmJV na AmH$bZ {H$¶m J¶m h¡ &

1.23 I§S>dma [anmo{Qª>J

àMmbZ I§S> BH$mB© H$m EH$ KQ>H$ h¡

(H$) ¶h ì¶mdgm{¶H$ J{V{d{Y¶m| ‘| g§b¾ h¡, {Oggo amOñd

Am¡a Am¶ ì¶¶ (amOñd g{hV Am¡a Cgr BH$mB© Ho$ AÝ¶

KQ>H$m| Ho$ gmW boZXoZ go g§~§{YV ì¶¶) bJm¶m Om

gH$Vm h¡ &

(I) BgH$m g§MmbZ n[aUm‘ {Z¶{‘V ê$n go BH$mB© Ûmam g‘rjm H$s OmVr h¡, ‘w»¶ g§MmbZ {ZU©¶ {Z‘m©Vm I§S> Ho$ {bE Am~§{Q>V {H$¶o OmZo dmbo g§gmYZm| Ho$ ~mao ‘| {ZU©¶ boZo Am¡a CgHo$ àXe©Z H$m Am§H$bZ {H$¶m OmVm h¡ &

(J) {OgHo$ {bE AgVV {dÎmr¶ OmZH$mar CnbãY h¡ &

112


113


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

The Chairman-cum-Managing Director (CMD) of the Company has been identified as ‘Chief Operating Decision Maker (CODM) as defined by Ind AS 108-‘Operating Segment’. Operating segments are reported in a manner consistent with the internal reporting provided to the CODM.

1.24 Revenue from contracts

Effective from 01st April 2018, the Company adopted Ind AS 115 – “Revenue from Contracts with Customers” using the retrospective method. Accordingly, the comparative figures have been reinstated retrospectively. (Refer note no. 30)

Timing of Recognition:

Revenue is recognized on satisfaction of performance obligation upon transfer of control of promised products or services to customers in an amount that reflects the consideration the Company expects to receive in exchange for those products or services.

Operating Revenue

(a) Sales of lint, fully pressed bales of cotton and cotton seeds are recognized at the time of issuance of delivery orders by the Company provided delivery has taken place on or before end of the reporting period.

(b) Credit towards interest, late lifting charges and carrying charges wherever applicable, has been taken in respect of sales booked during the year.

(c) Export sales are accounted on the basis of relevant Bills of Lading.

other operating Revenue

The income relating to the core activities of the company which are not included in revenue from sales/services for e.g. subsidy, claims against losses on trade transactions, interest on credit sales and trade related advances (other than on overdue) etc., which are derived based on the terms of related trade agreements with business associates or schemes on related trade, are accounted for under ‘Other Operating Revenue’.

AÜ¶j Ed§ à~§Y {ZXoeH$ (grE‘S>r) H$mo H§$nZr H$m ‘w»¶

n[aMmbZ {ZU©¶H$Vm© (grAmoS>rE‘) Ho$ ê$n ‘| nhMmZm J¶m h¡, Š¶m|{H$ B§S>EEg 108 Ûmam n[a^m{fV àMmbZ I§S> Ho$ g§MmbZ Ho$ ê$n ‘| Bg àH$ma go [anmoQ>© H$s OmVr h¡, Omo grAmoS>rE‘ H$mo

àXmZ H$s J¶r Am§V[aH$ [anmo{Qª>J Ho$ AZwê$n ~Vm¶m J¶m h¡ &

1.24 R>oHo$ go amOñd

1 Aà¡b, 2018 go à^mdr H§$nZr Zo nyd© ì¶mnr {d{Y

H$m Cn¶moJ H$aHo$ J«mhH$m| Ho$ gmW AZw~§Y B§S> EO 115

amOñd Ho$ ê$n ‘| AnZm¶m,Š¶m|{H$ VwbZmË‘H$ Am§H$S>o

nyd©ì¶mnr ê$n go ~hmb {H$¶o J¶o h¢ & (g§X^© Zmo.g§.30)

‘mÝ¶Vm H$m g‘¶

amOñd H$m dmXm {H$¶o J¶o CËnmXm| ¶m godmAm| H$m {Z¶§ÌU J«mhH$mo

H$mo EH$ am{e ‘| hñVm§V[aV H$aZo na àXe©Z Xm{¶Ëd H$s g§Vw{ï>

na hmoVm h¡,Omo CZ CËnmXm| ¶m godmAm| Ho$ ~Xbo ‘| àmá hmoZo dmbr

H§$nZr H$s Anojm H$mo Xem©Vm h¡ &

Am°naoqQ>J aodÝ¶y

(H$) qbQ> H$s {~H«$s H$nmg Am¡a {~Zm¡bm nyar Vah àog H$s Jm§R>m|

H$mo H§$nZr Ûmam {dVaU/gwnwX©Jr Ho$ AmXoe Omar H$aZo Ho$

g‘¶ na ‘mÝ¶Vm Xr OmVr h¡ ~eV} {H$ gwnwX©Jr Ad{Y

[anmo{Q©>J Ad{Y Ho$ A§V ¶m Cggo nhbo hþB© hmo &

(I) df© Ho$ Xm¡amZ ~wH$ H$s JB© {~H«$s Ho$ g§~§Y ‘| ã¶mO,Xoa go

CR>mZo Ho$ ewëH$ Am¡a bmJy ewëH$ Ohm§ ^r bmJy h¡ {b¶m

J¶m h¡ &

(J) {Z¶m©V {~H«$s H$m boIm-OmoIm g§~§{YV {~bm| Ho$ AmYma

na {H$¶m OmVm h¡ &

amOñd AÝ¶ àMmbZ

H§$nZr H$s ‘w»¶ J{V{d{Y¶m| go g§~§{YV Am¶,Omo {~H«$s Ho$ {bE

amOñd/godmAm| go em{‘b Zht h¡, CXmhaU Ho$ {bE,ì¶mnma

boZXoZ na ZwH$gmZ Ho$ pIbm’$ Xmdo, H«o${S>Q> {~H«$s na A§Va

Am¡a ì¶mnma go g§~§{YV A{J«‘ àJ{V na A§Va (A{VXo¶ Ho$

Abmdm AÝ¶) Am{X Omo ì¶mnma gh¶mo{J¶m| ¶m g§~§{YV ì¶mnma

na ¶moOZmAm| Ho$ gmW g§~§{YV ì¶mnma g‘Pm¡Vm| H$s eVm] Ho$

AmYma na àmá hmoVo h¢, AÝ¶ àMmbZ amOñd Ho$ VhV {Oå‘oXma

hmoVo h¢ &

112


113


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

claims

Claims are recognized in the Statement of Profit & Loss (Net of any payable) on accrual basis including receivables from Govt. towards subsidy, cash incentives, reimbursement of losses etc, when it is not unreasonable to expect ultimate collection. Claims recognized but subsequently becoming doubtful are provided for through Statement of Profit and Loss.

dividend and interest income

Interest income is recognized, when no significant uncertainty as to measurability or collectability exist, on a time proportion basis taking into account the amount outstanding and the applicable interest rate, using the effective interest rate method.

Revenue from rentals and operating leases is recognized on an accrual basis in accordance with the substance of the relevant agreement.

Revenue recognition is deferred till actual realization, owing to significant uncertainty about measurability and ultimate collection in respect of:

(a) Insurance claims, which are accounted upon issuance of relevant loss vouchers by the insurance company.

(b) Income towards interest in regard to debts outstanding from institutional buyers, which are not regular in clearing their dues to the Company.

(c) Net claims (after adjusting deposits, advance carrying charges and credit balances) lodged and interest thereon on the defaulting buyers for losses arising out of resale of quantities initially sold to them;

1.25 use of judgments and estimates

In preparing these financial statements, management has made judgments, estimates and assumptions that affect the application of the company’s accounting policies and the reported amounts of assets , liabilities, income and expenses. Management believes that the estimates used in the preparation of the financial statements are prudent and reasonable. Actual results may differ from these estimates. Estimates and underlying assumptions are reviewed on an ongoing basis. Revisions to estimates are recognized prospectively.

Xmdm

Xmdo H$mo bm^ Am¡a hm{Z Ho$ {ddaU ‘| ‘mÝ¶Vm Xr JB© h¡ (Omo

{H$gr ^r Xo¶ H$m ewÛ) H$mo gaH$ma go àmá H$aZo g{hV C{MV

AmYma na gpãgS>r, ZH$X àmoËgmhZ, ZwH$gmZ H$s à{Vny{V© Am{X

H$s {Xem ‘|, O~ A§{V‘ g§J«h H$s Cå‘rX H$aZm AZw{MV Zht h¡

‘mÝ¶Vmàmá h¡, bo{H$Z ~mX ‘| g§{X½Y hmoZo na bm^ Am¡a hm{Z Ho$

~¶mZ Ho$ {bE àXmZ {H$¶m OmVm h¡ &

bm^m§e Am¡a ã¶mO Am¶

ã¶mO Am¶ H$mo ‘mÝ¶Vm Xr OmVr h¡, O~ n^m{dVVm Xa nÛ{V H$m

Cn¶moJ H$aVo hþE, g‘¶ gmaUr ¶m gm‘y{hH$Vm Ho$ AZwgma H$moB©

‘hËdnyU© A{Z{üVVm ‘m¡OyX Zht hmoVr h¡ &

{H$am¶o Am¡a n[aMmbZ nQ>Q>m| go àmá amOñd H$mo g§~§{YV g‘Pm¡Vo

Ho$ AZwgma EH$ AmH$pñ‘H$ AmYma na ‘mÝ¶Vm àmá h¡ &

amOñd ‘mÝ¶Vm H$mo dmñV{dH$ àm{á VH$ ñW{JV H$a {X¶m OmVm h¡,{OgH$s dOh go ‘mnZ Am¡ Cn¶mo{JVm g§J«h Ho$ ~mao ‘| ‘hËdnyU©

A{Z{üVVm hmo gH$Vr h¡ &

(H$) ~r‘m Xmdo, O¡go ~r‘m H§$nZr Õmam àmg§{JH$ hm{Z dmCMa

Omar H$aZo na AmY[aV hmoVo h¢&

(I) g§ñWmJV IarXmam| go ~H$m¶m F$Um| Ho$ {bE AnZm

~H$m¶m gm’$ H$aZo ‘| {Z¶{‘V Zht h¢

(J) ewÛ Xmdm| (O‘mAm| H$mo g‘m¶mo{OV H$aZo Ho$ ~mX,A{J«‘

ewëH$ Am¡a H«o${S>Q> eof) XO© {H$¶o J¶o Am¡a CZ na {S>’$mëQ>

ê$n go IarXmam| H$mo ã¶mO {X¶m J¶m, Omo CÝh| ~oMr J¶r

‘mÌm Ho$ nwZ: {dH«$¶ go hmoZo dmbo ZwH$gmZ Ho$ {bE h¡ &

1.25 {ZU©¶m| Am¡a AZw‘mZm| H$m AZw‘mZm| H$m Cn¶moJ

BZ {dÎmr¶ {ddaU H$mo V¡¶ma H$aZo ‘|, à~§YZ Zo {ZU©¶,AZw‘mZ

Am¡a YmaUmE§ ~ZmB© h¡, Omo boIm§H$Z Zr{V¶m| Am¡a n[ag§n{Îm¶m|,

XoZXm[a¶m|, Am¶ Am¡a ì¶¶ H$s [anmoQ>© H$s JB© ‘mÌm H$mo à^m{dV

H$abr h¡, à~§YZ H$m ‘mZZm h¡ {H$ {dÎmr¶ {ddaUr H$s V¡¶mar ‘|

Cn¶moJ {H$¶o OmZo dmbo AZw‘mZ h¢ & AZw‘m{ZV Am¡a A§V{Z©{hV

YmaUm H$s {Za§Va g‘rjm H$s OmVr h¡ & AZw‘mZm| H$mo g§^m{dV

ê$n go ‘mÝ¶Vm Xr OmVr h¡ &

114


pB


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

a) Judgments

Information about the judgments made in applying accounting policies that have the most significant effects on the amounts recognized in the financial statements have been given below:

- Leases: Whether an arrangement contains a lease.

- Classification of Leases: Classification of leases under finance lease or operating lease requires judgment with regard to the estimated economic life and estimated cost of the asset. The Company has analyzed such lease contracts on case to case basis to classify the arrangement as operating or finance lease, based on an evaluation of the terms and conditions of the arrangements, such as the lease term not constituting a major part of the economic life of the commercial property and the fair value of the asset.

b) Assumptions and estimation uncertainties

Information about assumptions and estimation uncertainties that have a significant risk of resulting in a material adjustment is included below:

- Measurement of defined benefit obligations: Key actuarial assumptions;

- Recognition of deferred tax assets: availability of future taxable profit against which carry forward tax losses can be used;

- Impairment test: Key assumption underlying recoverable amounts, including the recoverability of development cost;

- Useful life of property, plant and equipment and intangible assets;

- Recognition and measurement of provision and contingencies: Key assumption about the likelihood and magnitude of an outflow of resources.

The actual results may defer from these assumptions and estimations.

(H$) {ZU©¶ boIm§H$Z Zr{V¶m| H$mo bmJy H$aZo ‘| {H$¶o J¶o {ZU©¶m| Ho$

~mao ‘| ‘mÝ¶Vm àmá am{e¶m| na g~go ‘hÎdnyU© à^md S>mbVo h¡, ZrMo {X¶o h¢ :

- nÅ>m : Š¶m {H$gr ì¶dñWm ‘| nÅ>m h¡ &

- nÅ>m| H$m dJuH$aU: {dÎm nÅ>o ¶m n[aMmbZ nÅ>o Ho$ VhV nÅ>m|

Ho$ dJuH$aU Ho$ {bE g§n{Îm Ho$ AZw‘m{ZV Am{W©H$ OrdZ

Am¡a AZw‘m{ZV bmJV Ho$ g§~§Y ‘| {ZU©¶ H$s Amdí¶H$Vm

hmoVr h¡ & H§$nZr Zo ‘yë¶m§H$Z Ho$ AmYma na ì¶dñWm H$mo

dJuH¥$V ¶m {dÎm nÅ>o Ho$ ê$n ‘| dJuH¥$V H$aZo Ho$ {bE

‘m‘bo Ho$ AmYma na Eogo nÅ>>o AZw~§Ym| H$m {dûcofU {H$¶m

h¡ & ì¶dñWmAm| Ho$ {Z¶‘m| Am¡a eVm| O¡go {H$ brO Ad{Y

‘| dm{UpÁ¶H$ g§n{Îm Ho$ Am{W©H$ OrdZ H$m EH$ ~S>m

{hñgm Am¡a n[ag§n{Îm¶m| H$m C{MV ‘yë¶ em{‘b Zht h¡ &

(I) ‘mÝ¶VmE| Am¡a AZw‘mZ A{Z{üVVmE|

AZw‘mZ Am¡a AZw‘mZ A{Z{üVVmAm| Ho$ ~mao ‘| OmZH$mar {Og‘| EH$ ‘Q>o[a¶b g‘m¶moOZ ‘| {OgHo$ n[aUm‘ ñdê$n H$m EH$ ~S>m OmopI‘ h¡, ZrMo em{‘b h¡:

- n[a^m{fV bm^ Xm{¶Ëdm| H$m ‘mnZ : ‘w»¶ ~r‘m§{H$V ‘mÝ¶VmAm| H$s Hw$Or h¡ &

- AmñW{JV H$a g§n{Îm¶m| H$s ‘mÝ¶V: ^{dî¶ Ho$ H$a ¶mo½¶ bm^ H$s CnbãYVm {OgHo$ pIbm’$ H$a ZwH$gmZ H$mo AmJo ~T>m¶m Om gH$Vm h¡ &

- hm{Z narjU: {dH$mg bmJV H$s nwZ©àm{á g{hV nwZ©àmá H$aZo ¶mo½¶ ‘mÌm ‘| A§V {Z©{hV ‘hËnnyU© YmaUm &

- àmdYmZ Am¡a AmH$pñ‘H$VmAm| H$s ‘mÝ¶Vm Am¡a ~{h©dmh

H$s g§^mdZm Am¡a n[aUm‘ Ho$ ~mao ‘| ‘hËdnyU© YmaUm &

- dmñV{dH$ n[aUm‘ BZ ‘mÝ¶VmAm| Am¡a AZw‘mZm| go AbJ

hmo gH$Vo h¢ &

B§S> EO 115 Ho$ AZwgma boIm Zr{V ‘| n[adV©Z Ho$ H$maU B§S> EO 8 H$m Iwbmgm &

PB

49th AnnuAl RePoRt 2018-19 the cotton coRPoRAtion of indiA limited

115


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 2 (H$) g§n{Îm, ßbm§Q> VWm CnH$aU /note 2 - (A) Property, plant and equipment (ê$n`o bmI ‘|) / (Rs. in lakh)

ewÕ H¡$[a¨J ‘yë¶Net Carrying Value

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$mo As at 31st

March, 2018

01 Aà¡b, 2017 H$mo As at 1st

April, 2017

’«$shmoëS> ^y{‘ /Land Freehold 126.23 126.23 126.23 brOhmoëS> ^y{‘ / Land Leasehold 56.83 57.66 58.49 ’«$shmoëS> ^dZ / Building Freehold 922.09 919.23 962.91 brOhmoëS> ^dZ / Building Leasehold 84.55 85.71 86.87 E¶a H§$S>reZ ßbm§Q / Air Condition Plant 13.83 13.83 13.83 {dÚwV g§ñWmnZ {bâQ> Ed§ EbrdoQ>g© Electrical installation Lifts and elevators 75.06 89.85 104.64 à¶moJembm CnH$aU / Lab Equipment 142.97 18.75 22.73 ‘moB©ñMa ‘rQ>a Am¡a ‘m¶H«$moZr¶a Q>oñQ>ag*

Moisture Meter and Micronnair Testers* 0.03 9.61 9.92 H§$ß¶yQ>a CnH$aU** / Computer Equipment** 287.09 155.80 209.66 ’$Zr©Ma Ed§ {’$³gMg© / Furniture and Fixtures 77.06 84.98 81.69 dmhZ/ Vehicles 117.99 129.16 132.70 H$m¶m©b¶ CnH$aU /Office Equipments 74.40 83.40 92.54 Hw$b / Total 1,978.13 1,774.21 1,902.21

ZmoQ> : *‘moB©ñMa ‘rQ>a Ed§ ‘mBH«$moZoa Q>oñQ>a H$m nyd©dVu df© ‘| b¡~ CnH$aU ‘| em{‘b {H$¶m J¶m & ~ohVa ê$n go ñnï> H$aZo Ho$ {bE Bgo AbJ ‘X ‘| nwZ: dJuH¥$V {H$¶m J¶m h¡ & ** H§$ß¶yQ>a gmâQ>do¶a O¡go AmnaoqQ>J {gñQ>‘, E‘Eg Am{’$g H$mo nhbo B§Q>|{O~b EgoQ>g Ho$ ê$n ‘| dJuH¥$V {H$¶m J¶m Wm & Bg Vah Ho$ gmâQ>do¶a H§$nZr Ho$ {bE Amdí¶H$ h¢ Am¡a {d{eï> H§$ß¶yQ>a àUmbr Ho$ gmW Ow‹S>o hþE h¢ & AV: ~ohVa ê$n go ñnï> H$aZo Ho$ {bE H§$ß¶yQ>a CnH$aU Ho$ A§VJ©V nwZ: dJuH¥$V {H$¶m J¶m h¡ & My±{H$ H§$ß¶yQ>a CnH$aU Ed§ H§$ß¶yQ>a gmâQ>do¶a H$s à¶moJZr¶Vm g‘mZ hmoVr h¡ & Bg{bE Bg Vah Ho$ nwZ: dJuH$aU Ho$ H$maU BZ n[ag§n{Îm¶m| Ho$ ‘wë¶ na {H$gr Vah H$m à^md Zht n‹S>Vm &

Note: *Moisture Meter and Micronaire Testers were included in the Lab Equipments in earlier year. The same have been reclassified as separate item for better disclosure.

** Computer Software such as operating systems, MS Office etc. were earlier classified as Intangible Assets. These software are essential for the company and are linked with specific computer system, hence for better disclosure the same have been reclassified under Computer Equipments. Since, the useful life of Computer Equipments and Computer Software are similar therefore, there is no significant financial impact on carrying value of assets due to such reclassification.

116


117


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

(ê$n`o

bmI

‘|)

/ (

Rs.

in la

kh)

bmJV

/ S

>råS>

bmJV

Cos

t / D

eem

ed C

ost

’«$shmoëS> ^y{‘ Land Freehold

brOhmoëS> ^y{‘ Land Leasehold

’«$shmoëS> ^dZ Building Freehold

brOhmoëS> ^dZ Building Leasehold

E¶a H§$S>reZ ßbm§Q> Air condition Plant

{dÚwV g§ñWmnZ {bâQ> Ed§ EbrdoQ>g©

Electrical installation Lifts and Elevators

à¶moJembm CnH$aU Lab Equipment

‘moBñMa ‘rQ>a E§S> ‘m¶H«$moZo¶a Q>oñQ>a

Moisture Meter and Micronnair Testers

H§$ß¶yQ>a CnH$aU Computer Equipments

’$ZuMa Ed§ {’$ŠñMg© Furniture and Fixtures

dmhZ Vehicles

H$m¶m©b¶ CnH$aU Ofice Equipments

Hw$b Total

01.0

4.20

16 H

$mo S>r

åS>

bmJV

Dee

med

Cos

t as

at

01.0

4.20

16

12

6.23

59.3

2

983.

51

88

.03

13

.83

103

.15

51.

38

8.5

0 2

85.0

9 9

1.12

152.

28

57.

17

2,0

19.6

1

- A{V

[aº$

/ -

Addi

tions

-

- -

- -

15.

38

0.4

8 3

.01

42.

80

8.7

7 6

.44

56.

80

133

.68

- {Zn

Q>mZ

/ g

‘m¶m

oOZ

-Dis

posa

l/ Ad

just

men

t -

0.0

1 -

0.8

4 0

.01

1.2

1 2

.51

4.5

8

01.0

4.20

17 H

$mo gH$b

H¡$[a¨J

‘yë¶

Gro

ss C

arrin

g va

lue

as a

t 01

.04.

2017

126.

23

59

.32

98

3.51

88.0

3

13.8

3 1

18.5

3 5

1.85

1

1.51

3

27.0

5 9

9.88

157.

51

111

.46

2,1

48.7

1

-A{V

[aº$

/ -

Addi

tions

-

- -

- -

- 0

.07

3.9

3 2

3.30

2

0.67

2

7.95

1

8.05

9

3.97

- {Zn

Q>mZ

/ g

‘m¶m

oOZ

-D

ispo

sal/

Adju

stm

ent

- -

- -

- -

0.0

7 0

.20

0.9

5 1

.55

3.0

2 4

.49

10.

28

- {d

H«$s H

o$ {bE

{Z¶m

o{OV

g§n{

Îm H$m ñ

WmZ

m§VaU

**

-Tra

nsfe

r to

Asse

t Hel

d fo

r Sal

e **

-

- 2

4.38

-

- -

- -

- -

- -

24.

38

31.0

3.20

18 H

$mo gH$b

H¡$[a¨J

‘yë¶

Gro

ss C

arrin

g va

lue

as a

t 31

.03.

2018

126.

23

59

.32

95

9.13

88.0

3

13.8

3 1

18.5

3 5

1.85

1

5.24

3

49.4

0 1

19.0

0

182.

44

12

5.02

2

,208

.02

- A{V

[aº$

/ -A

dditi

ons

- -

0.3

8 -

- -

135.

57

124

.09

217

.61

8.7

4 1

1.55

1

7.13

5

15.0

7

- {dH

«$s Ho$ {b

E {Z

¶mo{O

V g§n{

Îm H$m ñ

WmZ

m§VaU

**

-Tra

nsfe

r fro

m A

sset

Hel

d fo

r Sal

e **

-

- 2

4.38

-

- -

- -

- -

- -

24.

38

116


117


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

(ê$n`o

bmI

‘|)

/ (

Rs.

in la

kh)

g§{M

V ‘yë

¶õmg

Acc

umul

ate

Dep

reci

atio

n

’«$shmoëS> ^y{‘ Land Freehold

brOhmoëS> ^y{‘ Land Leasehold

’«$shmoëS> ^dZ Building Freehold

brOhmoëS> ^dZ Building Leasehold

E¶a H§$S>reZ ßbm§Q> Air condition Plant

{dÚwV g§ñWmnZ {bâQ> Ed§ EbrdoQ>g©

Electrical installation Lifts and Elevators

à¶moJembm CnH$aU Lab Equipment

‘moBñMa ‘rQ>a E§S> ‘m¶H«$moZo¶a Q>oñQ>a

Moisture Meter and Micronnair Testers

H§$ß¶yQ>a CnH$aU Computer Equipments

’$ZuMa Ed§ {’$ŠñMg© Furniture and Fixtures

dmhZ Vehicles

H$m¶m©b¶ CnH$aU

Ofice Equipments

Hw$b Total

01.0

4.20

16 H

$mo g§{M

V ‘yë

¶ömg

Ac

cum

ulat

ed d

epre

ciat

ion

as a

t 01.

04.2

016

- -

- -

- -

- -

- -

- -

- ‘yë

¶ömg

/ D

epre

ciat

ion

- 0

.83

20.

60

1.1

6 -

13.

89

29.1

2 1

.59

117

.39

18.

19

24.8

1 19

.37

246.

95

{ZnQ

>mZ /

g‘m

¶moOZ

Dis

posa

l/ Ad

just

men

t 0

.45

0.4

5 01

.04.

2017

H$mo

g§{M

V ‘yë

¶ömg

Ac

cum

ulat

ed d

epre

ciat

ion

as a

t 01.

04.2

017

- 0

.83

20.

60

1.1

6 -

13.

89

29

.12

1.5

9 1

17.3

9 1

8.19

24.8

1

18.9

2

246.

50

‘yë¶ö

mg /

Dep

reci

atio

n -

0.8

3 1

9.95

1

.16

- 1

4.79

3

.98

4.0

4 7

4.62

1

6.13

21

.21

22.7

1 17

9.42

{ZnQ

>mZ /

g‘m

¶moOZ

Dis

posa

l/ Ad

just

men

t -

- 0

.65

- -

- -

- (1

.59)

0.3

0

(7.2

6) 0

.01

(7.8

9)31

.03.

2018

H$mo

g§{M

V ‘yë

¶ömg

Accu

mul

ated

dep

reci

atio

n as

at 3

1.03

.201

8 -

1.6

6 3

9.90

2

.32

- 2

8.68

33.1

0 5

.63

19

3.60

3

4.02

53.2

8

41.6

2

433.

81

- {Zn

Q>mZ/

g‘m

¶moOZ

-Dis

posa

l/ Ad

just

men

t -

- -

- -

- 5

.94

- 3

.94

0.8

3 1

0.25

7

.36

28.

32

31.0

3.20

19 H

$mo gH$b

H¡$[a¨J

‘yë¶

Gro

ss C

arrin

g va

lue

as a

t 31

.03.

2019

126.

23

59

.32

98

3.89

88.0

3

13.8

3 1

18.5

3

181.

48

139

.33

563

.07

126

.91

18

3.74

134.

79

2,7

19.1

5

118


119


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

‘yë¶ö

mg /

Dep

reci

atio

n -

0.8

3 2

0.60

1

.16

- 1

4.79

4

.57

133

.67

84.

91

16.

25

22

.45

22

.95

322.

18

{ZnQ

>mZ /

g‘m

¶moOZ

Dis

posa

l/ Ad

just

men

t -

- (1

.30)

- -

-

(0.8

4) -

2.5

3 0

.42

9.9

8 4

.18

14.

97

31.0

3.20

19 H

$mo g§{M

V ‘yë

¶ömg

Ac

cum

ulat

ed d

epre

ciat

ion

as a

t 31.

03.2

019

- 2

.49

61.

80

3.4

8 -

43.

47

38

.51

139

.30

27

5.98

4

9.85

65.7

5

60.3

9

741.

02

ZmoQ>

2 (I

)- n

y±OrJ

V H$

m¶© à

J{V

na /

not

e 2

(B) -

cap

ital W

ork

in P

rogr

ess

(ê$n`o

bmI

‘|)

/ (

Rs.

in la

kh)

{dda

UPa

rticu

lars

201

8-19

2

017-

18

201

6-17

01 Aà¡b, 2018 H$mo eof Balance as at April 1, 2018

df© Ho$ Xm¡amZ A{V[aº$/g‘m¶moOZ Additions/

Adjustments during the year

df© Ho$ Xm¡amZ ny±OrH$aU Capitalized

during the year

31 ‘mM©, 2019 H$mo eof Balance as at

March 31, 2019





during the year


March 31, 2018





during the year


March 31, 2017

’«$shmoë

S> ^d

ZBu

ildin

g (fr

eeho

ld)

1.7

4 9

.06

- 1

0.80

-

1.7

4 -

1.7

4 -

- -

-

à¶moJemb

m CnH

$aU

Lab

Equi

pmen

t -

- -

- -

- -

1.7

7 -

1.7

7 -

Hw$b/

Tota

l 1

.74

9.0

6 -

10.

80

- 1

.74

- 1

.74

1.7

7 -

1.7

7 -

118


119


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 2 (J) - {~H«$s Ho$ {bE n[ag§n{Îm H$m dJuH$aU / Note 2 (C) - Assets classified as held for sale(ê$n`o bmI ‘|) / (Rs. in lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo

As at 31st March,

2019

{ddaU Particulars

31 ‘mM©, 2018 H$mo

As at 31st March,

2018

{ddaU Particulars

01 Aà¡b, 2017 H$mo

As at 1st April,

2017

01.04.2018 H$mo gH$b H¡$[a¨J am{e Gross Carrying amount as at 01.04.2018 24.38

01.04.2017 H$mo gH$b H¡$[a¨J am{e Gross Carrying amount as at 01.04.2017 -

01.04.2016 H$mo gH$b H¡$[a¨J am{eGross Carrying amount as at 01.04.2016 -

A{V[aº$ / Additions

-

^dZ go ñWmZm§V[aV (’«$shmoëS>) **

Transferred from Building (Freehold) ** 24.38

^dZ go ñWmZm§V[aV (’«$shmoëS>)Transferred from Buildings -

^dZ ‘| ñWmZm§V[aV (’«$shmoëS>)**

Transferred to Building (Freehold)** 24.38

{ZnQ>mZ / Disposals

-

{ZnQ>mZ / Disposals -

31.03.2019 H$mo gH$b H¡$[a¨J ‘yë¶ Gross Carrying value as on 31.03.2019 -

31.03.2018 H$mo gH$b H¡$[a¨J ‘yë¶ Gross Carrying value as on 31.03.2018 24.38

31.03.2018 H$mo gH$b H¡$[a¨J ‘yë¶Gross Carrying value as on 31.03.2018 -

01.04.2018 H$mo g§{MV ‘yë¶ömgAccumulated depreciation as at 01.04.2018 1.30

01.04.2017 H$mo g§{MV ‘yë¶ömg Accumulated depreciation as at 01.04.2017 0.65

01.04.2016 H$mo g§{MV ‘yë¶ömg Accumulated depreciation as at 01.04.2016 -

A{V[aº$ / Additions - A{V[aº$ / Additions 0.65 A{V[aº$ / Additions -

{ZnQ>mZ / Disposals 1.30 {ZnQ>mZ / Disposals - {ZnQ>mZ / Disposals -


31.03.2018 H$mo g§{MV ‘yë¶ömgAccumulated depreciation as at 31.03.2018 1.30


31.03.2019 H$mo ewÕ H¡$[a¨J ‘yë¶ Net Carrying value as on 31.03.2019 -

31.03.2018 H$mo ewÕ H¡$[a¨J ‘yë¶ Net Carrying value as on 31.03.2018 23.08

01.04.2017 H$mo ewÕ H¡$[a¨J ‘yë¶ Net Carrying value as on 01.04.2017 -

ZmoQ> : **{dÎmr¶ df© 2017-18 Ho$ Xm¡amZ ‘w§~B© ‘| pñWV Xmo Amdmgr¶ âb¡Q>m| H$mo ~oMZo H$m {ZU©¶ {b¶m J¶m (31.03.2018 H$mo Hw$b {Zdb ‘yë¶ 23.08 bmI ê$n¶o & My±{H$ Amdmgr¶ âb¡Q> Imbr Zht Wo Bg{bE {ZXoeH$ ‘§S>b Zo BZ g§n{Îm¶m| H$mo ~oMZo H$m {ZU©¶ Zht {b¶m Am¡a VX²Zwgma {Oggo dh g§~§{YV h¡ n[ag§n{Îm dJ© Ho$ AZwgma Cgo AZmdVu n[ag§n{Îm Ho$ ê$n ‘| nwZ: dJuH¥$V {H$¶m J¶m &

Note : **During FY 2017-18, it was decided to sell two residential flats situated at Mumbai (Net carrying value is Rs. 23.08 lakh as at 31.03.2018). As the residential flats were occupied, the Board of Directors decided not to sale these properties and accordingly the same is reclassified as non current assets accordance to the class of asset that it belongs to.

120


121


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 3 - {Zdoe g§n{Îm / note 3 - investment Properties (ê$n`o bmI ‘|) / (Rs. in lakh)

ewÕ H¡$[a¨J ‘yë¶ Net Carrying Value

31 ‘mM©, 2019 H$moAs at

31st March, 2019

31 ‘mM©, 2018 H$moAs at

31st March, 2018

01 Aà¡b, 2017 H$mo As at

1st April, 2017

brOhmoëS> ^y{‘ / Land Leasehold 162.07 164.77 167.47

’«$shmoëS> ^dZ / Building Freehold 2,460.16 2,517.16 2,574.16

brOhmoëS> ^dZ / Building Leasehold 88.49 89.70 90.91

aobdo gmBqS>J / Railway Sidings 19.02 19.02 19.02

Hw$b / Total 2,729.74 2,790.65 2,851.56

(ê$n`o bmI ‘|) / (Rs. in Lakh)

bmJV VWm S>råS> bmJVCost and Deemed Cost

brOhmoëS> ^y{‘Land

Leasehold

’«$shmoëS> ^dZBuilding Freehold

brOhmoëS> ^dZ Building

Leasehold

aobdo gmBqS>J Railway Sidings

Hw$b Total

01.04.2016 H$mo gH$b H¡$[a¨J ‘yë¶Gross Carring value as at 01.04.2016 170.17 2,631.16 92.12 19.02 2,912.47

- A{V[aº$ / -Additions - - - - -

- {ZnQ>mZ / g‘m¶moOZ -Disposal/ Adjustment - - - - -



- {ZnQ>mZ / g‘m¶moOZ-Disposal/ Adjustment - - - - -

31.03.2018 H$mo gH$b H¡$[a¨J ‘yë¶ Gross Carring value as at 31.03.2018 170.17 2,631.16 92.12 19.02 2,912.47


- {ZnQ>mZ / g‘m¶moOZ-Disposal/ Adjustment - - - - -


120


121


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

(ê$n`o bmI ‘|) /(Rs. in lakh)

g§{MV ‘yë¶ömg Accumulate Depreciation

brOhmoëS> ^y{‘Land

Leasehold

’«$shmoëS> ^dZBuilding Freehold

brOhmoëS> ^dZ Building

Leasehold

aobdo gmBqS>J Railway Sidings

Hw$b Total

01.04.2016 H$mo g§{MV ‘yë¶ömg Accumulated depreciation as at 01.04.2016 - - - - -

‘yë¶ömg / Depreciation 2.70 57.00 1.21 - 60.91

{ZnQ>mZ / g‘m¶moOZDisposal/ Adjustment - - - -

01.04.2017 H$mo g§{MV ‘yë¶ömg Accumulated depreciation as at 01.04.2017 2.70 57.00 1.21 - 60.91


{ZnQ>mZ / g‘m¶moOZ Disposal/ Adjustment - - - - -

31.03.2018 H$mo g§{MV ‘yë¶ömgAccumulated depreciation as at 31.03.2018 5.40 114.00 2.42 - 121.82


{ZnQ>mZ / g‘m¶moOZ Disposal/ Adjustment - - - - -

31.03.2019 H$mo g§{MV ‘yë¶ömg Accumulated depreciation as at 31.03.2019 8.10 171.00 3.63 - 182.73

{Zdoe g§n{Îm¶m| Ûmam bm^ VWm hm{Z Ho$ {bE Xr JB© ‘mÝ¶Vm : Amounts recognized in Profit and Loss for Investment properties

(ê$n`o bmI ‘|) / (Rs. in lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$moAs at

31st March, 2019

31 ‘mM©, 2018 H$moAs at

31st March, 2018


1st April, 2017

{H$am¶o go Am¶ / Rental Income 877.38 858.51 700.58 àmnQ>u na àË¶j n[aMmbZ ì¶¶, Omo {H$am¶o H$s Am¶ H$mo OZaoQ> H$aVm h¡ / Direct Operating expenses on properties that generated rental income 57.24 69.38 38.03 àmnQ>u na àË¶j n[aMmbZ ì¶¶, Omo {H$am¶o H$s Am¶ H$mo OZaoQ> Zht H$aVm h¡ / Direct Operating expenses on properties that did not generate rental income 4.08 5.83 5.53 ‘yë¶ömg go nhbo {Zdoe JwUm| go bm^ Profit from Investment properties before depreciation 816.06 783.30 657.02 ‘yë¶ömg / Depreciation 60.91 60.91 60.91 {Zdoe JwUm| go bm^ / Profit from Investment Properties 755.15 722.39 596.11

122


123


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

{Zdoe Ho$ àH$Q>rH$aU H$m C{MV ‘yë¶ / Fair Value Disclosure of Investment

{Zdoe g§n{Îm¶m| H$mo {ZåZ{bpIV bmJV ‘m°S>b ‘| ‘yë¶m§{H$V {H$¶m J¶m & H§$nZr Zo AnZo {Zdoe g§n{Îm¶m| H$m ñdV§Ì ê$n go ‘yë¶m§H$Z H$am¶m Am¡a ñdV§Ì Ed§ AZw‘mo{XV ‘yë¶m§H$H$m| Ûmam {H$E JE ‘yë¶m§H$Z Ho$ AmYma na CgH$m C{MV ‘yë¶ {ZYm©[aV {H$¶m & C{MV ‘yë¶ H$m {ZYm©aU ~mOma ‘yë¶ Ho$ VwbZmË‘H$ AmYma na {H$¶m J¶m & ñdV§Ì ‘yë¶m§H$Z {ZYm©[aV {Zdoe g§n{Îm¶m| H$m C{MV ‘yë¶ {ZåZmZwgma h¢ :

The investment properties have been measured following cost model. The company has obtained independent valuations for its investment properties and fair values have been arrived on the basis of valuation carried out by independent approved valuers. The fair value has been determinied using the comparable market approach. Fair value of invesment properties determined by independent valuers are as follows:

(ê$n`o bmI ‘|) /(Rs. in lakh)

na {Zdoe g§n{Îm Investment Property at

g§n{Îm¶m| H$m dJuH$aU Classification of

Property

31 ‘mM©, 2019 H$moAs at

31st March, 2019

31 ‘mM©, 2018 H$moAs at

31st March, 2018


1st April, 2017

H$mobH$mVm / Kolkata H$m¶m©b¶ n[aga Office Premises 442.17 442.17 416.16

B§Xm¡a / Indore H$m¶m©b¶ n[aga Office Premises 397.78 391.60 373.77

{gagm / Sirsa H$m¶m©b¶ n[aga Office Premises 42.43 39.31 40.20

gr~rS>r ~obmnwa, Zdr ‘w§~B©CBD Belapur, Navi Mumbai

H$m¶m©b¶ n[aga Office Premises

4,876.49 4,686.60 4,482.77

H$b§~mobr / Kalamboli JmoXm‘ / Warehouse 14,497.47 13,933.72 13,289.34

ZmoQ> 4 : A‘yV© n[ag§n{Îm`m± /note 4 : intangible Assets(é. bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo

As at 31st March,

2019

{ddaU Particulars

31 ‘mM©, 2018 H$mo

As at 31st March,

2018

{ddaU Particulars

01 Aà¡b, 2017 H$mo

As at 1st April,

2017




A{V[aº$ / Additions - A{V[aº$ / Additions 0.44 A{V[aº$ / Additions - {ZnQ>mZ / Disposals 1.19 {ZnQ>mZ / Disposals - {ZnQ>mZ / Disposals - 31.03.2019 H$mo g§{MV ‘yë¶ömg Gross Carrying value as on 31.03.2019 0.44

31.03.2018 H$mo g§{MV ‘yë¶ömg Gross Carrying value as on 31.03.2018 1.62

31.03.2017 H$mo g§{MV ‘yë¶ömg Gross Carrying value as on 31.03.2017 1.19

122


123


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.




A{V[aº$ / Additions 0.37 A{V[aº$ / Additions 0.54 A{V[aº$ / Additions 0.40 {ZnQ>mZ / Disposals 1.19 {ZnQ>mZ / Disposals - {ZnQ>mZ / Disposals - 31.03.2019 H$mo g§{MV ‘yë¶ömg Accumulated depreciation as at 31.03.2019 0.12






ZmoQ> : H§$ß¶yQ>a gmâQ>do¶a Am°naoqQ>J {gñQ>‘ E‘Eg Am{’$g Am{X H$m nyd© ‘| {ZpîH«$¶ n[ag§n{Îm Ho$ ê$n ‘| dJuH¥$V {H$¶m J¶m h¡ & ¶h gmâQ>do¶a H§$nZr Ho$ {bE A{Zdm¶© h¡ Am¡a {deof H§$ß¶yQ>a {gñQ>‘ go qbH$ h¡ & AV: BZH$m ~ohVa ê$n go g‘má {H$¶m OmZm H§$ß¶yQ>a CnñH$a Ho$ A§VJ©V nwZ: dJuH¥$V {H$¶m J¶m h¡ & My±{H$ H§$ß¶yQ>a CnñH$a Ed§ H§$ß¶yQ>a gmâQ>do¶a H$m C{MV à¶moJ g‘mZ {ZYm©[aV hmoVm h¡ & Bg{bE Bg Vah Ho$ dJuH$aU Ho$ H$maU n[ag§n{Îm¶m| Ho$ ‘yë¶ na H$moB© {deof à^md Zht n‹S>Vm &

H§$nZr Zo {dÎmr¶ df© 2011-12 Ho$ Xm¡amZ B§Q>aàmBO [agmog© ßbm°qZJ (B©Amanr) àUmbr bmJy {H$¶m, Omo {dÎmr¶ df© 2014-15 VH$ nyU© ê$n go A‘yV© h¡ & VWm{n H§$nZr A^r ^r Bg Vah Ho$ B©Amanr {gñQ>‘ H$m à¶moJ H$a ahr h¡ &

Note : Computer Software such as operating systems, MS Office etc. were earlier classified as Intangible Assets. These software are essential for the company and are linked with specific computer system, hence for better disclosure the same have been reclassified under Computer Equipments. Since, the useful life of Computer Equipments and Computer Software are similar therefore, there is no significant financial impact on carrying value of assets due to such reclassification. The Company has implemented the Enterprise Resource Planning (ERP) system in the F.Y. 2011-12 which is fully amortized till F.Y. 2014-15. However, the company is still using such ERP system.

124


125


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 5 : {Zdoe / note 5 : investments (é. bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018

01 Aà¡b, 2017 H$mo As at 01st April, 2017

H$. J¡a Mmby / A. Non current

B{¹$Q>r B§ñQ´`y‘|Q²g ‘| {Zdoe (J¡a-CÕ¥V) lnvestment in Equity instrument (Unquoted) 5.00 5.00 5.00

KQ>mB`o : {Zdoe Ho$ ‘yë` ‘| j{V less : Impairment in value of investment (4.99) (4.99) (4.99)

¶moJ (H$) / Total (A) 0.01 0.01 0.01

I. Mmby / B. Current B{¹$Q>r B§ñQ´`y‘|Q²g ‘| {ZdoeInvestment in Equity Instruments - - -

Hw$b (H$+I) Total (A+B) 0.01 0.01 0.01

{Zdoe Ho$ ‘yë¶ H$s H$‘r ‘| AnZmB© JB© à{H«$¶m / Movement in impairment in value of investment (é. bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


df© Ho$ Ama§^ ‘| eofBalance at the beginning of the year (4.99) (4.99) (4.99)

df© Ho$ Xm¡amZ ‘mZr JB© hm{Z¶m|/àmdYmZ Impairment losses/ provision during the year recognized - - -

df© Ho$ Xm¡amZ ~Å>o ImVo ‘| S>mbr JB© am{e Amount written off during the year - - -

df© Ho$ Xm¡amZ dgyb H$s JB© am{eAmounts recovered during the year - - -

df© Ho$ A§V ‘| eof / Balance at the end of the year (4.99) (4.99) (4.99)

ZmoQ> 6 H$ : ì`mnma àmß` / note 6 A : trade Receivables (é. bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


J¡a-Mmby / NON-CURRENT

g§~§{YV nm{Q©>`m| go ì`mnma àmß`Trade Receivables from related parties

gwa{jV, emoÜ` ‘mZo JE Seceured, considered Good

- - -

124


125


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

Agwa{jV, emoÜ` ‘mZo JE Unsecured, considered good

- - -

g§{X½Y / Doubtful - - -

KQ>mB©E- g§{X½Y F$Um| H$s ñdrH$m`©Vm Less : Allowences for doubtful debts

- - -

Cn-`moJ / Sub-Total - - -

AÝ` ì`mnma àmß` /Other Trade Receivables

H$) gwa{jV, emoÜ` ‘mZo JE a) Secured, considered Good

- - -

I) Agwa{jV, emoÜ` ‘mZo JEb) Unsecured, considered good

- - -

J) g§{X½Y / c) Doubtful 1,371.36 1,462.46 1,794.59

KQ>mB©E : g§{X½Y F$Um| H$s ñdrH$m`©Vm Less : Allowances for doubtful debts (1,371.36) (1,462.46) (1,794.59)

Cn-`moJ / Sub-Total - - -

Hw$b (H$) / Total (A) - - -

ZmoQ> 6 I : ì`mnma àmß` / note 6 B : trade Receivables (é. bmI ‘|) / (Rs. in Lakh)

Mmby CURRENT

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


g§~§{YV nm{Q©>`m| go àmß` ì`mnma Trade Receivable from releted parties - - -

gwa{jV, emoÜ` ‘mZo JE / Secured, considered Good - - -

Agwa{jV, emoÜ` ‘mZo JE Unsecured, considered Good 6,853.83 5,524.89 2,833.12

g§{X½Y / Doubtful - - -

KQ>mB©E- g§{X½Y F$Um| H$s ñdrH$m`©Vm Less : Allowances for doubtful debts - - -

Cn-`moJ / Sub-Total 6,853.83 5,524.89 2,833.12

AÝ` ì`mnma àmß` / Other trade Receivable H$) gwa{jV, emoÜ` ‘mZo JE a) Secured, considered Good - - -

I) Agwa{jV, emoÜ` ‘mZo JE b) Unsecured, considered Good 41.49 579.97 446.12

J) g§{X½Y / c) Doubtful - - -

KQ>mB©E- g§{X½Y F$Um| H$s ñdrH$m`©Vm Less : Allowences for doubtful debts - - -

Cn-`moJ / Sub-Total 41.49 579.97 446.12

Hw$b (I) / Total (B) 6,895.32 6,104.86 3,279.24

126


127


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

AemoÜ¶ g§{X½Y F$Um| H$s ñdrH$m¶©Vm ‘| AnZmB© JB© à{H«$¶m: / Movement in allowances for doubtful debt:

(é. bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


df© Ho$ Ama§^ ‘| eofBalance at the beginning of the year 1,462.46 1,794.59 1,789.03

df© Ho$ Xm¡amZ ‘mZr JB© hm{Z¶m|/àmdYmZImpairment losses/ provision during the year recognized - 1.56 5.56

df© Ho$ Xm¡amZ ~Å>o ImVo ‘| S>mbr JB© am{eAmount written off during the year 81.08 - -

df© Ho$ Xm¡amZ dgyb H$s JB© am{eAmounts recovered during the year 10.02 333.69 -

df© Ho$ A§V ‘| eof / Balance at the end of the year 1,371.36 1,462.46 1,794.59

ZmoQ> 7$ : F$U / note 7 : loans (é. bmI ‘|)/ (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo31st March 2019

31 ‘mM©, 2018 H$mo31st March 2018

01 Aà¡b 2017 H$mo1st April 2017

MmbyCurrent

J¡a-MmbyNon-

Current

MmbyCurrent

J¡a-MmbyNon-

current

MmbyCurrent

J¡a-MmbyNon-

current

(A) gwa{jV (emoÜ` ‘mZo JE)(a)Secured (considered good)

g§~§{YV nm{Q©>`m|/{ZXoeH$m| H$mo {XE JE F$U Loans to Related Parties/Directors - - 4.24 - 5.76 4.24

H$‘©Mm[a`m| H$mo {XE JE F$U / Loans to Employees 35.43 181.48 43.87 210.32 49.53 232.10

AÝ` /Others

Cn-`moJ (H$) / Sub-Total (a) 35.43 181.48 48.11 210.32 55.29 236.34

(I) Agwa{jV (emoÜ` ‘mZo JE)(b) Unsecured (Considered good)

g§~§{YV nm{Q©>`m|/{ZXoeH$m| H$mo {XE JE F$ULoans to Related Parties/Directors - - - - - -

H$‘©Mm[a`m| H$mo {XE JE F$U /Loans to Employees 43.87 45.99 46.54 66.15 49.97 69.68

AÝ` / Others

Cn-`moJ (I) / Sub- Total (b) 43.87 45.99 46.54 66.15 49.97 69.68

(J) Agwa{jV (g§{X½Y) (C) Unsecured (doubtful)

{ZXoeH$m| H$mo {XE JE F$U / Loans to Directors - - - - - -

H$‘©Mm[a`m| H$mo {XE JE F$U / Lans to Employees - 1.25 - 1.25 - 1.25

126


127


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

AÝ` H$mo {XE JE F$U Ed§ A{J«‘ Others Loans and Advance - 5.84 - 19.67 - 19.67

KQ>mB`o : emoÜ` g§{X½Y F$Um| H$s ñdrH$m`©VmLess : Allowance for bad and doubtful loans - (7.09) - (20.92) - (20.92)

Cn-`moJ (J) / Sub-Total (C) - - - - - - Hw$b (H$+I+J) / Total (a+b+c) 79.30 227.47 94.65 276.47 105.26 306.02

ZmoQ> : à~§YZ Ho$ erf© H$m{‘©H$m| Ed§ AÝ¶ H$‘©Mm[a¶m| H$mo {X¶o J¶o àñVwVrH$aU Am¡a A{J«‘ ~mOma Xa na h¢ Bgr{bE Eogo F$U Ed§ A{J«‘ am{e CZHo$ C{MV ‘yë¶ Ho$ ~am~a h¡ & {ZYm©aU à^md Ho$ ê$n ‘| nyd© dfu¶ S>rEEnr ‘yë¶ na AÝ¶ H$‘©Mm[a¶m| H$mo {X¶o J¶o Agwa{jV F$U H$m H$moB© ‘hÎd Zhr§ h¡ & F$U Ed§ Cgna ã¶mO Ho$ nwZ: ^wJVmZ ‘| MyH$ H$m H$moB© nyU© {ddaU Zht h¡ & AV: àË¶m{eV H«o${S>Q> hm{Z H$mo {ZYm©[aV Zht {H$¶m Om gH$Vm h¡ &

Note :

Secured loans and advances given to key management personnel and other employees are at market rate, therefore the carrying amount of such loans and advances are equal to their fair value. Unsecured loans to other employees continue to be carried at previous GAAP value as measurement impact is immaterial. There is no history of default in repayment of loan and interest thereupon, hence, expected credit loss is not recognized.

AemoÜ¶ g§{X½Y F$Um| H$s ñdrH$m¶©Vm ‘| AnZmB© JB© à{H«$¶m: / Movement in allowances for doubtful debt:


{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


df© Ho$ Ama§^ ‘| eofBalance at the beginning of the year 20.92 20.92 49.62

df© Ho$ Xm¡amZ ‘mZr JB© hm{Z¶m|/àmdYmZImpairment losses/ provision during the year recognized - - -

df© Ho$ Xm¡amZ ~Å>o ImVo ‘| S>mbr JB© am{eAmount written off during the year 4.78 - -

df© Ho$ Xm¡amZ dgyb H$s JB© am{eAmounts recovered during the year 9.05 - 16.43

AÝ¶ g‘m¶moOZ * / Other Adjustment* - - 12.27

df© Ho$ A§V ‘| eof / Balance at the end of the year 7.09 20.92 20.92

ZmoQ> : *nyd© 12.27 bmI ê$. ‘| g§{X½Y F$U A{J«‘ H$mo (g§{X½Y F$U àmdYmZ ‘| em{‘b {H$¶m J¶m h¡) BgHo$ ~ohVa àH$Q>rH$aU Ho$ {bE Bgo g§{X½Y A{J«‘ Ho$ ê$n ‘| nwZ: dJuH¥$V {H$¶m J¶m h¡ &

Note : * Provision towards doubtful advance of Rs. 12.27 lakh earlier included in doubtful loans. The same has been reclassified as doubtful advances for better disclosure.

128


PB


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 8 : AÝ` {dÎmr` n[ag§n{Îm`m± / note 8 : other financial Assets (é. bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo31st March 2019

31 ‘mM©, 2018 H$mo31st March 2018

01 Aà¡b 2017 H$mo 1st April 2017

Mmby Current

J¡a-Mmby Non-

Current

Mmby Current

J¡a-Mmby Non-

current

Mmby Current

J¡a-Mmby Non-

current

12 ‘hrZo go A{YH$ n[anŠdVm dmbo ~¢H$ {S>nm{OQ²gBank Deposits with more than 12 months maturity - - - - - -

^maV gaH$ma go àmß¶ E‘Egnr hm{ZMSP Losses Receivable from Government of India 2,55,752.03 - 3,14,452.64 -

2,95,480.40 -

ì¶mnma àmß¶ Ho$ A{V[aº$ AÝ¶ àmß¶Receivables Other Than Trade Receivables 201.29 - 239.60 - 128.51 -

àmß¶ B§í¶moa|g àr{‘¶‘ [a’§$S>$Insurance Premium Refund Receivable 281.79 - 252.02 - 267.36 -

àmß¶ B§í¶moa|g ³boågInsurance Claims Receivable 70.00 - - - - -

CËnÞ Xo`/AXo` ã`mOInterest accrued due/not due on

gmd{Y$ O‘m am{eTerm Deposites - - - - - -

g§~§{YV nm{Q©>`m| H$mo F$ULoan to Related Parties 0.33 - 0.83 - - 0.02

H$‘©Mm[a`m| H$mo F$U / Loan to Employees 15.55 177.75 17.84 171.32 18.72 174.23

AÝ` F$U / Loan to Others - - - - - -

Hw$b / Total 2,56,320.99 177.75 3,14,962.93 171.32 2,95,894.99 174.25

PB


129


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 9 : AmñW{JV H$a n[ag§n{Îm`m§ / Note 9 : Deffered Tax Assets (é. bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo31st March 2019

31 ‘mM©, 2018 H$mo31st March 2018

01 Aà¡b 2017 H$mo 1st April 2017

AmñW{JV H$a Xo`Vm / Deffered Tax Liability

ßbm§Q>, g§n{Îm, CnH$aU, {~H«$s Ho$ {bE aIr JB© g§n{Îm`m§,

{Zdoe g§n{Îm Ed§ A‘yV© g§n{Îm`m§Plant Property Equipments, Assets Held for Sale, Investment Property & Intagible Assets 816.03 845.60 809.63

Cn-`moJ / Sub-Total 816.03 845.60 809.63

AmñW{JV H$a n[ag§n{Îm`m§ / Deffered Tax Asstes

i) hm{Z Am¡a ‘yë`ömg AmJo bm`m J`m i) Carried Forwarded Losses & Depreciation - 1,176.53 -

ii) Am`H$a A{Y{Z`‘ Ho$ A§VJ©V Zm‘§Oyaii) Disallowance Under the Income Tax Act 2,559.26 2,427.24 4,354.91

iii) g§{X½Y F$Um| Ed§ A{J«‘m| Ho$ {bE àmdYmZiii) Provision for Doubtful Debts and advances 479.22 502.91 613.01

iv) {Zdoe ‘yë` ‘| H$‘r Ho$ {bE àmdYmZiv) Provision for Dimnution Value of Investment 1.74 1.73 1.73

v) àmß` ~’$a ñQ>m°H$ hm{Z Ho$ {bE àmdYmZ v) Provision for Buffer Stock losses Receivable 753.79 753.79 746.54

vi) n[a^m{fV bm^ `moOZm Ho$ nwZ: ‘yë`m§H$Zvi) Remeasurements of the defined benefit plans 16.59 81.01 11.59

vii) ‘¡Q> Ho«${S>Q> àmÌVm / vii) MAT Credit Entitlement 2,468.11 2,511.31 2,023.34

Cn-`moJ / Sub-Total 6,278.71 7,454.52 7,751.12

AmñW{JV H$a n[ag§n{Îm`m§ (ewÕ)Deferred Tax Assets (Net) 5,462.68 6,608.92 6,941.49

df© Ho$ Xm¡amZ AmñW{JV H$a eof Ho$ {bE AnZm`r JB© à{H«$`m :Movement in deffered tax balances during the year

(én¶o bmI ‘|)/ (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©,

2018 H$mo eof Balance as at 31st March

2018

bm^ d hm{Z

{ddaUr ‘| em{‘b Recognized in Statement of Profit & Loss

g‘m`moOZ Adjustments

31 ‘mM©,


2019

AmñW{JV H$a Xo`Vm / Deffered Tax Liabilityßbm§Q>, g§n{Îm, CnH$aU, {~H«$s Ho$ {bE aIr JB© g§n{Îm`m§,

{Zdoe g§n{Îm Ed§ A‘yV© g§n{Îm`m§Plant Property Equipments, Assets Held for Sale, Investment Property & Intagible Assets 845.60 (29.57) - 816.03

130


131


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

Cn-`moJ / Sub-Total 845.60 (29.57) - 816.03


i) hm{Z Am¡a ‘yë`ömg AmJo bm`m J`m i) Carried Forwarded Losses & Depreciation 1,176.53 - 1,176.53 -

ii) Am`H$a A{Y{Z`‘ Ho$ A§VJ©V Zm‘§Oyaii) Disallowance Under the Income Tax Act 2,427.24 132.02 - 2,559.26

iii) g§{X½Y F$Um| Ed§ A{J«‘m|Ho$ {bE àmdYmZiii) Provision for Doubtful Debts and advances 502.91 (23.69) - 479.22

iv) {Zdoe ‘yë` ‘| H$‘r Ho$ {bE àmdYmZiv) Provision for Dimnution Value of Investment 1.73 0.01 - 1.74

v) àmß` ~’$a ñQ>m°H$ hm{Z Ho$ {bE àmdYmZ v) Provision for Buffer Stock losses Receivable 753.79 - - 753.79

vi) n[a^m{fV bm^ `moOZm Ho$ nwZ: ‘yë`m§H$Zvi) Remeasurements of the defined benefit plans 81.01 - 64.42 16.59

vii) ‘¡Q> Ho«${S>Q> nmÌVm / vii) MAT Credit Entitlement 2,511.31 (43.20) - 2,468.11

Cn-`moJ / Sub-Total 7,454.52 65.14 1,240.95 6,278.71

AmñW{JV H$a n[ag§n{Îm`m§ (ewÕ)Deferred Tax Assets (Net) 6,608.92 94.71 1,240.95 5,462.68


{ddaU Particulars

1 Aà¡b,

2017 H$mo eof Balance as at

1st April 2017

bm^ d hm{Z {ddaUr ‘| em{‘b Recognized in Statement of Profit & Loss


31 ‘mM©,


2018


ßbm§Q>, g§n{Îm, CnH$aU, {~H«$s Ho$ {bE aIr JB© g§n{Îm`m§,

{Zdoe g§n{Îm Ed§ A‘yV© g§n{Îm`m§Plant Property Equipments, Assets Held for Sale, Investment Property & Intagible Assets 809.63 35.97 - 845.60

Cn-`moJ / Sub-Total 809.63 35.97 - 845.60


i) hm{Z Am¡a ‘yë`ömg AmJo bm`m J`m i) Carried Forwarded Losses & Depreciation - 1,176.53 - 1,176.53

ii) Am`H$a A{Y{Z`‘ Ho$ A§VJ©V Zm‘§Oyaii) Disallowance Under the Income Tax Act 4,354.91 (1,927.67) - 2,427.24


iv) {Zdoe ‘yë` ‘| H$‘r Ho$ {bE àmdYmZiv) Provision for Dimnution in Value of Investment 1.73 - - 1.73

130


131


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

v) àmß` ~’$a ñQ>m°H$ hm{Z Ho$ {bE àmdYmZ v) Provision for Buffer Stock losses Receivable 746.54 7.25 - 753.79

vi) n[a^m{fV bm^ `moOZm Ho$ nwZ: ‘yë`m§H$Zvi) Remeasurements of the defined benefit plans 11.59 69.42 - 81.01

vii) ‘¡Q> Ho«${S>Q> nmÌVm /vii) MAT Credit Entitlement 2,023.34 487.97 - 2,511.31

Cn-`moJ /Sub-Total 7,751.12 (296.60) - 7,454.52

AmñW{JV H$a n[ag§n{Îm`m§ (ewÕ)Deferred Tax Assets (Net) 6,941.49 (332.57) - 6,608.92


{ddaU Particulars

1 Aà¡b,


1st April,2016

bm^ d hm{Z

{ddaUr ‘| em{‘b Recognized in Statement of Profit & Loss


1 Aà¡b,


1st April 2017


ßbm§Q>, g§n{Îm, CnH$aU, {~H«$s Ho$ {bE aIr JB© g§n{Îm`m§, {Zdoe g§n{Îm Ed§ A‘yV© g§n{Îm`m§Plant Property Equipments, Assets Held for Sale, Investment Property & Intagible Assets 805.44 4.19 - 809.63

Cn-`moJ / Sub-Total 805.44 4.19 - 809.63


i) hm{Z Am¡a ‘yë`õmg AmJo bm`m J`m i) Carried Forwarded Losses & Depreciation - - - -

ii) Am`H$a A{Y{Z`‘ Ho$ A§VJ©V Zm‘§Oyaii) Disallowance Under the Income Tax Act 4,710.21 (355.30) - 4,354.91


iv) {Zdoe ‘yë` ‘| H$‘r Ho$ {bE àmdYmZiv) Provision for Dimnution in Value of Investment 1.73 - - 1.73

v) àmß` ~’$a ñQ>m°H$ hm{Z Ho$ {bE àmdYmZ v) Provision for Buffer Stock losses Receivable 746.54 - - 746.54

vi) {Zdoe ‘yë` ‘| H$‘r Ho$ {bE àmdYmZvi) Provision for Diminution in value of investment - 11.59 - 11.59

vii) ‘¡Q> Ho«${S>Q> nmÌVm vii) MAT Credit Entitlement - 2,023.34 - 2,023.34

Cn-`moJ / Sub-Total 6,076.55 1,674.57 - 7,751.12

AmñW{JV H$a n[ag§n{Îm`m§ (ewÕ)Deferred Tax Assets (Net) 5,271.11 1,670.38 - 6,941.49

132


PB


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> : H§$nZr Ho$ nmg 31 ‘mM©, 2019, 31 ‘mM©, 2018 VWm 31 ‘mM©, 2017 na H$moB© ^r A‘mÝ`Vm àmßV ñW{JV H$a n[ag§n{Îm`m§ /

Xo`VmE°§ Zht h¢ &

Note : The Company does not have any Unrecognized Deferred Tax Assets/Liabilities as at 31st March, 2019, 31st

March, 2018 and 31st March, 2017.

ZmoQ> 10 H$- AÝ` J¡a-Mmby n[ag§n{Îm`m§ / Note 10 A - Other Non-Current Assets (én¶o bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


H$. J¡a-Mmby / A. Non-Current

ny±Or A{J«‘ / Capital Advances - - -

KQ>mB©ò: AemoÜ` VWm g§{X½Y A{J«‘m| hoVw ^ÎmoLess: Allowances for bad and Doubtful Advance - - -

ny±Or A{J«‘ Ho$ Abmdm AÝ` A{J«‘Advances other than Capital Advances

- {gŠ`w[aQ>r {S>nm{OQ> / - Security Deposits 165.14 159.97 156.12

- g§~§{YV nm{Q©>`m| H$mo A{J«‘-Advances to related parties - - -

- AÝ` gßbm`©g H$mo A{J«‘-Advances to other suppliers 9.82 - -

- AÝ` A{J«‘ / - Other Advances - - -

KQ>mB©ò : AemoÜ` VWm g§{X½Y A{J«‘m| hoVw ^ÎmoLess : Allowances for bad and Doubtful Advance - - -

AemoÜ` VWm g§{X½Y A{J«‘m| hoVw ^Îmo Allowances for bad and Doubtful Advance - - -

AÝ` dgybr `mo½` / Others recoverable -

- ^m.H$.{Z. J«oÁ¶wQ>r Q´>ñQ> go àmßV- Receivable from CCI Gratuity Trust

- ^m.H$.{Z. nr. E’$. Q´>ñQ> go àmßV- Receivable from CCI PF Trust

- àmßV {~H«$s H$a/doQ> H«o${S>Q>- Sales Tax/VAT credit Receivable 57.51 57.51 57.51

- AÝ¶ àmß¶ / - Other Receivable 2,169.41 2,169.41 2,169.41

KQ>mB©ò : AemoÜ` VWm g§{X½Y A{J«‘m| hoVw ^ÎmoLess : Allowances for bad and Doubtful Advance (2,169.41) (2,169.41) (2,169.41)

Hw$b /Total 232.47 217.48 213.63

ZmoQ> : AÝ¶ àmß¶ ‘| ê$. 2157.14 bmI H$m ~’$a ñQ>m°H$ na ZwH$gmZ em{‘b h¡ ({nN>bo df© 2157.14 bmI) {Q>ßnUr g§. 35 XoI|

Note : Other receivables includes Losses on Buffer Stock Receivables Rs. 2157.14 lakh (previous year 2157.14 lakh). Refer note no. 35.

PB


133


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

g§{X½Y A{J«‘ H$s ñdrH$m¶©Vm ‘| AnZmB© JB© à{H«$¶m : / movement in allowances for doubtful advantage:


{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


df© Ho$ Ama§^ ‘| eofBalance at the beginning of the year 2,169.41 2,169.41 2,157.14

df© Ho$ Xm¡amZ ‘mZr JB© hm{Z¶m± /àmdYmZImpairment losses / provision during the year recognized - - -

df© Ho$ Xm¡amZ ~Å>o ImVo ‘| S>mbr JB© am{eAmount written off during the year - - -


AÝ¶ g‘m¶moOZ* / Other Adjustment* - - 12.27


ZmoQ : *nyd© 12.27 bmI ê$. ‘| g§{X½Y F$U A{J«‘ H$mo (g§{X½Y F$U àmdYmZ ‘| em{‘b {H$¶m J¶m h¡) BgHo$ ~ohVa àH$Q>rH$aU Ho$ {bE Bgo g§{X½Y A{J«‘ Ho$ ê$n ‘| nwZ: dJuH¥$V {H$¶m J¶m h¡ &

Note : *Provision towards doubtful advance of Rs. 12.27 lakh earlier included in doubtful loans. The same has been reclassified as doubtful advances for better disclosure.

ZmoQ> 10 I - AÝ¶ Mmby n[ag§n{Îm¶m§ / note 10 B - other current Assets (én¶o bmI ‘|)/ (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


I. Mmby / B. Current

ny±Or A{J«‘ / Capital Advances

ny±Or A{J«‘ Ho$ Abmdm AÝ` A{J«‘Advances other than Capital Advances

- {gŠ`w[aQ>r {S>nm{OQ> / - Security Deposits 34.95 49.86 62.03

- g§~§{YV nm{Q©>`m| H$mo A{J«‘/ - Advances to related parties - - -

- AÝ` gßbm`g© H$mo A{J«‘/ - Advances to other suppliers - - -

- dgybr ¶mo½¶ AÝ¶ Xmdo / - Claim Recoverable others - - -

- AÝ` A{J«‘ / - Other Advances - - -

KQ>mB©`o : AemoÜ` VWm g§{X½Y A{J«‘m| hoVw ^ÎmoLess : Allowances for bad and Doubtful Advance - - -

AÝ¶ g§n{Îm¶m± / Others Assets

- ^m.H$.{Z. J«oÁ¶wQ>r Q´>ñQ> Ho$ àmßV- Receivable from CCI Gratuity Trust 128.32 363.80 319.41

134


PB


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

- ^m.H$.{Z. nr.E’$. Q´>ñQ> go àmßV- Receivable from CCI PF Trust 200.16 56.20 247.62

- àmßV {~H«$s H$a/doQ> Ho«${S>Q>- Sales Tax/VAT credit Receivable 635.25 850.42 944.70

- Xo¶ godmH$a [a’§$S> / - Service Tax refund due - 0.66 0.66

- OrEgQ>r BZnwQ> Q>¡³g Ho«${S>Q> / - GST Input Tax Credit 11,586.79 6,627.23 -

- AÝ¶ Mmby g§n{Îm¶m± / - Other Current Assets 600.36 349.27 132.10

Hw$b / Total 13,185.83 8,297.44 1,706.52

ZmoQ> -11 : ‘mbgyMr / note 11 : inventories (én¶o bmI ‘|)/ (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


H$ƒm ‘mb / Raw Materials - 1,628.40 -

V¡¶ma ‘mb / Finished Goods - qbQ> / - Lint 2,43,412.89 1,59,483.09 10,785.52

- H$m°Q>Z ~rO / - Cotton Seed 602.55 1,509.56 1,527.87

- dmB©nr /Amanr /Z‘yZm /{‘brOwbr Jm±R>o- YP/RP/Sample/Misc Bales 120.43 47.03 7.60

n¡qH$J gm‘J«r / Packing Materials 3,443.51 5,116.92 5,867.49

Hw$b / Total 2,47,579.38 1,67,785.00 18,188.48

ZmoQ> : H$) 573.47 bmI ê$. H$s (31 ‘mM© 2018 ‘| 2203.46 bmI Ed§ 31 ‘mM© 2016 ‘| 58.99 bmI) {Zdb dgybr ¶mo½¶ ‘yë¶ ‘| ‘yë¶m§{H$V H$s JB© & I) BÝd|Q>ar bm°ñQ> ‘| ’$m¶a Am¡a Jw‘ hþB© ‘mÌm H$s é. 449.15 bmI am{e Wr & (31 ‘mM© 2018 VH$ é. 17.21 bmI Am¡a 1 Aà¡b 2017 VH$ é. 0.70 bmI) Ho$ AZwgma ZmoQ> ~§Xr Ho$ VhV bm^ Am¡a hm{Z Ho$ ~¶mZ ‘| IM© go d§{MV ZmoQ> g§»¶m 24 Am¡a 25 XoI| & J) BÝd|Q>ar H$mo H«o${S>Q> gw{dYm àmá H$aZo Ho$ {bE ~¢H$ H§$gmo{Q©>¶‘ H$mo hmBnmoWoHo$Q>oS> {H$¶m J¶m &

Note :

(a) Inventory amounting to Rs. 573.47 lakh (as at 31st March, 2018 Rs.2203.46 lakh and as at 31st March, 2016 Rs.58.99 lakh) has been valued at Net Realizable Value.(b) Inventory lost in fire/misappropriation amounting to Rs. 449.15 lakh (as at 31st March, 2018 Rs. 17.21 lakh and As at 1st April, 2017 Rs.0.70 lakh) written off and recognized as expense in the Statement of Profit and Loss under note no. 24 and 25.(c) The Inventories are hypothecated to consortium of Banks for availing credit facilities.

PB

^m.H.{Z.

C.C.I.


135


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> -12 : ZH$X VWm ZH$X g‘Vwë` / note 12 cash and equivalent


{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


H$. ZH$X VWm ZH$X g‘H$jA. Cash and Cash Equivalent

hmW ‘| amoH$‹S> / Cash on hand - - -

hmW ‘| CnbãY M¡H²$g, S´>mâQ>gcheques, Drafts, Stamp on hand - - -

~¢H$ ‘| CnbãY eof / Balances with Banks

(E) Mmby ImVo ‘| / (a) in current account* 313.23 1,124.61 171.90

(~r) H¡$e H«o${S>Q> AH$m§CQ> ‘| / (b) in cash credit account** - 280.39 287.54

gmd{YH$ O‘m am{e ‘| {OZH$s ‘yb n[anŠdVm 3 ‘hrZo VH$

H$s h¡In term deposit with origanal maturity upto 3 months - - -

AZw`moJ (E) / Sub total (A) 313.23 1,405.00 459.44

I. CnamoŠV Ho$ Abmdm ~¢H$ eofB. Bank Balances other than above

gmd{YH$ O‘m am{e ‘| {OZH$s ‘yb n[anŠdVm 3 ‘hrZo go

A{YH$ na§Vw 12 ‘hrZo go H$‘ h¡In term deposit with original maturity more than 3 months but less than 12 months* 47.69 44.59 41.90

Cn-`moJ (~r) / Sub Total (B) 47.69 44.59 41.90

Hw$b (H$+I) / Total (A+B) 360.92 1,449.59 501.34

ZmoQ> : *df© 1999 Ho$ Xm¡amZ {d{^Þ {H$gmZm| H$mo H$nmg Ho$ ‘yë` H$m ^wJVmZ Z H$aZo Ho$ ‘m‘bo ‘| Am§Y«m ~¢H$ Ho$ nmg H«$‘e: 0.12 bmI

ê$. ({nN>bo df© 0.12 bmI) VWm 47.68 bmI ê$. ({nN>bo df© 44.58 bmI) em{‘b H$aVo hþE Mmby d gmd{YH$ O‘m ‘| CnamoŠV eof

h¡, Omo qà{gnb gr{Z`a {g{db OO JwÝVya Ûmam Omar AmXoe Ho$ AZwgma brZ Ho$ A§VJ©V h¡ &

**H§$nZr Ho$ nmg 14 bmoH$ CÚ‘ ~¢H$ (nrEg~r) Ho$ H§$gmo{Q©>`‘ ‘| 25000 H$amoS> ê$. H$s F$U gw{dYm CnbãY h¡ & ì`mnma H$s ‘m¡g‘r àH«¥${V

H$mo XoIVo hþE H§$nZr Zo H¡$e H«o${S>Q> {b{‘Q> Ho$ gm‘Zo bKw Ad{Y Ho$ F$U H$mo àmßV H$aZo Ho$ {bE ghmam {b`m h¡ & {XZm§H$ 31 ‘mM©, 2018

H$mo H§$nZr H$m H¡$e H«o${S>Q> ImVo ‘| O‘m eof h¡ &

Note: * The above balances in Current Account and term deposit includes Rs. 0.12 lakh (previous year 0.12 lakh) and Rs. 47.68 lakh (previous year 44.58 lakh) respectively with Andhra Bank which are under lien as per order issued by the Principal Senior Civil Judge, Guntur in the matter of non payment of kapas value to the various farmers during the year 1999.

** The Company has a credit facilities of Rs. 25,000 crores with the consortium of 14 Public Sector Banks (PSB). Looking to the seasonal nature of business, Company availed short term loans in lieu of cash credit limits. As at 31st March, 2018, Company had a credit balance in Cash Credit Account.

136

^m.H.{Z.

C.C.I.


137


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 13 : dV©‘mZ H$a n[ag§n{Îm`m§ / note 13 : current tax Assets (ê$nò bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


Mmby H$a n[ag§n{Îm¶m± / Current Tax Assets 1,562.62 931.54 1,229.44

Hw$b / Total 1,562.62 931.54 1,229.44

ZmoQ> : Mmby Am¶H$a n[ag§n{Îm {Og‘| nmQ>u Ûmam A{J«‘ H$a Am¡a òmoV na H$mQ>o JE H$a em{‘b h¢ & Note: Current Income Tax Assets includes Advance Tax, Tax Deducted by Party.

ZmoQ> 14 : B{¹$Q>r eoà ny±O / note 14 : equity Share capital


{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


àm{YH¥$V / Authorized

àËòH$ 100/- ê$. Ho$ 75,00,000 B{¹$Q>r eo`g©75,00,000 Equity shares of Rupees 100/- each 7,500.00 7,500.00 7,500.00

7,500.00 7,500.00 7,500.00

{ZJ©{‘V, IarXo JE VWm nyU© àXÎmIssued, subscribed and fully paid-up

àËòH$ 100/- ê$. Ho$ 25,00,000 B{¹$Q>r eo`g© nyU© àXÎm25,00,000 Equity Shares of Rupees 100/- fully paid-up 2,500.00 2,500.00 2,500.00

Hw$b / Total 2,500.00 2,500.00 2,500.00

B{¹$Q>r eo¶am| go g§~§{YV ‘m‘bo / A{YH$ma H§$nZr Ho$ nmg B{¹$Q>r eo¶am| H$m Ho$db EH$ dJ© h¡, {Og‘| à{V eo¶a é. 100 H$m ~am~a ‘yë¶

h¡& {ZXoeH$ ‘§S>b Ûmam àñWm{dV bm^m§e AmJm‘r dm{f©H$ Am‘ ~¡R>H$ ‘| eo¶aYmaH$m| H$s ‘§Oyar Ho$ A{YZ h¡ & ZE eo¶am|, eo¶am| Ho$ hñVm§VaU,

ny±Or Ho$ nyZ© ^wJVmZ, Cn{d^mOZ Am¡a eo¶a Ho$ g‘¶H$Z AmXr ^maV Ho$ amï´>nVr ‘hmoX¶ go AZw‘moXZ Ho$ AYrZ h¡ &

Terms / rights attached to equity shares. The Company has only one class of equity shares having a par value of Rs. 100 per share. The dividend proposed by the Board of Directors is subject to the approval of the shareholders in the ensuing Annual General Meeting. Issue of new shares, transfer of shares, repayment of Capital, sub division and consolidation of share etc. are subject to approval of the President of India.

136

^m.H.{Z.

C.C.I.


137


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

eoàm| H$s g§»`m {OZH$m g‘mYmZ {H$`m J`m : / Reconcilliation of number of share :

{ddaU Particulars

31 ‘mM©, 2019 H$mo As at 31st

March, 2019

31 ‘mM©, 2018 H$moAs at 31st

March, 2018


Ama§{^H$ B{¹$Q>r eoà / Opening Equity shares 25,00,000 25,00,000 25,00,000

OmoSo>- df© Ho$ Xm¡amZ eoàm| H$s g§»`m, eoà ny±Or Omar H$s JB©/IarXo JEAdd: No. of shares, shares capital issued/subscribed during the year - - -

KQ>mBò : H$Q>m¡Vr / Less : Deduction - - -

A§{V‘ eof / Closing balance 25,00,000 25,00,000 25,00,000

H§$nZr ‘| Eogo eoà hmoëS>a Ho$ eoàm| H$s g§»`m {OZH$s 5 à{VeV go A{YH$ hmopëS§>J h¡No. of shares in the company held by shareholder holding more than 5 percent

eoà hmoëS>a H$m Zm‘Name of the shareholder

31 ‘mM©, 2019 H$mo As at 31st March, 2019

31 ‘mM©, 2018 H$mo As at 31st March, 2018


g§»¶m bmI ‘| No of Shares

in Lakh

% hmopëS>¨J % holding

g§»¶m bmI ‘| No of Shares

in Lakh


g§»¶m bmI ‘|No of Shares

in Lakh


^maV Ho$ amîQń{VPresident of India 25 100 25 100 25 100

ZmoQ> : {~oZr{’${e`b eoà hmoëS>g© hmoZo Ho$ H$maU 3 eoà (JV df© 3 eoà) ^maV Ho$ amîQń{V Ho$ Zm{‘Zr eo`g© Ûmam Ym[aV {H$E JE h¢}Note : {3 Shares (previous year 3 shares) held by nominee shareholders of the President of India being the beneficial shareholder.}

ZmoQ> 15 : AÝ` B{¹$Q>r / note 15 : other equity


{ddaUParticulars

31 ‘mM©, 201931 March 2019

31 ‘mM©, 2018 31 March 2018

01 Aà¡b, 201701 April, 2017

(i) gm‘mÝ` Ama{jV / (i) General Reserve 2,798.86 2,798.86 2,798.86

(ii) à{VYmaU AO©Z / (ii) Retained Earnings 30,058.13 25,132.99 24,576.98

(iii) Ama{jV ny±Or / (iii) Capital Reserve - - -

(iv) {ZJ{‘V gm‘m{OH$ Xm{`Ëd Ama{jV(iv) Corporate social responsibility reserve - - -

(v) AÝ` Ama{jV / (v) Other Reserves - - -

Hw$b AÝ` B{¹$Q>r / Total Other Equity 32,856.99 27,931.85 27,375.84

138

^m.H.{Z.

C.C.I.


139


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.


{ddaU Particulars

(i) gm‘mÝ`

Ama{jV(i) General Reserve

(ii) à{VYmaU

AO©Z (ii) Retained

Earnings

(iii) Ama{jV

ny±Or (iii) Capital Reserve

(iv) {ZJ{‘V

gm‘m{OH$ Xm{`Ëd

Ama{jV (iv) Corporate

social responsibility

reserve

(v) AÝ`

Ama{jV (v) Other Reserves

01.04.2018 H$mo Ama§{^H$ eof Opening Balance as on 01.04.2018 2,798.86 25,132.99 - - -

df© Ho$ Xm¡amZ ewÕ bm^ Net profit for the year - 5,099.36 - - -

à{VYm[aV AO©Z ‘| grYo ì`mnH$ Am` nhMmZ

H$s AÝ` ‘X|Items of other comprehensive income recognize directly in Retained Earnings - - - - -

H$a Ho$ Xm{¶Ëd bm^ Ho$ ~mX nwZ: ‘mnH$Re-measurements of post benefit obligation net of tax - 162.61 - - -

boIm§H$Z Zr{V ‘| n[adV©Z Ho$ H$maU ñWJZAdjustments due to change in Accounting Policy - - - - -

nyd© A{dY H$s ‘Xm| Ho$ H$maU AÝ¶ ñWJZOther adjustment due to prior period items 0.73

H$m°nm}aoQ> bm^m§e H$a g{hV df© Ho$ Xm¡amZ

^wJVmZ {H$¶m J¶m bm^m§eDividend paid during the year including Corporate Dividend Tax - (337.56) - - -

gm‘mÝ¶ Ama{jV Am¡a AÝ¶ Ama{jVm| H$mo

hñVm§V[aVTransferred to General Reserve and Other Reserves - - - - -

‘¡Q> Ho«$S>rQ> àmÌVm MAT Credit Entitlement - - - - -

31.03.2019 VH$ A§{V‘ eofClosing Balance as on 31.03.2019 2,798.86 30,058.13 - - -

138

^m.H.{Z.

C.C.I.


139


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.


{ddaU Particulars

(i) gm‘mÝ`


(ii) à{VYmaU

AO©Z (ii) Retained

Earnings

(iii) Ama{jV


(iv) {ZJ{‘V

gm‘m{OH$ Xm{`Ëd



reserve

(v) AÝ`



df© Ho$ Xm¡amZ ewÕ bm^ Net profit for the year - 417.48 - - -

à{VYm[aV AO©Z ‘| grYo ì`mnH$ Am` nhMmZ H$s AÝ` ‘X|Items of other comprehensive income recognize directly in Retained Earnings - - - - -

H$a Ho$ Xm{¶Ëd bm^ Ho$ ~mX nwZ: ‘mnH$Re-measurements of post benefit obligation net of tax - (78.64) - - -

boIm§H$Z Zr{V ‘| n[adV©Z Ho$ H$maU ñWJZAdjustments due to change in Accounting Policy - - - - -

nyd© Ad{Y H$s ‘Xm| Ho$ H$maU AÝ¶ ñWJZOther adjustment due to prior period items -





‘¡Q> Ho«${S>Q> nmÌVm (ZmoQ> 53)MAT Credit Entitlement (refer note 53) 487.97

31.03.2018 VH$ A§{V‘ eof Closing Balance as on 31.03.2018 2,798.86 25,132.99 - - -

140

^m.H.{Z.

C.C.I.


141


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.


{ddaU Particulars

(i) gm‘mÝ`


(ii) à{VYmaU

AO©Z (ii) Retained

Earnings

(iii) Ama{jV


(iv) {ZJ{‘V

gm‘m{OH$ Xm{`Ëd



reserve

(v)AÝ`



df© Ho$ Xm¡amZ ewÕ bm^ Net profit for the year - (455.27) - - -

à{VYm[aV AO©Z ‘| grYo ì`mnH$ Am` nhMmZ H$s AÝ` ‘X| Items of other comprehensive income recognize directly in Retained Earnings - - - - -

H$a Ho$ Xm{¶Ëd bm^ Ho$ ~mX nwZ: ‘mnH$Re-measurements of post benefit obligation net of tax - (53.55) - - -

boIm§H$Z Zr{V ‘| n[adV©Z Ho$ H$maU ñWJZAdjustments due to change in Accounting Policy - (175.42) - - -

nyd© Ad{Y H$s ‘Xm| Ho$ H$maU AÝ¶ ñWJZOther adjustment due to prior period items -





‘¡Q> Ho«${S>Q> nmÌVm (ZmoQ> 53)MAT Credit Entitlement (refer note 53) - 2,023.34 - - -

31.03.2017 VH$ A§{V‘ eof Closing Balance as on 31.03.2017 2,798.86 24,576.98 - - -

140

^m.H.{Z.

C.C.I.


141


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 16 H$ : àmdYmZ / note 16 A - Provisions


{ddaUParticulars

31 ‘mM©, 201931 March 2019

31 ‘mM©, 2018 31 March 2018

01 Aà¡b, 201701 April, 2017

H$. J¡a-Mmby / A. Non Current

H$‘©Mmar bm^m| Ho$ {bE / For Employee benefits

E) AdH$me ZH$XrH$aU / a) Leave Encashment 1,910.31 1,821.50 1,863.72

~r) AZwH§$nm CnXmZ (J«oÀ`wQ>r) / b) Compassionate Gratuity - - -

gr) godm{Zd¥{Îm Ho$ ~mX {M{H$Ëgm bm^ c) Post Retirement medical benefit 391.98 393.14 421.19

S>r) AY©doVZ AdH$me / d) Half pay Leave - - -

B©) AÝ` / e) Others - - -

Cn-`moJ (H$) (H$) / Sub total (A) (a) 2,302.29 2,214.64 2,284.91

AÝ` Ho$ {bE / For Others

n§Om~ BZ’«$mñQ´ŠMa gog Ho$ {bE àmdYmZ* Provision for Punjab Infrastructure Cess* 4,303.69 4,303.69 9,989.01

Cn-`moJ (H$) (H$) / Sub total (A) (b) 4,303.69 4,303.69 9,989.01

Hw$b (H$) (H$+I) / Total (A) (a+b) 6,605.98 6,518.33 12,273.92

ZmoQ> :

*n§Om~ B§’«$mñQ>ŠMa (S>odbn‘|Q> E§S> aoJyboeZ) EŠQ> 2002 Ho$ A§VJ©V 02.02.2014 VH$ CnñH$a (gog) Ho$ àdrOZ àmdYmZ H$mo {Zê${nV

H$aVm h¡ & Bg g§~§Y ‘| ^mdr ZH$X àdmh H$m {ZYm©aU {g’©$ ‘mZZr¶ gdm}ƒ Ý¶m¶mb¶ Ho$ g‘j b§{~V h¡ & {ZU©¶ Ho$ àmá hmoZona hr {H$¶m

Om gH$Vm h¡ & {d{YH$ am¶ Ho$ AmYma na H§$nZr Zo gog CnñH$a H$s am{e na ã¶mO Ho$ ~mao ‘| {H$gr àH$ma H$m {dMma Zht {H$¶m h¡ &

Note :

*Represent provision towards cess upto 02.02.2014 under Punjab Infrastructure (Development and Regulation) Act, 2002. Future cash outflows in respect of the same is determinable only on receipt of judgment/decision pending before the Hon'ble Supreme Court. Based on legal opinion, the Company has not considered provision towards interest on cess amount.

142

^m.H.{Z.

C.C.I.


143


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

àmdYmZ ‘| AnZmB© JB© à{H«$`m / movement in Provisions


{ddaUParticulars

31 ‘mM©, 2019 31st March, 2019

31 ‘mM©, 2018 31st March, 2018

01 Aà¡b, 2017 H$mo 01st April, 2017

df© Ho$ Ama§^ ‘| eof Balance at the beginning of the year 4,303.69 4,303.69 9,989.01

df© Ho$ Xm¡amZ ‘mZr JB© hm{Z¶m±/àmdYmZImpairment losses/ provision during the year recognized - - -

df© Ho$ Xm¡amZ ~Å>o ImVo ‘| S>mbr JB© am{eAmount written off during the year - - 5,685.32


AÝ¶ g‘m¶moOZ* / Other Adjustment* - - -


ZmoQ> - B§S>EEg-19 Ho$ AZwgma H$‘©Mmar {hV Ho$ {bE àmdYmZ H$s {Q>ßnUr g§. 40 XoI| &

Note: Movement in provisions towards Employee Benefit as per IND AS -19, refer note no. 40.

ZmoQ> 16 I : H$‘©Mmar bm^ Xm{`Ëd / Note 16 B : Employee Benefits Obligations


{ddaUParticulars

31 ‘mM©, 201931 March 2019

31 ‘mM©, 2018 31 March 2018

01 Aà¡b, 201701 April, 2017

I : Mmby / B: Current

H$‘©Mmar bm^ Ho$ {bE / For Employee benefits

H$) AdH$me ZH$XrH$aU / a) Leave Encashment 218.73 357.67 327.29

I) A§eXm¶r ^{dî¶ {Z{Y / b) CPF 9.12 12.67 8.43

J) A§eXm¶r A{Yd{f©Vm ¶moOZm / c) CSS 694.50 85.67 1,196.81

K) CnXmZ / d) Gratuity 43.58 1,214.78 134.16

S.) ~moZg/H$m¶©[ZînmXZ go g§~§{YV ^wJVmZe) Bonus/Performance related pay 26.70 30.33 14.60

M) godm{Zd¥Îmr Ho nümV {M{H$Ëgm bm^ ¶moOZm f) Post Retirement Medical Benefit Scheme 27.72 25.77 24.49

N>) ñQ>m’$ go g§~§{YV AÝ` àmdYmZ g) Others Staff related provisions 302.75 1,403.82 0.80

Hw$b / Total 1,323.10 3,130.71 1,706.58

ZmoQ >: 31 ‘mM© 2019 VH$ ñQ>m’$ go g§~§{YV AÝ¶ àmdYmZ {dÎmr¶ df© 2017-18 é. 302.75 bmI (31 ‘mM© 2018 é. 1403.82

bmI Ho$ {bE àmdYmZ Ho$ AZwgma) g§~§{YV ^wJVmZ Ho$ {bE àmdYmZ H$m à{V{Z{YËd H$aVo h¡ &

Note : Other staff releated provision as at 31st March, 2019 represent provision for Performance Related Pay for the F.Y. 2017-18 Rs.302.75 lakh (as at 31st March, 2018 Rs.1403.82 lakh towards provision for pay revision).

142

^m.H.{Z.

C.C.I.


143


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

H$‘©Mmar g§~§Yr AÝ` àmdYmZm| ‘| AnZm`r JB© à{H«$`m / movement in other employee related provisions (én¶o bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

01 Aà¡b, 2018 H$mo eof

Balance as at 01.04.2018

df© Ho$ Xm¡amZ àmdYmZ H$mo Xr JB©

‘mÝ`Vm Provision

during the year recognized

df© Ho$ Xm¡amZ {H$`m J`m ^wJVmZ

Payment made during the Year

df© Ho$ Xm¡amZ {bIr JB© am{e

Amount written off during the

year

31 ‘mM©,2019 H$mo eof


A§eXm¶r A{Yd{f©Vm ¶moOZm CSS 85.66 694.50 85.66 - 694.50

~moZg / Bonus 26.70 26.05 25.40 0.65 26.70

ñQ>m’$ go g§~§{YV AÝ¶ àmdYmZ / Other Staff related provisions 1,403.82 302.75 1,403.82 - 302.75


{ddaU Particulars

01 Aà¡b,2017 H$mo eof



‘mÝ`Vm Provision






year

31 ‘mM©,2018 H$mo eof


A§eXm¶r A{Yd{f©Vm ¶moOZm CSS 1,196.81 85.66 1,196.81 - 85.66

~moZg / Bonus 14.60 26.70 14.60 - 26.70

ñQ>m’$ go g§~§{YV AÝ¶ àmdYmZ / Other Staff related provisions 0.80 1,403.82 0.80 - 1,403.82


{ddaU Particulars




‘mÝ`Vm Provision






year

31 ‘mM©,2017 H$mo eof


A§eXm¶r A{Yd{f©Vm ¶moOZm CSS 634.14 1,196.81 634.14 - 1,196.81

~moZg / Bonus 56.91 14.60 56.91 - 14.60

ñQ>m’$ go g§~§{YV AÝ¶ àmdYmZ / Other Staff related provisions 1.67 0.80 1.67 - 0.80

144

^m.H.{Z.

C.C.I.


145


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 16 J - àmdYmZ / note 16 c - Provisions


{ddaUParticulars

31 ‘mM©, 201931 March 2019

31 ‘mM©, 2018 31 March 2018

1 Aà¡b, 2017 H$moas at 1st April 2017

AÝ¶ Ho$ {bE / For others

IM© H$m àmdYmZ / Provision for Expenses 239.07 151.09 174.51

E‘EgE‘B© H$s ~H$m¶m am{e na ã¶mO H$m àmdYmZ Provision for Interest on Ouststanding dues to MSME 152.24 141.85 139.92

Xo¶ {H$am¶o na ã¶mO Ho$ {bE àmdYmZ Provision for Interest on Lease Rent Payable 13.68 - -

Hw$b / Total 404.99 292.94 314.43

àmdYmZ Ho$ {bE H$s AnZm¶r JB© à{H«$¶m / movement in Provisions


{ddaU Particulars

01 Aà¡b, 2018 H$mo eof



‘mÝ¶VmProvision


df© Ho$ Xm¡amZ {H$¶m J¶m ^wJVmZ




year

31 ‘mM©, 2019 H$mo eof


IM© H$m àmdYmZ Provision for Expenses 151.09 236.16 147.93 0.25 239.07

E‘EgE‘B© H$s ~H$m¶m am{e

na ã¶mO H$m àmdYmZ Provision for Interest on Ouststanding dues to MSME 141.85 10.39 - - 152.24

Xo¶ {H$am¶o na ã¶mO Ho$

{bE àmdYmZ Provision for Interest on Lease Rent Payable - 13.68 - - 13.68

144

^m.H.{Z.

C.C.I.


145


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.


{ddaU Particulars




‘mÝ¶VmProvision






year

31 ‘mM©, 2018 H$mo eof


IM© H$m àmdYmZ Provision for Expenses 174.51 78.99 102.41 151.09




{bE àmdYmZ Provision for Interest on Lease Rent Payable - - - - -


{ddaU Particulars




‘mÝ¶VmProvision






year

31 ‘mM©, 2017 H$mo eof


IM© H$m àmdYmZ Provision for Expenses 872.06 70.69 768.24 174.51




{bE àmdYmZ Provision for Interest on Lease Rent Payable - - - - -

146

^m.H.{Z.

C.C.I.


147


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 17 - CYma / Note 17 - Borrowings


{ddaU Particulars

31 ‘mM©,2019 March 31, 2019

31 ‘mM©, 2018 March 31, 2018

01 Aà¡b, 2017 H$moAs at 1st April, 2017

Mmby / Current

‘m§J na nwZ: ^wJVmZ ¶mo½¶ gwa{jV Secured Repayable on demand

~¢H$ go / From Banks 4,54,459.59 4,04,200.00 2,78,500.00

AÝ¶ nm{Q©>¶m| go / From Other parties - - -

‘m§J na nwZ: ^wJVmZ ¶mo½¶ Agwa{jVUnsecured repayable on demand - - -

~¢H$ go / From Banks 20,000.00 40,000.00 -

AÝ¶ nm{Q©>¶m| go / From Other Parties - - -

g§~§{YV nm{Q©>¶m| go F$U Ed§ A{J«‘ - Agwa{jV Loans and Advances from related parties- Unsecured - - -

bKw Ad{Y gwa{jV O‘m - Agwa{jV Short Term Security Deposits- Unsecured - - -

AÝ¶ F$U (CYma) / Other Loans (Borrowings) - - -

Hw$b / Total 4,74,459.59 4,44,200.00 2,78,500.00

ZmoQ> : 8.15 à{V df© ({nN>bo df© é. 359200 bmI à{V df© E‘[email protected]% à{Vdf© Am¡a é. 45000 bmI CYma à{V df©

E‘[email protected]% à{Vdf© H$s Xa go CYma {b¶m J¶m) é. 454000 bmI H$s {ZYr¶m| H$s bmJV AmYm[aV CYma Xa E‘grEbAma

H$m¶©{eb ny±Or H$s Amdí¶H$Vm Ho$ {bE 30 {XZm| Ho$ ^rVa, 14 gmd©O{ZH$ joÌ Ho$ ~¢H$m| {~¢H$ Am°’$ ~S>moXm (brS> ~¢H$), ~¢H$ Am°’$ B§{S>¶m,

g|Q´>b ~¢H$ Am°’$ B§{S>¶m, H$m°nm}aoeZ ~¢H$, XoZm ~¢H$, Amo[aE§Q>b ~¢H$ Am°’$ H$m°‘g©, n§Om~ Z°eZb ~¢H$, ñQ>oQ> ~¢H$ Am°’$ B§{S>¶m, qg{S>Ho$Q> ~¢H$,

¶y{Z¶Z ~¢H$ Am°’$ B§{S>¶m, Bbmhm~mX ~¢H$, AmÝY«m ~¢H$, ¶yZmBQ>oS> ~¢H$ Am°’$ B§{S>¶m Am¡a {dO¶m ~¢H$}, H$mo EH$hr dº$ ‘| hm¶nmo{WHo$eZ na

nyar Vah go dV©‘mZ g§n{Îm O¡go H$ƒo ‘mb, (H$nmg), à{H«$¶m ‘| ñQ>m°H$ AY© V¶ma ‘mb (btQ) Am¡a V¶ma ‘mb (btQ) Ûmam gya{jV {H$¶m

OmVm h¡ Am¡a V¶ma ‘mb (E’$nr Jm§R>o Am¡a H$m°Q>Z grS²>g) ñQ>moa Am¡a ny±Or g§¶§Ì Am¡a ‘{eZar nwñVH$ F$U, ~H$m¶m n¡go àm{á¶m|, Xmdm| Am¡a

{~b XmoZm| H§$nZr Ho$ dV©‘mZ Am¡a ^{dî¶ go g§~§{YV Zht h¡ &

Note : Rs. 454000 lakh at Marginal Cost of Fund based Lending Rate (MCLR) at the rate of 8.15 per cent per annum (previous year Rs. 359200 lakh borrowed at MCLR @ 7.80 per cent per annum and Rs. 45,000 lakh borrowed at MCLR @ 7.75% per annum) payable within 30 days for working capital requirement, payable on demand as per loan agreement from Consortium of 14 Public Sector Banks {Bank of Baroda (Lead Bank), Bank of India, Central Bank of India, Corporation Bank, Dena Bank, Oriental Bank of Commerce, Punjab National Bank, State Bank of India, Syndicate Bank, Union Bank of India, Allahabad Bank, Andhra Bank, United Bank of India and Vijaya Bank}, which is secured by pari-passu charge on Hypothecation of entire current assets such as raw material (Kapas), stock in process, semi-finished goods (lint) and finished goods (FP bales and cotton seed), stores and spares not related to plant and machinery, book debts, outstanding money receivables, claims and bills receivables of the company both present and future.

146

^m.H.{Z.

C.C.I.


147


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 18 - ì¶mnma Xo¶ / note 18 - trade Payables (én¶o bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©,2019 March 31, 2019

31 ‘mM©,2018 March 31, 2018

01 Aà¡b,2017 H$moAs at 1st April, 2017

Mmby / Current

E‘EgE‘B© H$mo N>moS>H$a AÝ` / Other than MSMEs 4,222.77 4,834.44 394.49

ì`mnma Xo` (E‘EgE‘B©) / Trade Payables (MSME) 1,872.74 64.93 2.73

g§~§{YV nm{Q©>`m| H$mo ì`mnma Xo`Trade Payables to related parties - - -

Hw$b / Total 6,095.51 4,899.37 397.22

ZmoQ> 19 H$ - AÝ¶ {dÎmr¶ Xo¶VmE§ / note 19 A - other financial liabilities (én¶o bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©, 2019 March 31, 2019

31 ‘mM©, 2018 March 31, 2018

01 Aà¡b, 2017 H$moAs at 1st April, 2017

H$. J¡a- Mmby / A. Non Current

gwajm O‘m am{e / {dH«o$Vm go B©E‘S>rSecurity Deposits / EMD from Venders 1,119.40 716.14 717.70

AÝ` ^wJVmZ `mo½` / Other Payable 89.58 54.26 215.49

Cn-`moJ (H$) / Sub total (A) 1,208.98 770.40 933.19

ZmoQ> 19 I - AÝ¶ {dÎmr¶ Xo¶VmE§ / note 19 B - other financial liabilities (én¶o bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©,2019 March 31, 2019

31 ‘mM©,2018 March 31, 2018


I. Mmby / B. Current

ì`mnma Ho$ Abmdm ^wJVmZ `mo½`Payables-Other than trade 195.79 81.62 128.91

J«mhH$m| H$mo ^wJVmZ `mo½` ã`mOInterest Payable to Customers 38.00 18.83 18.73

CYmar na A{O©V ã`mO /Interest accrued on Borrowings - - -

gwajm O‘m am{e Ed§ B©E‘S>r / Security Deposit & EMD 1,642.02 2,282.23 1,223.66

Amny{V©H$Vm© go O‘m (gwajm) Deposits (Security) from Suppliers 326.26 309.96 494.56

{H$am`oXmam| go O‘m (gwajm) Deposits (Security) from Tenants 10.52 4.99 34.43

J«mhH$m| go àmßV B©E‘S>r / EMD from Customers 1,458.19 1,514.36 49.79

[aQ>|eZ ‘Zr / Retention Money 128.33 804.36 509.97

AÝ` ^wJVmZ `mo½` / Other Payable 1,003.55 1,957.44 452.90

Cn-`moJ (I) / Sub total (B) 4,802.66 6,973.79 2,912.95

Hw$b (H$+I) / Total (A+B) 6,011.64 7,744.19 3,846.14

148

^m.H.{Z.

C.C.I.


PB


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 20 - Mmby H$a Xo¶VmE§ / note 20 - current tax liabilities (én¶o bmI ‘|) / (Rs. in Lakh)

{ddaU Particulars

31 ‘mM©,2019 March 31, 2019

31 ‘mM©,2018 March 31, 2018


Am`H$a / Income Tax 1,654.80 545.00 444.40

Hw$b / Total 1,654.80 545.00 444.40

ZmoQ> 21 - AÝ¶ Mmby Xo¶VmE§ / note 21 - other current liabilities


{ddaU Particulars

31 ‘mM©,2019 March 31, 2019

31 ‘mM©,2018 March 31, 2018


Mmby / Current

J«mhH$m| go àmßV A{J«‘Advance Received from customers 2,199.87 12,494.81 5,072.84

gm§{d{YH$ ^wJVmZ `mo½` Xo` / Statutory dues payable 2,430.01 1,031.51 607.71

^wJVmZ `mo½` H$‘©Mmar bm^ / Employee benefits payable 88.39 34.91 27.62

AÝ` / Others 172.87 166.97 228.51

Hw$b / Total 4,891.13 13,728.20 5,936.68

PB


149


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

^maVr` H$nmg {ZJ‘ {b{‘Q>oS>, Zdr ‘w§~B© 31 ‘mM©, 2019 H$mo g‘mßV df© Ho$ {bE bm^ Ed§ hm{Z H$s {ddaUr Ho$ {bE ZmoQ>g

the cotton coRPoRAtion of indiA ltd, nAVi mumBAinoteS foR the StAtement of PRofit And loSS

foR the YeAR ended 31St mARch 2019

ZmoQ> 22 n[aMmbZ go amOñd / note 22 Revenue from operations (é. bmI ‘|) / (Rs. in Lakh)

{dVaUParticulars

31 ‘mM©, 2019 H$mo g‘mßV df©

Year ended31st March 2019

31 ‘mM©, 2018 H$mo g‘mßV df©


(H$) CËnmXm| H$s {~H«$s / (a) Sale of products

nyU© ~§{YV Jm§R>m| H$s {~H«$s, {~Zm¡bm, qbQ> VWm {d{dY ‘X| O¡go g¢nb, H$m¡S>r, amoba / `obmo {nqH$J Jm°R>| BË`m{XSale of Fully Pressed Bales, Cotton Seed, Lint and Miscellaneous Items such as Sample, Cowdy, Roller/Yellow Picking Bales etc. 2,47,534.81 86,520.52

Hw$b (H$) / Total (a) 2,47,534.81 86,520.52

(I) godmAm| H$s {~H«$s / (b) Sale of Services

Jm§R>m| H$m à‘mUZ / Certification of Bales - -

Hw$b (I) / Total (b) - -

(J) AÝ` n[aMmbZ go amOñd / (c) Other Operating RevenuesaIaImd à^ma VWm Xoa go CR>m`o OmZo na à^maCarrying Charges & Late Lifting Charges 1,820.28 269.40 J«mhH$mo go àmßV ã`mO / Interest received from Customers 810.10 748.69

g§{dXm aÔ H$aZo Ho$ {bE à{Vny{V©/Compensation For Cancellation of Contracts 577.30 906.14

S>`yQ>r S´>m°~¡H$ ({Z`m©V) {Z`m©V àmoËgmhZDuty Drawback (Export)/Export Incentive 7.55 -

V¡`ma Jm°R>m| H$s IarX na H¡$e {S>ñH$mC§Q> Cash Discount on Ready Bales purchase - 17.90

Ý`yZV‘ g‘W©Z ‘yë` n[aMmbZ na hþB© hm{Z H$s à{Vny{V©Reimbursement of Losses on Minimum Support Price Operations 32,495.39 28,890.41

Hw$b (J) / Total (c) 35,710.62 30,832.54

Hw$b (H$+I+J) / Total (a+b+c) 2,83,245.43 1,17,353.06

ZmoQ> : B§S>EEg 115 amOñd Ho$ ê$n ‘| B§S>EEg Ho$ AZwnmbZ ‘|, H§$nZr Zo AZw~§Ym| go amOñd nwZ: g§¶moOZ Ho$ {bE AnZr boIm§H$Z Zr{V H$mo g§emo{YV {H$¶m h¡ (ZmoQ> g§. 1.24) H§$nZr Zo ‘§Ìmb¶ Ho$ n[a{eï> gr Ho$ AZwÀN>oX gr 3 (E) Ho$ AZwgma nyd© ì¶mnr ê$n go B§S>EEg H$mo bmJy {H$¶m h¡ & H$m°nm}aoQ> ‘m‘bm| H$s A{YgyMZm {XZm§H$ 28.03.2018 CËnmX H$s {~H«$s Ho$ VwbZmË‘H$ Am§H$‹S>o Cgr Ho$ AZwgma {H$¶o J¶o h¡ & H¥$n¶m {dÎmr¶ na {dñV¥V à^md Ho$ {bE ZmoQ> g§. 30 XoI| &

Note : In compliance of Ind AS 115 - 'Revenue from Contracts', the company has revised its accounting policy for revenue recognition from contracts (Refer Note no. 1.24). The company has applied this Ind AS retrospectively in accordance with paragraph C 3 (a) of Appendix 'C' of Ministry of Corporate Affairs notification dated 28.03.2018. The comparative figures of the Sale of Product has been reinstated accordingly. Please refer to Note No 30 for detailed impact on the Financial Statements.

150


151


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 23 AÝ` Am` / note 23 other income (ê$nò bmI ‘|) / (Rs. in Lakh)

{dVaUParticulars

31 ‘mM©, 2019 H$mo g‘mßV df©


31 ‘mM©, 2018 H$mo g‘mßV df©


{H$amò go Am` / Rental Income 877.37 858.51

~¢H$ {S>nm°{OQ> go àmßV ã`mO / Interest Received on Bank Deposits 3.10 2.99

AÝ` ã`mO Am` / Other Interest Income 30.40 32.59

~r‘m Xmdo / Insurance Claims 88.35 -

Sy>~V F$U H$s dgybr / Foreign Exchange Gain (Net) 148.60 -

AÝ` {d{Y Am` d amB©Q> ~¡³gOther Miscelleneous Income and Write Backs 167.08 124.35

Hw$b / Total 1,314.90 1,018.44

ZmoQ> : 26 Aà¡b, 2019 H$mo àmá ê$. 70. 00 bmI ¶m{Z {dÎmr¶ df© 2018-19 ‘| XO© ~r‘m Xmdo Ho$ pIbm’$ [anmo{Qª>J Ho$ ~mX ^r A‘mÝ¶Vm àmá h¡ & d{Y em{‘b h¡ & ¶h Am¶ [anmo{Qª> VmarI na CnbãY OmZH$mar Ho$ AmYma na Note: Includes Rs. 70.00 lakh received on 26th April 2019 i.e. after reporting period against the insurance claim lodged in the financial year 2018-19. This income is recognised based on the information available at the reporting date.

ZmoQ> 24 Cn^moJ H$s JB© ‘Q>o[a`b na bmJV / note 24 cost of material consumed (ê$nò bmI ‘|) / (Rs. in Lakh)

{dVaUParticulars

31 ‘mM©, 2019 H$mo g‘mßV df©


31 ‘mM©, 2018 H$mo g‘mßV df©


H$ÀMm ‘mb / Raw Material 2,98,950.78 1,30,587.82

n¢qH$J gm‘J«r / Packing Material 1,682.32 751.91

Vmanmo{bZ / Tarpaulins - -

H$nmg H$s A{¾ ‘| hm{Z / J~Z* / Kapas lost in Fire / Misappropriation* 204.74 -

Hw$b / Total 3,00,837.84 1,31,339.73 ZmoQ> : (H$) {nN>bo df© 2018-19 ‘| B§Xm¡a emIm Ho$ Hw$ßner Ho$ÝÐ ‘| AmJ Ho$ H$maU 52.74 bmI ‘yë¶ Ho$ 970.25 q¹$Q>b H$nmg H$s j{V hþB© {OgHo$ {bE ~r‘m H$m Xmdm H$a {X¶m J¶m h¡ &(I) H$m°Q>Z grOZ 2017-18 Ho$ Xm¡amZ Ah‘Xm~mX emIm Ho$ EH$ Ho$ÝÐ ‘| 122.00 bmI ‘yë¶ Ho$ 697 E’$nr ~oëg Ho$ ~am~a H$nmg Ed§ 30 bmI ê$n¶o ‘yë¶ Ho$ 1600 q¹$Q>b H$m°Q>Z erS H$m Xþ{d©{Z¶moOZ {H$¶m J¶m {{Q>nUr g§.47 (S>.) XoIo}.

*Note :(a) 970.25 quintal of kapas valuing to Rs. 52.74 lakh lost in fire at Kukshi centre, Indore branch in the F.Y. 2018-19 against which Insurance claim has been lodged. (b) During the cotton season 2017-18, at one of the centre at Ahmedabad branch misappropriated kapas equivalents to 697 FP bales valuing to Rs. 122.00 lakh and 1600 quintals of cotton seed valuing to Rs.30.00 lakh {Refer note no. 43 (e)}.

150


151


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 25 V¡`ma ‘mb H$s ‘mbgyMr ‘| n[adV©Z, S>ãë`y.AmB©.nr. ì`mnma ‘| ñQ>mH$note 25 changes in inventories of finished Goods, W.i.P., Stock in trade


{dVaUParticulars

31 ‘mM©, 2019 H$mo g‘mßV df©


31 ‘mM©, 2018 H$mo g‘mßV df©


Ama§{^H$ ñQ>mH$ / Opening Stock 1,61,039.68 12,320.98

KQ>mB`o : A§{V‘ ñQ>m°H$ / Less : Closing Stock 2,44,380.29 1,61,056.89

‘mb H$s A{¾ ‘| hm{Z/Mmoar/J~Z* Inventory Lost in Fire/Theft/Misappropriation* 244.41 17.21

‘mbgyMr ‘| OmdH$/(AmdH$Amo) / Stock Outward / (Inward) - -

‘mbgyMr ‘| H$‘r/(d¥{Õ) / Decrease/ (Increase) in Inventories (83,096.20) (1,48,718.70)* ZmoQ> : (H$) {dÎmr¶ df© 2018-19 Ho$ Xm¡amZ ‘hmamï´> amÁ¶ do¶a hmCqgJ H$mnm}aoeZ, Am¡a§Jm~mX emIm Ho$ Joamd Ho$ÝÐ ‘| 244.41 bmI ê$n¶o ‘yë¶ Ho$ E’$nr ~oëg H$s AmJ bJZo go j{V hþB© {OgHo$ {bE ~r‘m H§$nZr ‘| Xmdm H$a {X¶m J¶m h¡ &(I) {dÎmr¶ df© 2018-19 Ho$ Xm¡amZ Am{Xbm~mX emIm Ho$ ^¡gm Ho$ÝÐ ‘| 17.21 bmI ê$. ‘yë¶ Ho$ E’$nr ~oëg H$s AmJ bJZo go j{V hþB© ~Mo hþE ^rJ H$s {~H«$s go 11 66 bmI ê$n¶o ‘yë¶ H$mo g‘m¶mo{OV H$aZo Ho$ nümV 5.54 bmI ê$n¶o H$m ~r‘m Xmdm ~r‘m H§$nZr ‘| H$a {X¶m J¶m h¡ &

*Note: (a) During the F.Y. 2018-19, 1208 FP bales valuing to Rs. 244.41 lakh lost in fire at Maharashtra State Warehousing Corporation (MSWC) Georai centre of Aurangabad Branch against which insurance claim has been lodged with insurance company. (b) During the F.Y. 2017-18, 92 FP bales valuing to Rs. 17.21 lakh lost in fire at Bhainsa centre of Adilabad branch. After adjusting the value of Rs. 11.66 lakh recovered from sale of salvage insurance claim of Rs.5.54 lakh lodged with the insurance company against which Rs.5.36 lakh received in the F.Y. 2018-19.

ZmoQ> 26 H$‘©Mmar bm^ ì`` / Note 26 Employee Benefit Expenses(ê$n`o bmI ‘|) / (Rs. in Lakh)

{dVaUParticulars

31 ‘mM©, 2019 H$mo g‘mßV df©


31 ‘mM©, 2018 H$mo g‘mßV df©


doVZ, ^Îmo VWm AÝ` àmoËgmhZ / Salaries, Allowances & Other incentives 6,583.53 6,571.92

~moZg VWm na’$m°a‘|g go OwS>m doVZ / Bonus & Performance related pay 443.54 111.01

^{dî` {Z{Y VWm n|eZ {Z{Y ‘| A§eXmZContribution to Provident Fund & Pension Fund 564.35 501.06

CnXmZ {Z{Y ‘| A§eXmZ /Contribution to Gratuity Fund 243.23 998.40

A{Yd{f©Vm {Z{Y ‘| A§eXmZ /Contribution to Super Annuation Fund 694.50 85.67

godm {Zd¥Îmr Ho$ ~mX H$s ¶moOZm /Post Retirement Benefit Scheme 39.78 46.99

Nw>Å>r ZH$XrH$aU Ho$ {bE ^wJVmZ /Payment for leave encashment 436.08 615.99

ñQ>m°’$ H$ë`mU ì`` /Staff Welfare Expenses 355.15 355.23

Hw$b/Total 9,360.16 9,286.27

152


153


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

ZmoQ> 27 {dÎmr` bmJV / note 27 finance cost (ê$n`o bmI ‘|) / (Rs. in Lakh)

{dVaUParticulars

31 ‘mM©, 2019 H$mo g‘mßV df©


31 ‘mM©, 2018 H$mo g‘mßV df©


E) ~¢H$ F$U na / A) On Bank Loans 27,977.07 25,245.48

~r) AÝ` / B) Others 0.22 5.15

Hw$b / Total 27,977.29 25,250.63

ZmoQ> 28 AÝ` ì`` / Note 28 Other Expenses(ê$n`o bmI ‘|) / (Rs. in Lakh)

{dVaUParticulars

31 ‘mM©, 2019 H$mo g‘mßV df©


31 ‘mM©, 2018 H$mo g‘mßV df©


(H$) {OqZJ Ed§ àoqgJ ì`` / (A) Ginning and Pressing Expenses

{OqZJ à^ma / Ginning Charges 7,740.28 3,749.30

àoqgJ à^ma / Pressing Charges 3,092.71 1,538.61

l‘ Ed§ AÝ` g§gmYZ à^ma / Labour and Other Processing charges 899.63 564.24

Hw$b (H$) / Total (A) 11,732.62 5,852.15

(I) AÝ` n[aMmbZ ì`` / (B) Other Operating Expenses

JmoXm‘ {H$am`m / Godown Rent 1,628.65 833.96

~r‘m / Insurance 605.17 245.26

~¢H$ à^ma / Bank Charges 30.68 9.29

H$nmg CnO ‘| gwYma Ho$ {bE ì`` Expneses on Improvement of Cotton Yield - -

Hw$b(I) / total (B) 2,264.50 1,088.51

(J) àemg{ZH$ ì`` / (C) Administrative Expneses

H$m`m©b` {H$am`m / Office Rent 97.39 89.72

`mÌm Ho$ {bE ì`` : / Travelling Expenses of :

- {ZXoeH$m| hoVw / - Directors 75.44 38.42

- AÝ` hoVw / - Others 213.66 143.61

Xa| Ed§ H$a / Rates and Taxes 50.10 50.19

{d{YH$ VWm ì`mdgm{`H$ ’$sg / Legal and Professional Fees 128.87 106.93

boIm narjH$m| H$m nm[al{‘H$ / Remuneration To Auditors

- boIm narjH$* / - As Auditor* 28.20 21.60

- H$amYmZ ‘m‘bo d¡Q> boIm narjm** / - For Taxation Matters/ VAT Audit ** 7.50 6.92

152


153


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

- AÝ` godmAm| Ho$ {bE / - For Other Services 5.60 2.80

- ì``m| H$s à{Vny{V© Ho$ {bE / - For Reimbursement of Expenses § 1.33 1.10

‘aå‘V Ed§ aIaImd (^dZ) / Repairs and Maintenance (Building) 135.09 133.45

‘aå‘V Ed§ aIaImd (H§$ß`yQ>a) / Repairs and Maintenance (Computers) 199.34 161.28

‘aå‘V Ed§ aIaImd (AÝ`) / Repairs and Maintenance (Others) 7.80 10.48

qàqQ>J Ed§ ñQ>oeZar / Printing and Stationery 61.85 56.94

Q>obr’$moZ / Telephone 30.17 34.54

nmoñQ>oO Ed§ Hw$[a`a / Postage and Courier 20.94 15.00

{dkmnZ / Advertisement 44.69 18.04

{~Obr Ed§ Ob à^ma / OZaoQ>a à^ma Electricity Water Charges / Generator Charges 143.55 99.23

{ZJ{‘V gm‘m{OH$ Xm{`Ëd na IM}Expenditure on Corporate Social Responsibilites 37.79 32.44

AÝ` àemg{ZH$ IM} /Other Administrative Expenses 194.12 192.71

Hw$b (J) / Total (C) 1,483.43 1,215.40

ZmoQ²g : *{dÎmr¶ df© 2017-18 Ho$ {bE {dÎmr¶ df© 2018-19 ‘| Am°{S>Q> ’$sg ‘| d¥{Õ Ho$ A§Va hoVw 4.20 bmI ê$. (JV df© 1.80 bmI ê$.) H$m ^wJVmZ em{‘b h¡ &**{dÎmr¶ df© 2017-18 Ho$ {bE {dÎmr¶ df© 2018-19 ‘| Q>¡Šg Am°{S>Q> ’$sg ‘| d¥{Õ Ho$ A§Va hoVw 1.00 bmI ê$. (JV df© 0.50 bmI ê$.) H$m ^wJVmZ em{‘b h¡ &

Note:* Includes incremental differences of Audit Fees of Rs. 4.20 Lakh (Previous Year Rs. 1.80) for the financial year 2017-18, paid during the financial year 2018-19. ** Includes incremental differences of Tax Audit Fees of Rs. 1.00 Lakh (Previous Year 0.50 lakh) for the financial year 2017-18, paid during the financial year 2018-19.


(K) {~H«$s, {dVaU VWm ào{fV ì`` / (D) Selling, Distribution & Forwarding Expenses

{dH«$s, {dVaU ì`` / Selling, Distribution Expenses 1,397.40 668.05

Xbmbr/ H$‘reZ / Brokerage/ Commission 393.68 0.72

H¡$e {S>ñH$mC§Q> / Cash Discount 0.82 0.45

Hw$b(K) / Total (D) 1,791.90 669.22

(B©) àmdYmZ VWm amB©Q> Am°’$ ì`` / (E) Provisions and Write Off Expenses

A{J«‘/ dgybr `mo½` ~Å>o ImVo ‘| S>mbm J`m Advances/ Recoverable Written Off 109.25 -

g§{X½Y F$U Ho$ {bE àmdYmZ / A{J«‘ Provision for Doubtful Debts/ Advances - 1.83

E‘.Eg.E‘.B© H$mo ~H$m`m am{e na ã`mO hoVw àmdYmZ Provision for Interest on Outstanding dues to MSME 10.39 1.94

n§Om~ BÝ’«$mñQ´>ŠMa gog na ã`mO hoVw àmdYmZ Provision for Interest on Punjab Infrastructure Cess - 774.66

154


PB


^m.H$.{Z.

C.C.I.

^m.H$.{Z.

C.C.I.

Xo¶ {H$amE na ã¶mO Ho$ {bE àmdYmZProvision for Interest on Lease Rent Payable 13.68 -

Hw$b (B©) / Total (E) 133.32 778.43

Hw$b ì`` (H$+I+J+K+B©) / Total Expenses (A+B+C+D+E) 17,405.77 9,603.71

ZmoQ> 29 AgmYmaU ‘X| / Note 29 Exceptional Items (ê$n`o bmI ‘|) / (Rs. in Lakh)

{dVaUParticulars

31 ‘mM©, 2019 H$mo g‘mßV df©


31 ‘mM©, 2018 H$mo g‘mßV df©


AMb n[ag§n{Îm`m| H$s ‘Xm| H$m {ZnQ>mZ Disposal of items of Fixed assets (5.55) (0.72)

J¡a dV©‘mZ {Zdoe H$m {ZnQ>mZDisposal of Non current investments - -

g~{gS>r Xmdo H$m CëQ>mdReversal of subsidy claim - -

Xoar go {H$E JE ^wJVmZm| na ã`mO (boQ> no-‘|Q> MmO}g)Interest on delayed payments (Late Payment Charges) 0.28 1.23

{ZnQ>mZ H$m ‘wH$X‘m (ewÕ)Litigation of settlements (Net) - -

g§{X½Y F$Um| Ho$ {bE àmdYmZ/ A{J«‘ (JVdf©) nwZam§H$ZProvision for Doubtful Debts/ Advances (Previous Year) Written Back - (333.11)

àmdYmZ {OZH$s Amdí`H$Vm Zht / Provisions no longer required (177.28) (6,494.51)

Hw$b / Total (182.55) (6,827.11)

155


^m.H$.{Z.

C.C.I.

Notes to the Financial Statements

30. MinistryofCorporateAffairs(MCA)has issuedthe Companies (IndianAccounting Standards)(Amendment)Rules,2018on28thMarch,2018notifying IndAS115, ‘Revenue fromContractswith Customers’ and amending Ind AS 21‘The Effects of Changes in Foreign ExchangeRates’;IndAS12‘IncomeTaxes’.Thesameareapplicableforfinancialstatementspertainingtoannual periodsbeginningonor after 1stApril,2018. The Company expects that there is nomaterial impact on the financial statementsresultingfromtheimplementationofIndAS12and IndAS21.However, incomplianceof IndAS115,thecompanyhasreviseditsaccountingpolicy for revenue recognition from contracts(refernoteno.1.24).

Disclosure as per IndAS 8 due to change inaccounting policy in accordance with Ind AS115.

(a) Natureofchangeinaccountingpolicy

Uptoearlieryear,companywasrecognizingtherevenue fromSale of Lint, fully pressed balesof cotton when the contract has been signed,initial security deposit as per the terms of thecontracthasbeenreceivedandthebaleshavebeenselectedbythecustomers.

However, in accordance with IndAS 115, therevenuefromthecontractsarerecognizedfromSalesof lint, fullypressedbalesof cottonandcottonseedsatthetimeofissuanceofdeliveryorders by theCompany provided delivery hastaken place on or before end of the reportingperiod.

(b) TheCompanyhaselectedtoapplyIndAS115retrospectively in accordance with paragraphC3(a) of Appendix C of Ministry of CorporateAffairs notification dated 28.03.2018. Thecomparative figuresof theSaleofProducts inNoteno.22(a)hasbeenreinstatedaccordingly.

(c) Thefinancialimpactoneachfinancialstatementline items for the current reporting period andeachpriorperiodpresentedisasunder:-

{dÎmr¶ {dda{U¶m| Ho$ {bE ZmoQ²g

30. H$m°anmoaoQ> ‘m‘bm| Ho$ ‘§Ìmb¶ (E‘grE) Zo 28 ‘mM©,

2018 H$mo H§$nZr (^maVr¶ boIm ‘mZH$) (g§emoYZ)

{Z¶‘, 2018 H$mo B§S>ñQ´>rµO Ho$ ê$n ‘| A{Ygy{MV {H$¶m

h¡, 'J«mhH$m| Ho$ gmW AZw~§Y go amOñd' Am¡a 21 Ho$

ê$n ‘| B§S>ñQ´>rµO ‘| g§emoYZ H$aZm {dXoer ‘wÐm Xam| ‘|

n[adV©Z'; B§S> EEg ‘| 12 'Am¶ H$a' & 1 Aà¡b,

2018 H$mo ¶m CgHo$ ~mX ewê$ hmoZo dmbr dm{f©H$ Ad{Y

go g§~§{YV {dÎmr¶ {dda{U¶m| Ho$ {bE ^r ¶hr bmJy hmoVm

h¡& H§$nZr H$mo Cå‘rX h¡ {H$ B§S>EEg 12 Am¡a B§S>EEg 21

Ho$ H$m¶m©Ýd¶Z Ho$ n[aUm‘ñdê$n {dÎmr¶ {ddaUm| na H$moB©

‘Q>o[a¶b à^md Zht h¡ & hmbm§{H$, AZwnmbZ ‘| 115

Ho$ ê$n ‘|, H§$nZr Zo AZw~§Y go amOñd ‘mÝ¶Vm Ho$ {bE

AnZr boIm§H$Z Zr{V H$mo g§emo{YV {H$¶m h¡ (ZmoQ> g§»¶m

1.24 XoI|)&

B§S>EEg 115 Ho$ AZwgma boIm§H$Z Zr{V ‘| n[adV©Z Ho$

H$maU B§S>EEg 8 Ho$ AZwgma àH$Q>rH$aU &

H$) boIm§H$Z Zr{V ‘| n[adV©Z H$s àH¥${V

nhbo df© VH$, H§$nZr {~H«$s Ho$ qbQ> go amOñd H$mo nhMmZ

ahr Wr, O~ AZw~§Y na hñVmja {H$E JE, H$nmg H$s

nyU©~§{YV Jm§R>|, AZw~§Y H$s eVm] Ho$ AZwgma àma§{^H$

gwajm O‘m Am¡a J«mhH$m| Ûmam Jm§R>m| H$m M¶Z {H$¶m J¶m h¡&

hmbm§{H$ B§S>EEg 115 Ho$ AZwgma H§$nZr Xdmam AZw~§Y

go àmá amOñd H$mo qbQ> H$s {~H«$s, nyU©~§{YV Jm§R>mo Ed§

{~Zdbo Ho$ {dVaU AmXoe Omar H$aZo Ho$ g‘¶ ‘mÝ¶

{H$¶m OmVm h¡ & ~eV} {H$ g‘rjmYrZ Ad{Y Ho$ A§V ‘|

¶m CgHo$ nhbo gwnwX©Jr hþB© hmo &

I) H§$nZr Zo 28.03.2018 H$mo H$m°nm}aoQ> ‘m‘bm| H$s

A{YgyMZm ‘§Ìmb¶ Ho$ n[a{eï> gr Ho$ n¡am gr 3 (E) Ho$

AZwgma B§S>EEg 115 Ho$ ê$n ‘| B§S>ñQ´>rµO H$mo bmJy H$aZo

Ho$ {bE MwZm h¡ & ZmoQ> g§. 22 (E) Ho$ AZwgma CËnmXm|

H$s {~H«$s Ho$ VwbZmË‘H$ Am§H$‹S>o ~hmb {H$E JE h¡ &

(J) dV©‘mZ n[aMmbZ Ad{Y Ho$ {bE àË¶oH$ {dÎmr¶ {ddaU bmBZ ‘X na {dÎmr¶ à^md Am¡a nyd© H$s Ad{Y Bg nH$ma n«ñVwV H$s JB© :-

156

^m.H$.{Z.

C.C.I.


{dÎmr¶ df© 2018-19Financial Year 2018-19

B§S> EEg 115 Ho$ ê$n ‘| g§H«$‘U Ho$ H$maU, AZw~§Y Omo àma§{^H$ AmdoXZ H$s VmarI go nyam Zht hþAm h¡, ¶m{Z Aà¡b 2018 Ho$ dV©‘mZ

{dÎmr¶ {ddaU ‘| ‘mÝ¶Vm àmá h¡ & {dÎmr¶ {ddaU ‘| n[adV©Z H$m à^md {ZåZmZwgma h¡ :-

DuetotransitionofIndAS115,contractsthatarenotcompletedatthedateofinitialapplicationi.e.01stApril2018arerecognizedinthecurrentfinancialstatements.ImpactofthetransitionintheFinancialstatementisasunder:-

(ê$. bmI ‘|) / (Rs.inlakh)

{ddaU Description

ZmoQ> Z§~a NoteNo.

B§S> EEg 115 Ho$ à^md H$mo

g‘m¶mo{OV H$aZo H$s nyd© am{e

Amountbeforeadjustingthe

impactofIndAS115

B§S> EEg 115 Ho$ à^md H$mo

g‘m¶moOZ H$aZo Ho$ ~mX am{e

AmountafteradjustingimpactoftheIndAS115

d¥Õr/(H$‘r)Increase/(Decrease)

{dH«$¶ / Sales 22 218354.53 247534.81 29180.28

H¡$[a¨J MmO}O / CarryingCharges 22 1668.01 1,820.28 152.27

àma§{^H$ ‘mb / OpeningInventories 25 132537.40 161039.68 28502.28

^maV gaH$ma go E‘Egnr hm{Z H$s à{Vny{V© MSPLossreimbursablefromGovt.ofIndia 22 33207.07 32,495.39 (711.68)

Q>¡Šg Ho$ nyd© bm^ / ProfitbeforeTax - 7705.64 7824.24 118.60

^maV gaH$ma go àmá E‘Egnr hm{Z MSPLossReceivablefromGovt.ofIndia 8 256463.71 255752.03 (711.68)

{dÎmr¶ df© 2017-18 / Financial Year 2017-18(ê$. bmI ‘|) /(Rs.inlakh)

{ddaU Description

ZmoQ> Z§~a NoteNo.

nhbo H$s Zr{V Ho$ AZwgma Am§H$S>oFiguresasper

earlieraccountingpolicy

g§emo{YV boIm Zr{V Ho$ AZwgma Am§H$S>o Figuresasper

revisedaccountingpolicy

d¥Õr/(H$‘r)Increase/(Decrease)

{dH«$¶ / Sales 22 108407.59 86,520.52 (21,887.07)

H¡$[a¨J MmO}O / CarryingCharges 22 390.14 269.40 (120.74)

^maV gaH$ma go E‘Egnr hm{Z H$s à{Vny{V© MSPLossreimbursablefromGovt.ofIndia

2228,751.52 28,890.41 138.89

àma§{^H$ ‘mb / OpeningInventories 25 5,171.68 12,320.98 7,149.30

eof ‘mb / ClosingInventories 25 1,32,537.40 1,61,039.68 28,502.28

Q>¡³g Ho$ nhbo bm^ ProfitbeforeTax

-2368.39 1,852.44 (515.95)

157


^m.H$.{Z.

C.C.I.

Q>¡Šg Ho$ ~mX bm^ / ProfitAfterTax - 933.43 417.48 (515.95)

^maV gaH$ma go àmß¶ E‘Egnr H$s hm{Z MSPLossReceivablefromGovt.ofIndia

83,14,313.76 3,14,452.64 138.88

ì¶mnma àm{á¶m§ / TradeReceivables 6A&6B 27,267.34 6,104.86 (21,162.48)

J«mhH$m| go àmá A{J«‘ AdvanceReceivedfromCustomers

212,863.41 12,494.81 9,631.40

OrEgQ>r BZnwQ> H«o${S>Q> / GSTInputCredit 10B 5,198.43 6627.23 1,428.80

OrEgQ>r ^wJVmZ / GSTPayables 21 418.81 386.30 (32.52)

à{Veo¶a Am¶ (ê$. ‘|) EarningsPerShare(inRs.)

37.34 16.70 20.64

{dÎmr¶ df© 2016-17 / Financial Year 2016-17(ê$. bmI ‘|) /(Rs.inlakh)

{ddaU Description

ZmoQ> Z§~a NoteNo.

nyd© H$s boI Zr{V Ho$

AZwgma Am§H$S>oFiguresasper

earlieraccountingpolicy

g§emo{YV boIm Zr{V Ho$

AZwgma Am§H$S>oFiguresasper

revisedaccountingpolicy

d¥Õr/(H$‘r) Increase/(Decrease)

V¡¶ma ‘mb H$m A§{V‘ ñQ>m°H$ ClosingInventoriesofFinishedGoods

11 11039.17 18188.48 7149.31

ì¶mnma àm{á¶m§ / TradeReceivables 6B 10347.10 3279.24 (7067.84)

^maV gaH$ma go àmß¶ E‘Egnr H$s hm{Z MSPLossReceivablefromGovt.ofIndia

8 295737.27 295480.40 (256.87)

ewÛ AO©Z na à^md NetEffectonRetainedEarnings

(175.42)

boIm Zr{V ‘| ê$. 175.42 bmI VH$ Ho$ n[adV©Zm| H$m ewÛà^md ~aH$ama aIr JB© Am¶ ‘| g‘m¶mo{OV {H$¶m J¶m h¡ & (g§X^© Zmo.g§.15)

TheneteffectofchangesintheaccountingpolicyamountingtoRs.175.42lakhhasbeenadjustedinretainedearnings(refernoteno.15).

31. H§$nZr ‘w»¶ ê$n go H$nmg H$s àog H$s JB© Jm§R>m| H$s

{~H«$s, qbQ> Am¡a CËnmoËnmX O¡go H$m°Q>Z erS>, {‘{lV Jm§R>m|

Am{X go amOñd àmá H$aVr h¡ & H§$nZr bm^ Am¡a hm{Z

Ho$ AnZo ~¶mZ ‘| AàË¶j H$am| H$m amOñd ewÕ àñVwV

H$aVr h¡ &

31. TheCompany derives revenue primarily fromsale of fully pressed bales of cotton, sale oflint and by-products i.e. cotton seeds, misc.balesetc.TheCompanypresentsrevenuenetof Indirect taxes in itsStatementofProfitandLoss.

158

^m.H$.{Z.

C.C.I.


Disaggregated Revenue from Contracts:

RevenuefromoperationsfortheyearendedMarch,312019andMarch,312018isasfollows:

a. Product wise:(Rs.inlakh)

ParticularsYearendedMarch,312019

YearendedMarch,312018

MainProduct:

FullyPressedBales 170022.35 54330.86

Lint 82.86 91.38

By-Product:

CottonSeeds 77301.20 32074.61

Misc.Items 128.40 23.65Total 247534.81 86520.5

b. Customer wise:(Rs.inlakh)

Particulars YearEndedMarch,312019

YearEndedMarch,312018

NationalTextilesCorporationLtd. 29117.08 18143.57

Others 218417.73 68376.93Total 247534.81 86520.5

32. Contingent Liabilities :

i) ContingentLiabilities

(Rs.inlakh)Sr.No. BriefDescription As at

31.03.2019As at

31.03.2018a) Claimsof

employeesandotheragainsttheCompanyofwhichtheamountsareascertainablebutnotacknowledgedasdebts*

826.75 829.77

AZw~§Y go AbJ amOñd àMmbZ:

g‘má hþE df© 31 ‘mM©, 2019 Am¡a 31 ‘mM©, 2018 Ho$ {bE

àMmbZ go amOñd àmá {ddaU Bg àH$ma h¡ :

H$. CËnmXdma :(ê$. bmI ‘|)

{ddaUg‘má df©

31 ‘mM©, 2019g‘má df©

31 ‘mM©, 2018

‘w»¶ CËnmX :

nyU©~§{YV Jm§R>| 170022.35 54330.86

qbQ> 82.86 91.38

CnmoËnmX :

H$m°Q>Z erS>g 77301.20 32074.61

{‘gbo{ZEg dñVw 128.40 23.65

Hw$b 247534.81 86520.5

I. J«mhH$dma :

(ê$.bmI ‘|)

{ddaUg‘má df©

31 ‘mM©, 2019g‘má df©

31 ‘mM©, 2018

ZoeZb Q>oŠgQ>mBb

H$mnm}aoeZ {b.29117.08 18143.57

AÝ¶ 218417.73 68376.93

Hw$b 247534.81 86520.5

32. AmH$pñ‘H$ Xo¶VmE§ :

i) AmH$pñ‘H$ Xo¶VmE§

(ê$.bmI ‘|)

H«$‘ g§{já {ddaU31 ‘mM©, 2019 H$mo

31 ‘mM©, 2018 H$mo

H$) H$‘©Mm[a¶m| Ho$ Xmdo

Am¡a AÝ¶ H§$nZr Ho$

pIbm’$, Omo am{e H$m

nVm bJmZo ¶mo½¶ h¡,

F$U Ho$ ê$n ‘| ñdrH$ma

Zht {H$¶m J¶m h¡ &

826.75 829.77

159


^m.H$.{Z.

C.C.I.

b) DisputedSalesTaxDemandagainstwhichRs.83.27lakh(PYRs.83.27Lakh)isdeposited.

235.16 247.49

b) DisputedServiceTaxDemandagainstwhichRs.0.33lakh(PYRs.0.33lakh)isdeposited.

4.39 4.39

c) DisputedIncomeTaxDemandagainstwhichcompanyisinappealbeforeCommissionerofIncomeTax(Appeals)

1.82 42.93

d) Duesmayariseduetonon-submissionof‘C’/’H’/’I’Forms**

1.37 6.91

e) InterestliabilityontheamountofRs.511.93lakhreceivedduringtheFY2015-16fromthedefaultingbuyersforlossesarisingoutofresaleofquantitiesinitiallysoldtothemundertheordersofHon’bleBombayHighCourt.

160.72 119.77

Total 1230.21 1251.26

*Interest on the claimed amount may have to bepaidiflegalcasesaredecidedagainsttheCompany(amountnotascertainable)

**Companyispursuingwiththepartiesforcollectionof ‘C’/’H’/’I’ forms and onward submission beforeassessmentbytheSalesTaxAuthorities.

I) {ddm{XV {~H«$sH$a H$s ‘m§J Ho$ gm‘Zo Omo ê$. 83.27 bmI (à{Vdf© ê$. 83.27 bmI O‘m)

235.16 247.49

I) {ddm{XV {~H«$sH$a Ho$

gm‘Zo Omo ê$.0.33

bmI (à{Vdf© ê$.

0.33 bmI) O‘m

h¡&

4.39 4.39

J) {ddm{XV Am¶H$a Ho$

gm‘Zo Omo Am¶H$a

Am¶moJ Ho$ g‘j Anrb

‘| h¡ & 1.82 42.93

K) gr/EM/AmB© ’$m‘© H$s

~H$m¶m am{e O‘m Z

hmoZo Ho$ H$maU

1.37 6.91

S>) df© 2015-2016 Ho$

Xm¡amZ ê$. 511.93

bmI H$s am{e na

ã¶mO H$s Xo¶Vm

{S>’$mëQ> IarXmam| go

àmá hmoZo dmbr hm{Z¶m|

Ho$ H$maU ewê$ ‘|

‘mZZr¶ ‘w§~B© hmB©H$moQ>©

Ho$ AmXoe Ho$ VhV CÝh|

~oMr JB© &

160.72 119.77

Hw$b 1230.21 1251.26

*¶{X H§$nZr Ho$ pIbm’$ H$mZyZr ‘m‘bo V¶ {H$¶o OmVo h¢, Vmo Xmdm

H$s JB© am{e na ã¶mO H$m ^wJVmZ H$aZm nS> gH$Vm h¡ & (am{e

nVm bJmZo ¶mo½¶ Zht h¡)

**{~H«$sH$a àm{YH$m[a¶m| Ûmam ‘yë¶m§H$Z go nhbo H§$nZr nm{Q©>¶m| go

gr/EM/AmB© ’$m‘© g§J«h àmá H$aZo Ho$ {bE n¶mgaV h¡ &

160

^m.H$.{Z.

C.C.I.


TheCompany’s pending litigations comprise claimsagainst the Company and proceedings pendingwith Tax/ Statutory /Government Authorities. TheCompanyhasreviewedallitspendinglitigationsandproceedings and has made adequate provisions,wherever, required and disclosed the contingentliabilities, wherever applicable, in its financialstatements.

TheCompanydoesnotexpecttheoutcomeoftheseproceedingstohaveamaterialimpactonitsfinancialposition. Future cash outflows in respect of theabovearedeterminableonlyonreceiptofjudgments/decisionspendingwithvariousforums/authorities.

ii) EstimatedamountofcommitmentofcapitalcontractsremainingtobeexecutedandnotprovidedforisNil(previousyearNil).

iii) EstimatedamountofothercommitmentsnotprovidedforisNil(previousyearNil).

iv) GuaranteegivenbytheBankonbehalfoftheCorporation is Rs 0.01 lakh (previous yearRs.0.01lakh)

33. Contingent Assets:

A. Insurance claims for stock damaged in fireamounting Rs.6518.61 lakh (previous yearRs.6184.66 lakh) are pending with variousinsurancecompaniesinrespectof16casesoffire/misappropriationinstock.TheCorporationhasbeenfollowingthesamewiththeinsurancecompanies. Since, claims were not beingsettledby the insurancecompany for9casesvaluing to Rs.2601.02 lakh (previous year2592.64 lakh) out of 16 cases as mentionedabove,theCorporationhastakenupthematterinthevariousappellateforums/authorities.

Basedonthepastexperience,theCorporationbelievesthattherecouldbeafavorableoutcomeis probable. However, it is impracticable toestimate the financial effects of the same asitsreceiptisdependentontheoutcomeofthejudgmentsandalso thedecision takenby theinsurance companies for the claims pendingwiththem.

b§{~V ‘wH$X‘m| ‘| H§$nZr Ho$ {Ibm’$ Xmdo H$a /d¡Ym{ZH$/

gaH$mar àm{YH$mar Ho$ gmW b§{~V H$m¶©dmhr em{‘b h¡ & H§$nZr

Zo AnZo g^r b§{~V ‘wH$X‘m| Am¡a H$m¶©dmhr H$s g‘rjm H$s Am¡a

AnZo {dÎmr¶ {ddaU ‘| Ohm§ H$ht ^r Amdí¶H$ hmo, AmH$pñ‘H$

XoZXm[a¶m| H$m Iwbmgm {H$¶m h¡ &

H§$nZrAm| H$mo BZ H$m¶©dmhtAm| Ho$ n[aUm‘ H$s {dÎmr¶ pñWVr na

{H$gr ‘Q>o[a¶b à^md H$s Anojm Zht h¡ & ^{dî¶ Ho$ ZH$Xr

~{hdm©h na à^md nS>Vm h¡ Omo Ho$db {d{^Þ {ZU©¶ Ho$ gmW ¶mo½¶

b§{~V {ZU©¶ àmá hmoZo na {ZYm©[aV hmoVo h¡ &

ii) {Zînm{XV hmoZo Ho$ {bE eof ny§Or AZw~§Ym| H$s à{V~ÛVm

H$s AZw‘m{ZV am{e Am¡a eyÝ¶ Ho$ {bE àXmZ Zht H$s

JB© h¡ & ({nN>bo df© eyÝ¶)

iii) AÝ¶ à{V~ÛVmAm| H$s AZw‘m{ZV am{e eyÝ¶ Zht h¡&

({nN>bo df© eyÝ¶)

iv) {ZJ‘ H$s Amoa go ~¢H$ Ûmam Xr J¶r Jma§Q>r ê$. 0.01

bmI ({nN>bo df© 0.01 bmI)

33. AmH$pñ‘H$ g§n{Îm

H$. ñQ>m°H$ ‘| AmJ bJZo XþK©Q>Zm Ho$ 16 ‘m‘bm| Ho$ g§~§Y ‘|

6518.61 bmI ({nN>bo df© 6184.66 bmI ê$.) ‘|

AmJ go j{VJ«ñV hþE ñQ>m°H$ Ho$ {bE ~r‘m Xmdo {d{^Þ

~r‘m H§${Z¶m| Ho$ nmg b§{~V h¢ & {ZJ‘ ~r‘m H§$n{Z¶m|

Ho$ gmW EH$ hr ì¶dhma H$a ahm h¡ & My§{H$, ~r‘m H§$nZr

Ûmam 9 ‘m‘bm| ‘| ‘yë¶ {ZYm©aU Ho$ {bE Xmdm| H$m {ZnQ>mZ

Zht {H$¶m Om ahm Wm & D$na d{U©V 16 ‘m‘bm| ‘| go

2601.02 bmI ({nN>bo df© 2592.64 bmI) {ZJ‘

Zo {d{^Þ Anrbr¶ ‘§M àm{YH$aUm| ‘| ‘m‘bo H$mo CR>m¶m

h¡ &

{nN>bo AZw^d Ho$ AmYma na {ZJ‘ H$m ‘mZZm h¡ {H$ EH$

AZwHy$b n[aUm‘ g§^m{dV hmo gH$Vm h¡ & d¡go ^r, ¶h

Cgr Vah Ho$ {dÎmr¶ à^mdm| H$m AZw‘mZ bJmZo Ho$ {bE

Aì¶mdhm[aH$ h¡ & Š¶m|{H$ Bg‘| agrX {ZU©¶ Ho$ n[aUm‘

na {Z^©a H$aVr h¡ Am¡a {ZU©¶ Ûmam ^r {H$¶m OmVm h¡ &

CZHo$ gmW b§{~V Xmdm| Ho$ {bE ~r‘m H§$nZr {ZU©¶ bo ahr

h¡ &

161


^m.H$.{Z.

C.C.I.

B. TheCorporationhaslodgedtheclaimstowardspricedifference,carryingcharges,interestetc.onthedefaultedbuyersduetonon-performanceoftheircontractualobligations.Theamountofclaimslodgedason31.03.2019isRs.27255.51lakh (previous year Rs. 27508.25 lakh). Inthe previous three year, the Corporation hadreceived the following amounts from suchdefaultedbuyers:-

(Rs.inlakh)FinancialYear Amountreceived*

2017-18 906.14

2016-17 793.33

2015-16 69.64

*includes out of court settlements made by thedefaultedbuyers.Basedontheaboveexperience,Corporationbelievesthat favorable outcome in the remaining cases isprobable. However, it is impracticable to estimatethe financial effects of the same as its receipt isdependent on the outcome of the judgments andthereexecutions.

34. Reimbursement of losses in Minimum Support Price operation

The losses if any, incurred on accountof Minimum Support Price Operationsreimbursable from the Government of India,Ministry of Textiles are accounted on accrualbasis and disclosed as Operating Revenueas these operations are relatedwith the corebusiness activities of the Company. Duringthe financial year 2018-19, Govt. of India,reimbursedRs.91196.00lakhagainsttheMSPlossesreceivableupto31.03.2018.Theamountreceivableason31.03.2019isRs.255752.03lakh(previousyearRs.314452.64lakh).

Losses amounting to Rs. 32495.39 lakh(previous year Rs. 28890.41 lakh) arising onaccount of Minimum Support Price (MSP)operationsarereimbursablebytheGovernmentof India during the financial year 2018-19.Theseexpenses/lossesinclude:

I. {ZJ‘ Zo AnZo AZw~§{YV Xm{¶Ëdm| H$mo nyam Z H$aZo Ho$

H$maU MyH$ hþE IarXXmam| na Xmdm| Ho$ ‘yë¶ A§Va, à^ma,

ã¶mO Am{X H$mo XO© {H$¶m h¡ & 31.03.2019 H$mo XO©

{H$E JE Xmdm| H$s am{e é. 27255.51 bmI ({nN>bo

df© é. 27508.25 bmI) h¡ & {nN>bo VrZ dfm} ‘| {ZJ‘

Eogo {S>’$m°ëQ> IarXXmam| go {ZåZ{b{IV am{e àmßV hþB©

Wr &

(ê$. bmI ‘|)

{dÎmr¶ df© àmß¶ am{e*

2017-18 906.14

2016-17 793.33

2015-16 69.64

*Bg‘| {S>’$mëQ> IarXXmam| Ûmam {H$¶o J¶o H$moQ>© gwbh em{‘b h¡ &

Cnamoº$ AZw^d Ho$ AmYma na, {ZJ‘ H$m ‘mZZm h¡ {H$ eof

‘m‘bm| ‘| AZwHy$b n[aUm‘ g§^m{dV h¡ & d¡go ^r, ¶h Cgr Vah

Ho$ {dÎmr¶ à^mdm| H$m AZw‘mZ bJmmZo Ho$ {bE Aì¶mdhm[aH$ h¡

Š¶m|{H$ BgH$s agrX {ZU©¶m| Ho$ n[aUm‘ na {Z^©a h¡ Am¡a dhm±

{ZînmXZ h¡ &

34. Ý¶yZV‘ g‘W©Z ‘yë¶ n[aMmbZ ‘| hþB© hm{Z¶m| H$s

à{Vny{V©

^maV gaH$ma, dó ‘§Ìmb¶ go à{Vny{V© ¶mo½¶ Ý¶yZV‘

‘yë¶ n[aMmbZ Ho$ boI| ‘| hþB© hm{Z¶m± ¶{X H$moB© hm|, Vmo

CÝh| àmoØdZ ar{V Ho$ AmYma na boIm§{H$V {H$¶m J¶m

h¡ VWm My±{H$ ¶h n[aMmbZ H§$nZr H$s ‘w»¶ ì¶mnm[aH$

J{V{d{Y¶m| go g§~§{YV h¡ Bgr{bE BÝh| Am°naoqQ>J amOñd

Ho$ ê$n ‘| àH$Q>Z {H$¶m J¶m h¡ & {dÎmr¶ df© 2018-19

Ho$ Xm¡amZ {XZm§H$ 31.03.2018 VH$ àmá H$aZo ¶mo½¶

E‘Egnr hm{Z¶m| Ho$ {dê$Õ ^maV gaH$ma Zo 91196.00

bmI ê$. H$s à{Vny{V© H$s h¡ & {XZm§H$ 31.03.2019 H$mo

àmá H$aZo ¶mo½¶ am{e 255752.03 bmI ê$. h¡ (JV

df© 314452.64 bmI ê$.)

{dÎmr¶ df© 2018-19 Ho$ Xm¡amZ g‘W©Z ‘yë¶ n[aMmbZ

ImVo na hþB© hm{Z 32495.39 bmI ê$n¶o (JV df©

28890.41 bmI ê$n¶o) h¡, {OgH$s à{Vny{V© Omo ^maV

gaH$ma Ûmam H$s OmZr h¡ & BZ‘| {ZåZ ì¶¶/hm{Z¶m±

em{‘b h¡ :-

162

^m.H$.{Z.

C.C.I.


i) Administrative, establishment expensesand depreciation for the financial year2018-19, apportioned on the basis ofvolume(numberofbales)ofpurchaseandsaleshandledduringtheyearunderMSPandCPoperations.

ii) Interestonfundsdeployed,computedforthefollowingperiods:-

a) Process cycle for conversion ofbalesi.e.fromthedateofpurchaseofkapasuptothedateofpressingofbales.

b) For bales sold and lifted - from thedate of pressing of bales up to thedateofliftingofbales.

c) Forunsoldbalesandbalessoldbutunliftedfromthedateofpressingofbalestilltheendoftheyeari.e.31st March2019.

d) Forunsoldbalesandbalessoldbutnotliftedatthebeginningoftheyearfrom1stApriltodateoflifting.

e) For the amount outstanding in thebeginning of the year, interest ischargedtillreceiptofthepayment.

iii) Tarpaulins expenditure allocated on thebasisofpurchasevalueofcotton.

iv) Hessian/grey cloth expenditure allocatedon the basis of the number of balespressed.

v) AmortizationoftestingequipmentnamelyMicronaire Testers and Moisture Meters,purchased during the year amounting toRs.133.67lakh(PreviousyearRs.Nil).

vi) Selling and Distribution expenses onactualbasis.

i) {dÎmr¶ df© 2018-19 Ho$ {bE àemg{ZH$, ñWmnZm

ì¶¶ d ‘yë¶õmg H$m df© Ho$ Xm¡amZ E‘Egnr d grnr

n[aMmbZ Ho$ A§VJ©V H«$¶-{dH«$¶ Ho$ dm°ë¶y‘ Ho$

AmYma na à^mOZ {H$¶m Om gH$Vm h¡ &

ii) {Z{Y¶m| na ã¶mO, {Z{Y Ho$ {bE JUZm H$s JB©

Ad{Y h¡ :-

H$) Jm±R>m| ‘| ~XbZo H$s g§gmYZ à{H«$¶m ¶m{Z

H$nmg H$s IarX H$s VmarI go Jm±R>m| H$s

àoqgJ H$s VmarI VH$ &

I) ~oMr JB© Am¡a CR>m¶r JB© Jm±R>m| Ho$ {bE -

Jm±R>m| Ho$ àoqgJ H$s VmarI go Jm±R>| CR>mZo H$s

VmarI VH$ &

J) AZ{~H$s Jm±R>| Am¡a ~oMr J¶r bo{H$Z Z CR>dmB© JB© Jm±R>m| Ho$ {bE - Jm±R>m| H$s àoqgJ H$s VmarI go Jm±R>m| Ho$ CR>m¶o OmZo VH$

31.03.2019 &

K) Z ~oMr JB© Jm±R>o VWm ~oMr JB© Jm±R>m| na§Vw df© Ho$ àma§^ go Z CR>m¶r JB© Jm±R>m| Ho$ {bE - 1 Aà¡b go CR>mZo H$s VmarI VH$

M) df© Ho$ Ama§^ ‘| ~H$m¶m am{e Ho$ {bE wJVmZ

H$s àm{á VH$ ã¶mO bJm¶m J¶m h¡&

iii) H$nmg Ho$ IarX ‘yë¶ Ho$ AmYma na {Vanmbm| Ho$

IMm} H$mo Am~§{Q>V {H$¶m J¶m h¡ &

iv) àog H$s JB© Jm±R>m| H$s g§»¶m Ho$ AmYma na h¡{g¶Z

/J«o H$n‹S>o Ho$ IMm} H$mo Am~§{Q>V {H$¶m J¶m h¡ &

v) df© Ho$ Xm¡amZ ‘m¶H«$moZo¶a Q>oñQ>a VWm ‘m¡BñMa ‘rQ>g© O¡go narjU gm‘J«r Ho$ n[aemoYZ H$s bmJV H$s IarX H$s am{e 133.67 bmI ê$. h¡ (JV df©

eyÝ¶ ê$n¶o)&

vi) {dH«$¶ Am¡a {dVaU ì¶¶ dmñV{dH$ AmYma na &

163


^m.H$.{Z.

C.C.I.

35. ~’$a ñQ>m°H$ n[aMmbZ H$s à{Vny{V©

dó ‘§Ìmb¶, ^maV gaH$ma Ho$ AmXoemZwgma {ZJ‘ Zo

JwOamV amÁ¶ ‘| H$nmg ‘m¡g‘ 2011-12 Ho$ Xm¡amZ

~’$a ñQ>m°H$ Ho$ A§VJ©V IarX H$m¶© {H$¶m & {ZJ‘ H$mo

3173.08 bmI ê$n¶o H$s hm{Z hþB© VWm {Ogo BZ

hm{Z¶m| H$s à{Vny{V© ^maV gaH$ma Ûmam {dÎmr¶ df©

2012-13 Ho$ Xm¡amZ {H$¶o OmZo hoVw boIm§{H$V {H$¶m

J¶m &

dó ‘§Ìmb¶ Zo Cnamoº$ g§X{^©V 3173.08 bmI ê$. Ho$

gm‘Zo df© 2013-14 Ho$ Xm¡amZ Ho$db 1015.94 bmI

ê$. H$s am{e H$s à{Vny{V© H$s h¡ VWm eof 2157.14

bmI ê$. dgybr H$s A{Z{üVVm Ho$ H$maU {dÎmr¶ df©

2013-14 ‘| g§{X½Y dgybr hoVw àmdYmZ {H$¶m h¡ (ZmoQ>

10 XoI|) &

36. AÝ¶ n[aMmbZ amOñd

AÝ¶ n[aMmbZ Am¶ ‘| 577.30 bmI ê$. (JV df©

906.14 bmI ê$.) em{‘b h¡ Omo MyH$H$Vm© IarXXmam| go

CZH$mo Ama§^ ‘| ~oMr J¶r ‘mÌm H$s nwZ: {~H«$s go CËnÞ

hm{Z¶m| Ho$ {bE O‘m am{e, A{J«‘, H¡$[a¨J MmO}g, O‘m

eof Am¡a Cg na ã¶mO Ho$ {bE h¡ &

37. eof H$s nw{ï> /g‘mYmZ

H§$nZr àË¶oH$ {dÎmr¶ df© Ho$ A§V ‘| g^r IarXXmam|/

Amny{V©H$Vm©Am| H$mo gm§{d{YH$ boIm narjH$m| H$mo grYo eof

am{e H$s nw{ï> H$aZo Ho$ AZwamoY Ho$ gmW eof nw{ï>H$aU nÌ

^oOZo H$s àUmbr H$m AZwgaU H$aVr h¡ & 31.03.2019

H$mo {dÎmr¶ {ddaU ‘| Xem©B© JB© am{e nw{ï> / gwbh Am¡a

n[aUm‘ñdê$n g‘m¶moOZ Ho$ AYrZ h¡, ¶{X H$moB© hmo&

35 ReimbursementofBufferStockOperation

As per mandate given by Government ofIndia,MinistryofTextiles,theCorporationhadundertakenbufferstockoperationsinthestateof Gujarat during the cotton season 2011-12. Losses amounting to Rs. 3173.08 lakhwereaccountedforbeingreimbursablebytheGovernmentofIndiaduringfinancialyear2012-13.

Ministry of Textiles reimbursed only a sum ofRs.1015.94 lakhduring theyear2013-14outofRs.3173.08lakhreferredtoaboveandthebalance Rs.2157.14 lakh was provided fordoubtful recoveries (ReferNoteno.10) in thefinancial year 2013-14 due to uncertainty ofrecovery.

36 Otheroperatingrevenue

Other operating revenue includes Rs.577.30lakh (previous year Rs.906.14 lakh) towardsdeposits, advance carrying charges, creditbalances and interest thereon received fromdefaultingbuyersforlossesarisingoutofresaleofquantitiesinitiallysoldtothem.

37 BalanceConfirmation/Reconciliation

The Company follows the system of sendingthe balance confirmation letters to all thebuyers/suppliersatendofeachfinancialyearwith a request to confirm the balancedirectlyto the Statutory Auditors. Amount shown inthe financial statement as on 31.03.2019 aresubject to confirmation/reconciliation andconsequentadjustments,ifany.

164

^m.H$.{Z.

C.C.I.


38 gyú‘, bKw Ed§ ‘Ü` ‘ CnH«$‘ {dH$mg A{Y{Z`‘,

2006

gyú‘, bKw Ed§ ‘Ü`‘ CnH«$‘ {dH$mg A{Y{Z`‘, 2006

Ho$ A§VJ©V àH$Q>rH$aU :

H§$nZr Zo Amny{V©H$Vm© VWm godm àXmZ H$aZodmbr g§ñWmAm|

go nw{ï> àmá H$s h¡, {OÝhm|Zo gyú‘, bKw Ed§ ‘Ü`‘

CnH«$‘ {dH$mg A{Y{Z`‘, 2006 (E‘EgE‘B©S>r EŠQ>,

2006) Ho$ A§VJ©V {OÝhm|Zo AnZo AmnH$mo a{OñQ>S©> {H$`m

h¡ VWm H§$nZr Ho$ nmg CnbãY OmZH$mar Ho$ AmYma na

E‘EgE‘B©S>r EŠQ>, 2006 Ho$ A§VJ©V ‘m`H«$mo, ñ‘mb

E§S> ‘r{S>`‘ EÝQ>aàmB©Oog H$mo Xo` eof 1872.74 bmI

ê$n`o h¡ ({nN>bo df© 64.93 bmI ê$.)

(i) àË¶oH$ boIm df© Ho$ A§V ‘| {H$gr Amny{V©H$Vm© H$mo

‘yb am{e VWm Cg na Xo¶ ã¶mO H$m eof ^wJVmZ :

(ê$. bmI ‘|)

H$mo g‘má {dÎmr¶ df©

‘yb* ã¶mO

31.03.2014 38.01 134.66

31.03.2015 554.78 136.73

31.03.2016 66.98 139.91

31 ‘mM©, 2019 VH$ H$s nw{ï>/gm‘§Oñ¶ H$s pñW{V {ZåZmZwgma h¡ : Thestatusofbalanceconfirmed/reconciledasat31stMarch2019isasunder:-

(ê$. bmI ‘|) /(Rs.inlakh)

{ddaU Particulars

31 ‘mM© 2019 H$mo eof

Balanceasat31stMarch

2019

eof H$s nw{ï> / g‘mYmZ Balance

Reconciled/Confirmed

[aH§${gboeZ Ho$ {bE b§{~V

PendingforReconciliation

eof Ho$ % H$s nw{ï>/{‘bmZ Zht {H$¶m J¶m%ofbalancenotconfirmed/reconciled

ì¶mnma àmß¶ (EZQ>rgr)TradeReceivables(NTC) 6853.83 6240.89 612.94 8.94

EZQ>rgr Ho$ Abmdm AÝ¶ àmß¶ ì¶mnmaTradeReceivablesotherthanNTC 41.49 10.86 30.63 73.83

ES>dm§g J«mhH$mo go àmß¶ AdvanceReceivedfromCustomers 2199.87 120.37 2079.5 94.53

ì¶mnma àmß¶ / TradePayables 6095.51 6.56 6088.95 99.89

B©E‘S>r/{S>nmo{OQ>/à{VYmaU YZEMD/Deposits/RetentionMoney 4802.66 1.50 4801.16 99.97

38 Micro, Small and Medium Enterprises Development Act, 2006

DisclosureasrequiredunderMicro,SmallandMediumEnterprisesDevelopmentAct,2006:

The Company has obtained confirmationsfrom suppliers and service providers whohave registered themselves under the Micro,Small and Medium Enterprises DevelopmentAct, 2006 (MSMEDAct, 2006) and based onthe information available with the Company,balance due to Micro, Small and MediumEnterprises defined under the MSMED Act,2006 is Rs.1872.74 lakh (Previous year Rs.64.93lakh).

(i) The principal amount and the interest duethereonremainingunpaidtoanysupplierasattheendofeachaccountingyear:

(Rs.inLakh)

FinancialYearend Principal* Interest

31.03.2014 38.01 134.66

31.03.2015 554.78 136.73

31.03.2016 66.98 139.91

165


^m.H$.{Z.

C.C.I.

31.03.2017 105.94 139.92

31.03.2018 64.93 141.85

31.03.2019 1872.74 152.24

* Bg‘| ã`mO ‘wº$ gwajm O‘m am{e em{‘b h¡ Omo g§{dXm H$s eVm}

Ho$ AZwgma R>oHo$Xmam| go àmá hþAm h¡&

(ii) àËòH$ boIm df© Ho$ Xm¡amZ {Z`V {XZ Ho$ ~mX

Amny{V©H$Vm© H$mo {H$E JE ^wJVmZ H$s am{e Ho$

gmW ‘m`H«$mo, ñ‘m°b AÝS> {‘{S>`‘ BÝQ>aàmBOog

So>dbn‘|Q> E°ŠQ> - 2006 H$s Ymam - 16 H$s eVm}

Ho$ AZwgma IarXXma Ûmam ^wJVmZ H$s JB© ã`mO H$s

am{e 'eyÝ`' h¡& (JV df© eyÝ` ê$nò) Cnamoº$ (i) Ho$ AZwgma ^wJVmZ `mo½` am{e H$mo N>mo‹S>H$a &

(iii) ã`mO H$s am{e Omo ^wJVmZ Xoar go H$aZo Ho$ H$maU

h¡, Xo` Ed§ ^wJVmZ `mo½` h¡ (df© Ho$ Xm¡amZ {Z`V

VmarI Ho$ ~mX {OgH$m ^wJVmZ {H$`m J`m h¡) na§Vw

Bg A{Y{Z`‘ Ho$ A§VJ©V é. 9.29 ã`mO em{‘b

Zht {H$`m J`m h¡ & (JV df© eyÝ` ê$nò)

(iv) àËòH$ boIm df© Ho$ A§V ‘| Cnm{O©V ã`mO am{e Am¡a

eof AàXÎm am{e {ZåZmZwgma h¡ :(ê$. bmI ‘|)

H$mo g‘mßV {dÎmr` df© am{e

31.03.2014 134.66

31.03.2015 136.73

31.03.2016 139.91

31.03.2017 139.92

31.03.2018 141.85

31.03.2019 152.24

(v) AmJo Xo` ã`mO H$s ~H$m`m am{e Am¡a AmJm‘r dfm}

‘| ^r Xo` Cg VmarI VH$ O~ Cn`w©º$ ~H$m`m am{e

dmñV{dH$ ê$n go N>moQ>o CÚ‘m| H$mo ^wJVmZ {H$`m J`m

h¡, Omo ‘m`H«$mo, ñ‘m°b E§S> {‘{S>`‘ BÝQ>aàmBOog

So>dbn‘|Q> EŠQ> - 2006 H$s Ymam-23 Ho$ A§VJ©V

H$Q>m¡Vr `mo½` ì`` Ho$ ê$n ‘| {S>gAbmCÝg à`moOZ

Ho$ {bE Xo` 152.24 bmI ê$nò h¡ & (JV df©

141.85 bmI ê$nò)

H§$nZr Ho$ nmg Cnamoº$ OmZH$mar {Og gr‘m VH$

CnbãY h¡, Xr JB© h¡ &

31.03.2017 105.94 139.92

31.03.2018 64.93 141.85

31.03.2019 1872.74 152.24

*Includesinterestfreesecuritydepositsreceivedfromcontractorsasperthetermsofthecontract.

(ii) TheamountofinterestpaidbytheCompanyin termsofsection16of theMicro,SmallandMediumEnterprisesDevelopmentAct,2006,alongwithamountofpaymentmadetothesuppliersbeyondtheappointeddayduringeachaccountingyearisNil(PreviousyearNil),exceptamountspayableasin(i)above.

(iii) The amount of interest due and payablefortheperiodofdelayinmakingpayment(which have been paid but beyond theappointeddayduringtheyear)butwithoutaddingtheinterestspecifiedunderthisActisRs.9.29(PreviousyearNil).

(iv)The amount of interest accrued andremaining unpaid at the end of eachaccountingyearisasunder:

(Rs.inlakh)FinancialYearend Amount

31.03.2014 134.6631.03.2015 136.7331.03.2016 139.9131.03.2017 139.9231.03.2018 141.8531.03.2019 152.24

(v) The amount of further interest remainingdue and payable even in the succeedingyears, until such date when the interestduesasaboveareactuallypaidtothesmallenterprise,forthepurposeofdisallowanceasadeductibleexpenditureunderSection23ofMicro,SmallandMediumEnterprisesDevelopmentAct,2006isRs.152.24lakh(PreviousyearRs141.85lakh).

TheaboveinformationisgiventotheextentavailablewiththeCompany.

166

^m.H$.{Z.

C.C.I.


39 Liquidated damages recoverable from various mills

Onaccountofliquidateddamagesrecoverablefrom various mills for their failure to lift thecontracted bales an amount of loss of Rs.1679.63 lakh (Previous year Rs. 1679.63Lakh)onresaleofcottonimportedonbehalfofGovernment of India during the year 1976-77and1977-78wereoutstanding.ThesamehasalreadybeenreceivedbytheCompanyfromtheGovernment of India. The losses recoverabletowards liquidated damages against suchdefaultersarependinginlargenumberofcasesbefore Honorable Bombay High Court. Theamount collected from the defaulted buyers,pending such cases, shall be accounted foronsettlementofsuchcasesandarecurrentlyshownundertheheadofNon-Currentliabilitiesbeing payable to the Government of India(ReferNoteNo.19A).

40 EmployeeBenefits

DetailsofEmployeeBenefitsasrequiredbytheIndAS19–“EmployeeBenefits”areasfollows:

A. DefinedContributionPlans:

TheCompanymakescontributions,determinedas a specified percentage of employeesalaries, in respect of qualifying employeestowards Provident Fund and SuperannuationFundwhicharedefinedcontributionplans.TheCompanyhasnoobligationotherthantomakethe specified contributions. The contributionsarechargedtothestatementofprofitandlossastheyaccrue.

Provident Fund

The company operates plan for its employees toprovideemployeebenefitsinthenatureofprovidentfund. Eligible employees receive benefits from aprovident fund, which is defined contribution plan.Both theemployeeandthecompanymakemonthlycontribution to the provident fund plan equal to aspecified percentage of the covered employee’ssalary.TheCompanycontributesfixedcontributionof

39. {d{^{Þ {‘ëg§ go dgybr `mo½` j{V H$m n[ag‘mnZ

df© 1976-77 Am¡a 1977-78 Ho$ Xm¡amZ ^maV

gaH$ma H$s Amoa go Am`mV H$s JB© H$nmg H$s nwZ: {~H«$s

na 1679.63 bmI ê$nò (JV df© 1679.63 bmI

ê$nò) H$s am{e hm{Z Ho$ {bE g§{dXmJV Jm±R>| {d{^Þ {‘bm|

Ûmam Z CR>mZo Ho$ H$maU dgybr `mo½` n[ag‘mnZ j{V Ho$

H$maU ~H$m`m Wr & H§$nZr H$mo ^maV gaH$ma go BgH$s

àm{á hmo MwH$s h¡ & Bg àH$ma Ho$ MyH$H$Vm©Am| Ho$ {dê$ÜX

n[ag‘mnZ j{V Ho$ ê$n ‘| dgybr `mo½` hm{Z`m± ‘mZZr`

‘w§~B© Cƒ Ý`m`mb` ‘| ~‹S>r g§»`m, ‘| ‘m‘bm| Ho$ ê$n ‘|

b§{~V h¢ & MyH$H$Vm© IarXXmam| go O‘m H$s J`r am{e, Eogo

‘m‘bo Ho$ b§{~V ahZo VH$ ^maV gaH$ma H$mo Xo` J¡a Mmby

Xo`VmE°§ erf© Ho$ A§VJ©V (g§X^© ZmoQ>-19E) Bg àH$ma Ho$

‘m‘bm| Ho$ {ZnQ>mZ hoVw br J`r h¡ &

40. H$‘©Mmar bm^

B§S> EEg 19 - "'H$‘©Mmar bm^'' Ûmam Ano{jV H$‘©Mmar

bm^m| Ho$ ã`m¡ao {ZåZmZwgma h¡ :

H$) n[a^m{fV A§eXmZ `moOZm

H§$nZr CZ H$‘©Mm[a`m| go g§~§{YV Omo ^{dî` {Z{Y VWm

A{Yd{f©Vm {Z{Y Ho$ {bE `mo½` h¡ H$‘©Mmar H$mo {d{eï>§

doVZ go {ZYm©[aV A§eXmZ XoVm h¡ Omo n[a^m{fV A§eXmZ

`moOZm h¡ & Bg {d{eï> A§eXmZ XoZo Ho$ Abmdm H§$nZr Ho$

AÝ` H$moB© Xm{`Ëd Zht h¡ & ò A§eXmZ bm^ AWdm hm{Z

{ddaUr ‘| MmO© {H$E OmVo h¢ Omo àmoX^dZ Ho$ AZwgma h¢&

^{dî` {Z{Y

H§$nZr ^{dî` {Z{Y H$s àH¥${V ‘| AnZo H$‘©Mm[a`m| H$mo H$‘©Mmar

bm^ àXmZ H$aZo Ho$ {bE `moOZm H$m n[aMmbZ H$aVr h¡ &

nmÌ H$‘©Mmar ^{dî` {Z{Y go bm^ àmá H$aVo h¡ Omo n[a^m{fV

A§eXm`r `moOZm h¡ & H$‘©Mmar Ed§ H§$nZr XmoZm| ^{dî` {Z{Y

`moOZm ‘| ‘m{gH$ ê$n go A§eXmZ H$aVo h¢ Omo H$‘©Mmar doVZ H$mo

H$da H$aVo hþE {d{eï> à{VeV Ho$ g‘mZ h¡ & H§$nZr EH$ AbJ

167


^m.H$.{Z.

C.C.I.

Q´ñQ> H$mo nyd© {ZYm©[aV Xa na ^{dî` {Z{Y H$m {Z`V A§eXmZ

H$aVr h¡ (^mH${Z H$‘©Mmar A§eXmZ ^{dî` {Z{Y) Omo AZw‘{V

àXmZ à{V^y{V`m| ‘| {Z{Y H$mo {Zdoe H$aVm h¡ & Q´ñQ> AnZo gXñ`m|

H$mo A§eXmZ na Ý`y{ZV‘ ã`mO H$s Xa go wJVmZ H$aVr h¡ & {Z{Y

‘| {Zdoe na [aQ>©Z H$mo em{‘b H$aVo hþE {Z{Y ‘| CnbãY am{e

H§$nZr Ho$ Xm{`Ëd go A{YH$ h¡ & H§$nZr ^{dî` {Z{Y ‘| ^wJVmZ

`mo½` A§eXmZ H$mo ì`` Ho$ ê$n ‘| ‘mÝ`Vm XoVr h¡ &

A{Yd{f©Vm

H§$nZr Zo {XZm§H$ 01.11.1995 go g^r {Z`{‘V H$‘©Mm[a`m| Ho$

{bE mH${Z H$‘©Mmar A§eXm`r A{Yd{f©Vm {Z{Y ‘| g§emoYZ {H$`m

h¡ & H§$nZr EH$ {d{eï> Q´>ñQ> H$mo nmÌ am{e H$m A§eXmZ H$aVr

h¡ (^mH${Z H$‘©Mmar A§eXm`r ^{dî` {Z{Y) Omo AZw‘{V àmá

à{V^y{V`m| ‘| {Z{Y {Zdoe H$aVr h¡ & H§$nZr A{Yd{f©Vm ‘| wJVmZ

`mo½` A§eXmZ H$mo ì`` Ho$ ê$n ‘| ‘mÝ`Vm XoVr h¡ &

H§$nZr Zo {ZåZ{bpIV am{e H$mo bm^ d hm{Z H$s {ddaUr ‘|

‘mÝ`Vm Xr JB© h¡ & (ZmoQ> 26 XoI|) : (ê$. bmI ‘|)

{ddaU 2018-2019(bmI ê$. ‘|)

2017-2018(bmI ê$. ‘|)

^{dî` {Z{Y VWm n|eZ {Z{Y ‘| A§eXmZ

564.35 501.06

A{Yd{f©Vm {Z{Y ‘| A§eXmZ 694.50 85.67

I) n[a^m{fV bm^ `moOZm -

{XZm§H$ 31.03.2019 H$mo ~r‘m§{H$H$ ‘yë`m§H$Z Ho$

AZwgma VWm H$‘©Mmar bm^ `moOZmAm| H$mo {dÎmr`

{dda{U`m| ‘| ‘mÝ`Vm Xr JB© h¡ &

providentfundatapredeterminedratetoaseparatetrust(TheCottonCorporationofIndiaLtdEmployees’ContributoryProvidentFundTrust)whichinveststhefunds in permitted securities. The trust is requiredtopayaminimumrateof interestoncontribution tomembersof trust.Theamountavailable in the fundincludingthereturnoninvestmentisgreaterthantheobligationofthecompany.Thecompanyrecognizescontributionpayabletotheprovidentfundschemeasexpenditure.

Superannuation

The Company has implemented ‘The CottonCorporation of India Ltd Employees’ ContributorySuperannuationFund’w.e.f.01.11.1995forallregularemployees.TheCompanycontributeseligibleamounttoaseparate trust (TheCottonCorporationof IndiaLtd Employees’ Contributory Superannuation FundTrust)whichinveststhefundsinpermittedsecurities.Thecompanyrecognizescontributionpayabletothesuperannuationfundschemeasexpenditure.

TheCompanyhasrecognizedthefollowingamountsintheStatementofProfitandLoss(Refernote26):

(Rs.inlakh)

Particulars 2018-19(Rs.inlakh)

2017-2018(Rs.inlakh)

ContributiontoProvidentFundandPensionFund

564.35 501.06

ContributiontoSuperannuationFund

694.50 85.67

B DefinedBenefitPlans-

As per Actuarial Valuation as on 31.03.2019and recognized in the financial statements inrespectofEmployeeBenefitSchemes:

168

^m.H$.{Z.

C.C.I.


1. amoOJma Ho$ ~mX bm^

H§$nZr ‘| amoOJma Ho$ ~mX bm^ `moOZmE°§ {ZåZ{bpIV h¡ :

i. Aënmd{Y H$‘©Mmar bm^

g^r H$‘©Mm[a`m| H$mo ~mah ‘hrZo godmE°§ XoZo Ho$ ^rVa

nyar Vah go Xo` H$mo Aënmd{Y H$‘©Mmar bm^ Ho$

ê$n ‘| dJuH¥$V {H$`m OmVm h¡ VWm H$‘©Mm[a`m| Ûmam

Xr JB© g§~§{YV godmAm| H$s Ad{Y ‘| BgH$s ‘mÝ¶Vm

Xr OmVr h¡ & Xo`Vm (Cnm{O©V ì¶`) Ho$ ê$n ‘| Xr

JB© godmAm| Ho$ ~Xbo nhbo go ^wJVmZ H$s JB© {H$gr

am{e H$s H$Q>m¡Vr Ho$ nümV ^wJVmZ H$s JB© Ano{jV

Aënmd{Y H$‘©Mmar bm^ H$s AZ{S>ñH$mD$§Q>oS> am{e

H$mo ‘mÝ`Vm Xr OmVr h¡&

ii. AÝ` XrKm©d{Y H$‘©Mmar bm^

H§$nZr Ho$ {Z`‘m| Ho$ AZwgma df© Ho$ {bE A{O©V

AdH$me VWm AY©doVZ H$s Xo`VmE°§ àmoOoŠQ>oS> `y{ZQ>

H«o${S>Q> ‘oWS> H$mo AnZmVo hþE EŠ`wab ‘yë`m§H$Z na

‘mÝ`Vm Xr OmVr h¡ &

^maVr` boIm ‘mZH$ 19 (B§S> EEg 19) Ho$ AZwgma AdH$me

Xo`VmAm| H$m àH$Q>rH$aU

01/04/2018 - 31/03/2019 VH$ H$s Ad{Y Ho$ {bE

(ê$. bmI ‘|)

Mmby Ad{Y nyd© Ad{Y

bm^ H$m àH$ma AdH$me AdH$me

Xoe ^maV ^maV

[anm{Q>ªJ ‘wÐm AmB©EZAma AmB©EZAma

[anmo{Q>ªJ ‘mZH$ ^maVr` boIm§{H$V ‘mZH$ 19

(B§S>EEg 19)

^maVr` boIm§{H$V ‘mZH$ 19

(B§S>EEg 19)

{dÎm nmo{fV pñW{V J¡a {dÎm nmo{fV J¡a {dÎm nmo{fV

Ama§^ H$s Ad{Y 01-Aà¡b-18 01-Aà¡b-17

[anmo{Q>ªJ H$s VmarI 31-‘mM©-19 31-‘mM©-18

[anmo{Q>ªJ Ad{Y 12 ‘{hZo 12 ‘{hZo

1. Post-employmentbenefits

The company has the following post –employmentbenefitplans:

i. Shorttermemployeebenefits

Allemployeebenefitspayablewhollywithintwelvemonthsofrenderingtheserviceareclassifiedasshorttermemployeebenefitsand they are recognized in the period inwhich the employee renders the relatedservice. It recognizes the undiscountedamount of short term employee benefitsexpected to be paid in exchange forservices rendered as a liability (accruedexpense) after deducting any amountalreadypaid.

ii. OtherLongtermemployeebenefits

TheliabilitytowardsearnedleaveandhalfpayleavefortheyearasperrulesofCompanyisrecognizedonthebasisofactuarialvaluationcarried out by using projected unit creditmethod.

Leave Disclosure Statement as Per Indian AccountingStandard19(IndAs19)

Fortheperiod01/04/2018-31/03/2019

(Rs.inlakh)

CurrentPeriod PreviousPeriod

TypeofBenefit Leave LeaveCountry India IndiaReportingCurrency INR INR

ReportingStandard

IndianAccountingStandard19(IndAS19)


FundingStatus Unfunded UnfundedStartingPeriod 01-Apr-18 01-Apr-17

DateofReporting 31-Mar-19 31-Mar-18PeriodofReporting 12Months 12Months

169


^m.H$.{Z.

C.C.I.

‘mÝ`VmE°§ (Ama§{^H$ Ad{Y)(ê$. bmI ‘|)

`moOZm n[ag§n{Îm`m| na Ano{jV [aQ>Z©

bm.Z. bm.Z.

{S>ñH$mD$§qQ>J H$s Xa 7.78% 7.27%

doVZ ‘| d¥{Õ H$s Xa 7.00% 7.00%

H$‘©Mmar Q>Z©Amoda H$s Xa 2.00% 2.00%

amoOJma Ho$ Xm¡amZ ‘m°aQ>¡{bQ>r

^maVr` AmœmgZ OrdZ

‘m°aQ>¡{bQ>r (2006-08)

^maVr` AmœmgZ OrdZ

‘m°aQ>¡{bQ>r (2006-08)

amoOJma Ho$ nümV ‘m°aQ>¡{bQ>r Xa

bm.Z. bm.Z.

‘mÝ`VmE°§ (g‘mnZ Ad{Y)(ê$. bmI ‘|)


bm.Z. bm.Z.

{S>ñH$mD§$qQ>J H$s Xa 7.76% 7.78%

doVZ ‘| d¥{Õ H$s Xa 7.00% 7.00%


amoOJma Ho$ Xm¡amZ ‘m°aQ>¡{bQ>r

^maVr` AmœmgZ OrdZ

‘m°aQ>¡{bQ>r (2006-08)

^maVr` AmœmgZ OrdZ

‘m°aQ>¡{bQ>r (2006-08)


bm.Z. bm.Z.

Assumptions(OpeningPeriod)(Rs.inlakh)

ExpectedReturnonPlanAssets N.A. N.A.

RateofDiscounting 7.78% 7.27%

RateofSalaryIncrease 7.00% 7.00%

RateofEmployeeTurnover 2.00% 2.00%

MortalityRateDuringEmployment

IndianAssuredLives

Mortality(2006-08)

IndianAssuredLives

Mortality(2006-08)

MortalityRateAfterEmployment N.A. N.A.

Assumptions(ClosingPeriod)

(Rs.inlakh)

ExpectedReturnonPlanAssets N.A. N.A.





IndianAssuredLives

Mortality(2006-08)

IndianAssuredLives

Mortality(2006-08)


170

^m.H$.{Z.

C.C.I.


àmoOoŠQ>oS> bm^ Xm{`Ëd> H$m dV©‘mZ ‘yë` ‘| n[adV©Z Xem©Zodmbr {ddaUr TableShowingChangeinthePresentValueofProjectedBenefitObligation


Mmby Ad{Y CurrentPeriod

nyd© Ad{YPreviousPeriod

Ad{Y Ho$ Ama§^ ‘| bm^ Xm{`Ëd H$m dV©‘mZ ‘yë`PresentValueofBenefitObligationattheBeginningofthePeriod 2179.17 2191.01

ã`mO bmJV / InterestCost 169.54 159.29

Mmby godm bmJV / CurrentServiceCost 143.57 133.86

VËH$mbrZ godm bmJV - J¡a {ZhrV Ad{Y Ho$ Xm¡amZ {H$E JE bm^ PastServiceCost-Non-VestedBenefitIncurredDuringthePeriod - -

VËH$mbrZ godm bmJV Ad{Y Ho$ Xm¡amZ {H$E JE bm^ {ZhrV PastServiceCost-VestedBenefitIncurredDuringthePeriod - -

à{VJ«hU ‘| Xo`VmE°§ A§VaU / LiabilityTransferredIn/Acquisitions - -

{d{Zdoe / Xo`VmE°§ A§VaU / (LiabilityTransferredOut/Divestments) - -

(bm^)/ H$Q>m¡Vr na hm{Z`m± / (Gains)/LossesonCurtailment - -

({ZnQ>mZ na Xo`VmE°§ {ZH$mbr JB©) / (LiabilitiesExtinguishedonSettlement) - -

({Z`moº$m Ûmam grYo bm^ ^wJVmZ) / (BenefitPaidDirectlybytheEmployer) (506.23) (738.13)

({Z{Y go bm^ ^wJVmZ) / (BenefitPaidFromtheFund) - -

{dXoer ‘wÐm Xam| ‘| hþE n[adV©Zm| Ho$ à^md TheEffectOfChangesinForeignExchangeRates - -

OZgm§p»`H$s YmaUmAm| ‘| n[adV©Z Ho$ H$maU ~r‘m§{H$H$ bm^/hm{Z na Xm{`Ëd Actuarial(Gains)/LossesonObligations-DuetoChangeinDemographicAssumptions - -

{dÎmr¶ YmaUmAm| ‘| n[adV©Z Ho$ H$maU ~r‘m§{H$H$ bm^/hm{Z na Xm{`Ëd Actuarial (Gains)/Losses onObligations -Due toChange in FinancialAssumptions 4.18 (81.14)

AZw^d Ho$ H$maU YmaUmAm| ‘| n[adV©Z Ho$ H$maU ~r‘m§{H$H$ bm^/hm{Z na Xm{`Ëd Actuarial(Gains)/LossesonObligations-DuetoExperience 138.80 514.28

Ad{Y H$s g‘m{á na bm^ Xm{`Ëdn H$m dV©‘mZ ‘yë`PresentValueofBenefitObligationattheEndofthePeriod 2129.04 2179.17

`moOZm n[ag§n{Îm Ho$ C{MV ‘yë` ‘| n[adV©Z Xem©Zodmbr {ddaUrTable Showing Change in the Fair value of plan assets

(ê$. bmI ‘|)/(Rs.inlakh)

Ad{Y Ho$ Ama§^ ‘| `moOZm n[ag§n{Îm Ho$ C{MV ‘yë`>FairValueofPlanAssetsattheBeginningofthePeriod - -

ã`mO bmJV / InterestIncome - -

{Z`moº$m Ûmam A§eXmZ / ContributionsbytheEmployer (20.02) -

H$‘©Mm[a`m| Ûmam Ano{jV A§eXmZ / ExpectedContributionsbytheEmployees 20.02 -

n[ag§n{Îm`m± A§VaU/YmaU / AssetsTransferredIn/Acquisitions - -

171


^m.H$.{Z.

C.C.I.

n[ag§n{Îm`m± ~mha A§VaU / {d{Zdoe / (AssetsTransferredOut/Divestments) - -

({Z{Y go bm^ ^wJVmZ) / (BenefitPaidfromtheFund) - -

({ZnQ>mZ na {dV[aV n[ag§n{Îm`m±) / (AssetsDistributedonSettlements) - -

’§$S> go ^wJVmZ {H$E JE bm^ àm{á¶m| Ho$ à~§YZ Ho$ {bE ì¶¶ Am¡a H$a(ExpensesandTaxformanagingtheBenefitObligations-paidfromthefund) - -

n[ag§n{Îm`m| H$s grqbJ ‘| n[adV©Z / EffectsofAssetCeiling - -

{dXoer ‘wÐm Xam| ‘| hþE n[adV©Zm| Ho$ à^mdTheEffectOfChangesInForeignExchangeRates - -

ã`mO Am` H$mo N>mo‹S>H$a `moOZm n[ag§n{Îm`m| na [aQ>Z©ReturnonPlanAssets,ExcludingInterestIncome - -

Ad{Y H$s g‘m{á na `moOZm n[ag§n{Îm H$m C{MV ‘yë`FairValueofPlanAssetsattheEndofthePeriod - -

Mmby Ad{Y Ho$ {bE bm^ d hm{Z H$s {ddaUr ‘| ‘mÝ¶Vm àmá ~r‘m§{H$H$ bm^/ hm{Z`m±Actuarial(Gains)/LossesRecognizedintheStatementofProfitorLossforCurrentPeriod


Mmby Ad{YCurrentPeriod

nyd© Ad{Y PreviousPeriod

Ad{Y Ho$ {bE ~r‘m§{H$H$ bm^/ hm{Z`m| na Xm{`ËdActuarial(Gains)/LossesonObligationForthePeriod 142.98 433.14

ã`mO Am` H$mo N>mo‹S>H$a `moOZm n[ag§n{Îm`m| na [aQ>Z©ReturnonPlanAssets,ExcludingInterestIncome - -

AZw`moJ / Subtotal 142.98 433.14

bm^ AWdm hm{Z Ho$ {ZnQ>mZ ‘| ‘mÝ`Vm àmá ~r‘m§{H$H$ (bm^)/hm{Z`m± Actuarial(Gains)/LossesRecognizedintheStatementofProfitorLoss 142.98 433.14

{Z¶mo{OV g§n{Îm¶m| na dmñV{dH$ à{V’$b /ActualReturnonPlanAssets(ê$. bmI ‘|) / (Rs.inlakh)



ã`mO Am` / InterestIncome - -

ã`mO Am` H$mo N>mo‹S>H$a `moOZm n[ag§n{Îm`m| na [aQ>Z© ReturnonPlanAssets,ExcludingInterestIncome - -

`moOZm n[ag§n{Îm`m| na dmñV{dH$ [aQ>Z© / ActualReturnonPlanAssets - -

172

^m.H$.{Z.

C.C.I.


Mmby Ad{Y Ho$ {bE bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àmá ì`ÀmountRecognizedintheBalanceSheet




Ad{Y Ho$ Ama§^ ‘| bm^ Xm{`Ëd H$m dV©‘mZ ‘yë` PresentValueofBenefitObligationattheendoftheperiod (2129.04) (2179.17)

Ad{Y Ho$ g‘m{á na ¶moOZm n[ag§n{Îm H$m C{MV ‘yë¶FairValueofPlanAssetsattheendoftheperiod - -

~r‘m§{H$H$ (bm^)/ hm{Z`m± / FundedStatus(Surplus/(Deficit) (2129.04) (2179.17)

Ad{Y Ho$ Xm¡amZ ‘mÝ`Vm àmá VËH$mbrZ godm bmJV- J¡a {Z{hV bmÛnrecognisedPastServiceCostattheendofthePeriod - -

VwbZ nÌ ‘| ‘mÝ¶Vm àmßV ewÕ Xo¶Vm / g§n{ÎmNet(Liability)/AssetRecognisedintheBalanceSheet (2129.04) (2179.17)

Mmby Ad{Y Ho$ {bE ewÕ ã`mO bmJV / Net Interest Cost for Current Period(ê$. bmI ‘|)/(Rs.inlakh)



Ad{Y Ho$ Ama§^ ‘| bm^ Xm{`Ëd H$m dV©‘mZ ‘yë` PresentValueofBenefitObligationattheBeginningoftheperiod 2179.17 2191.01

(Ad{Y Ho$ Ama§^ ‘| `moOZm n[ag§n{Îm H$m C{MV ‘yë`) (FairValueofPlanAssetsattheBeginningoftheperiod) - -

Ama§^ ‘| ewÕ (Xo`VmE°§) / n[ag§n{Îm NetLiability/(Asset)attheBeginning 2179.17 2191.01


(ã`mO Am`) / (InterestIncome) - -

Mmby Ad{Y ‘| ewÕ ã`mO bmJV / NetInterestCostforCurrentPeriod 169.54 159.29

Mmby Ad{Y Ho$ {bE bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àmá ì`ÈxpensesRecognizedintheStatementofProfitorLossforCurrentPeriod





ewÕ ã`mO bmJV / NetInterestCost 169.54 159.29

~r‘m§{H$V (bm^)/hm{Z`m± / Actuarial(Gains)/Losses 142.98 433.14

Ad{Y Ho$ Xm¡amZ ‘mÝ`Vm àmá VËH$mbrZ godm bmJV- J¡a {Z{hV bm^ PastServiceCost-Non-VestedBenefitRecognizedDuringthePeriod

Ad{Y Ho$ Xm¡amZ ‘mÝ`Vm àmá VËH$m{bZ godm bmJV {Z{hV bm^ PastServiceCost-VestedBenefitRecognizedDuringthePeriod - -

173


^m.H$.{Z.

C.C.I.

H$‘©Mm[a`m| Ûmam Ano{jV A§eXmZ (ExpectedContributionsbytheEmployees) (20.02) -

(bm^)/H$Q>m¡Vr na hm{Z`m± Am¡a {ZnQ>mZ(Gains)/LossesonCurtailmentsAndSettlements - -

{dXoer ‘wÐm Xam| ‘| hþE n[adV©Zm| Ho$ ewÕ à^md NetEffectofChangesinForeignExchangeRates - -

n[ag§n{Îm grqbJ ‘| n[adV©Z / ChangeinAssetCeiling - -

bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àmá ì`` ExpensesRecognizedintheStatementofProfitorLoss 436.08 726.29

VwbZ nÌ g‘mYmZ / Balance Sheet Reconciliation




ewÕ Xo`VmE°§ Ama§^ / OpeningNetLiability 2179.17 2191.01

bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àmá ìæm`ExpenseRecognizedinStatementofProfitorLoss 436.08 726.29

A§VaU ‘| ewÕ Xo`VmE°§ /(n[ag§n{Îm) / NetLiability/(Asset)TransferIn - -

A§VaU Ho$ ~mha ewÕ Xo`VmE°§ /(n[ag§n{Îm) / Net(Liability)/AssetTransferOut - -

{Z`moº$m Ûmam ^wJVmZ {H$`m J`m bm^ (BenefitPaidDirectlybytheEmployer) (506.23) (738.13)

{Z`moº$m H$m A§eXmZ / (Employer'sContribution) 20.02 -

VwbZ àmá ‘| ‘mÝ`Vm àmßV ewÕ Xo`VmE°§ / n[ag§n{Îm`m± NetLiability/(Asset)RecognizedintheBalanceSheet

2129.04 2179.17

n[ag§n{Îm`m| H$s loUr / Category of Assets




^maV gaH$ma H$s n[ag§n{Îm / GovernmentofIndiaAssets

Nil Nil

amÁ` gaH$ma à{V^y{V`m± / StateGovernmentSecurities

{deof O‘m `moOZm / SpecialDepositsScheme

So>ãQ> B§ñQ¯>‘|Q²g / DebtInstruments

H$m°nm}aoQ> ~m°ÝS§>g / CorporateBonds

ZH$X d ZH$X g‘Vwë` / CashAndCashEquivalents

~r‘m {Z{Y / Insurancefund

EgoQ²g-~¡ŠS> à{V^y{V`m± / Asset-BackedSecurities

g§a{MV F$U / StructuredDebt

AÝ` / Other

174

^m.H$.{Z.

C.C.I.


AÝ` OmZH$m[a`m± / OtherDetails




g{H«$` gXñ`m| H$s g§»`m / NoofActiveMembers 733 798

g{H«$` gXñ`m| H$m à{V ‘mh doVZ PerMonthSalaryForActiveMembers 360.05 372.08

àmoOoŠQ>²oS> ~oZo{’$Q> Am°~{bJoeZ (nr~rAmo)ProjectedBenefitObligation(PBO) 2129.04 2179.17

AZw^d g‘m`moOZ / Experience Adjustment




AZw^d Ho$ H$maU ~m‘m§{H$H$ (bm^)/hm{Z Xm{`Ëd na hm{Z Actuarial(Gains)/LossesonObligations-DuetoExperience 138.80 514.29


godm{Zd¥{Îm nümV {M{H$Ëgm bm^ `moOZm

H§$nZr Hw$N> {Z{X©ï>o H$‘©Mm[a`m| Ho$ {bE n[a^m{fV godm{Zd¥{Îm nümV

{M{H$Ëgm bm^ `moOZm g§Mm{bV H$a ahm h¡ VWm H$‘©Mm[a`m| H$s

Hw$N> eVm] H$s g§Vw{ï> Ho$ nümV ^wJVmZ `mo½` h¡ &

n[a^m{fV bm^ `moOZm H$s ‘mÝ`Vm d AmH$bZ:

n[a^m{fV bm^ àXmZ H$aZo H$s bmJV àË`oH$ [anmo{Qª>J {V{W na {H$E OmZo dmbo AZw‘m{ZV ‘yë`m§H$Z Ho$ gmW AZw‘m{ZV `y{ZQ> H«o${S>Q> nÕ{V H$m Cn`moJ H$aHo$ {ZYm©[aV {H$`m OmVm h¡ & VwbZ nÌ ‘| ‘mÝ`Vm àmá n[a^m{fV bm^ ~mÜ`Vm H$mo n[a^m{fV bm^ ~mÜ`Vm Ho$ dV©‘mZ ‘yë` H$mo bmJy H$aZo Ho$ {bE `moOZm n[ag§n{Îm`m| Ho$ C{MV ‘yë` Ûmam H$‘ {H$`m J`m h¡, `{X bmJy

hmo Vmo &

{H$gr n[a^m{fV bm^ n[ag§n{Îm (Bg JUZm Ho$ n[aUm‘ñdê$n ZH$mamË‘H$ n[a^m{fV bm^ Xm{`Ëd) H$mo CnbãY [a’§$S> Ho$ dV©‘mZ ‘yë` VWm `moOZm Ho$ ^mdr A§eXmZ ‘| H$Q>m¡{V H$m à{V{Z{YËd H$aZo Ho$ {bE ‘mÝ`Vm Xr OmVr h¡ &

n[a^m{fV bm^ Xo`Vm/n[ag§n{Îm na dV©‘mZ g{d©g bmJV, ^yVnyd© g{d©g bmJV, `{X H$moB© hmo, VWm ewÕ ã`mO H$mo bm^ d

hm{Z {ddaUr ‘| ‘mÝ`Vm Xr OmVr h¡ &

PostRetirementMedicalBenefitPlan

The Company operates a defined post-retirementmedicalbenefitplanforcertainspecifiedemployeesandispayableupontheemployeesatisfyingcertainconditions.

RecognitionandmeasurementofDefinedBenefitplans:

ThecostofprovidingdefinedbenefitsisdeterminedusingtheProjectedUnitCreditmethodwithactuarialvaluationsbeing carriedout at each reportingdate.The defined benefit obligations recognized in theBalance sheet represent the present value of thedefined benefit obligations as reduced by the fairvalueofplanassets,ifapplicable.

Any defined benefit asset (negative defined benefitobligationsresultingfromthiscalculation)isrecognizedrepresenting the present value of available refundsandreductionsinfuturecontributionstotheplan.

All expenses represented by current service cost,past service cost, if any, and net interest on thedefinedbenefit liability/(asset)are recognized in thestatementofProfitandLoss.

175


^m.H$.{Z.

C.C.I.

~r‘m§{H$H$ bm^ d hm{Z VWm `moOZm n[ag§n{Îm na dmngr H$mo

em{‘b H$aHo$ (ewÕ n[a^m{fV bm^ Xo`Vm/ n[ag§n{Îm na ewÕ

ã`mO ‘| em{‘b am{e H$mo N>mo‹S>H$a) ewÕ n[a^m{fV bm^ Xo`Vm

(n[ag§n{Îm) Ho$ nwZ: AmH$bZ H$mo AÝ` ì`mnH$ Am` ‘| ‘mÝ`Vm

Xr JB© h¡ & AmJm‘r Ad{Y ‘| Eogo nwZ: AmH$bZ H$mo bm^ d hm{Z

{ddaUr ‘| nwZ: dJuH¥$V Zht {H$`m J`m h¡ & H§$nZr Zo Cº$ Xo`Vm/

(n[ag§n{Îm) H$mo ñdV§Ì EŠMwAar Ûmam ~r‘m§{H$H$ ‘yë`m§H$Z Ho$

AZwgma VwbZ nÌ ‘| Mmby d J¡a Mmby Ho$ ê$n ‘| àñVwV {H$`m h¡

VWm{n, CnXmZ {Z{Y Ho$ {bE g§nyU© Xo`VmAm| H$mo dV©‘mZ Ho$ ê$n

‘| {dMma {H$`m J`m h¡ My±{H$ H§$nZr AJbo 12 ‘hrZm| Ho$ ^rVa

CnXmZ {Z{Y ‘| Bg am{e H$m A§eXmZ H$a XoJr &

n[a^m{fV bm^ godm{Zd¥{Îm nümV {M{H$Ëgm bm^ `moOZm

(Anmo{fV)

H§$nZr Hw$N> {Z{X©ï> H$‘©Mm[a`m| Ho$ {bE n[a^m{fV godm{Zd¥{Îm nümV

{M{H$Ëgm bm^ `moOZm g§Mm{bV H$a ahm h¡ VWm H$‘©Mm[a`m| H$s

Hw$N> eVm] H$s g§Vw{ï> Ho$ nümV ^wJVmZ `mo½` h¡ &

Cº$ {Z`w{º$ Ho$ nümV bm^ `moOZm Am‘ Vm¡a na H§$nZr H$mo

{ZåZ{bpIV ê$n go ~r‘m§{H$H$ OmopI‘ H$m Iwbmgm H$aVr h¡ &

{Zdoe OmopI‘ :

n[a^m{fV bm^ Xo`VmAm| Ho$ dV©‘mZ ‘yë` H$s JUZm {S>ñH$mD§$Q>

Xa H$m Cn`moJ H$aVo hþE H$s OmVr h¡ Omo gaH$mar ~m°§S>g na

[anmo{Q>ªJ Ad{Y H$s g‘m{á na ~mOma àm{á H$mo XoIVo hþE {ZYm©[aV

H$s OmVr h¡ &

ã`mO OmopI‘ :

~m±S> ã`mO Xa ‘| KQ>m¡{V Ho$ H$maU `moOZm Xo`VmAm| ‘| d¥{Õ hmoJr

VWm{n Bg `moOZm Ho$ {Zdoe na dmngr ‘| Am§{eH$ ê$n go d¥{Õ

hmoJr &

XrKm©d{Y OmopI‘ :

n[a^m{fV bm^ Xo`Vm H$m dV©‘mZ ‘yë` CZH$s amoOJma Ho$ Xm¡amZ Am¡a nüm{V XmoZm| ‘| `moOZm à{V^m{J`m| H$s ‘¥Ë`w Xa Ho$ gdm}Îm‘ AZw‘mZ Ho$ g§X^© ‘| JUZm H$s OmVr h¡ & `moOZm à{V^m{J`m| H$s OrdZ àË`mem ‘| d¥{Õ go `moOZm Xo`Vm ‘| d¥{Õ hmoJr &

Re-measurementsofthenetdefinedbenefitliability/(asset)comprisingactuarialgainsandlossesandthereturnontheplanassets(excludingamountsincludedin net interest on the net defined benefit liability/asset), are recognized in Other comprehensiveIncome.Such re-measurementsarenot reclassifiedtotheStatementofProfitandLossinthesubsequentperiods. The Company presents the above liability/(asset) as current and non-current in the Balancesheetasperactuarial valuationby the independentactuary;however,theentireliabilitytowardsgratuityisconsideredascurrentasthecompanywillcontributethisamounttothegratuityfundwithinthenexttwelvemonths.

Defined benefit post-retirement medical benefitplan(Unfunded)

The Company operates a defined post-retirementmedicalbenefitplanforcertainspecifiedemployeesand payable upon the employee satisfying certainconditions.

Aforesaid post-employment benefit plans typicallyexposetheCompanytoactuarialriskssuchas:

Investmentrisk:

The present value of the defined benefit liability iscalculatedusingadiscountratewhichisdeterminedby reference to market yields at the end of thereportingperiodongovernmentbonds.

InterestRisk:

Adecreaseinthebondinterestratewillincreasetheplanliability;however,thiswillbepartiallyoffsetbyanincreaseinthereturnontheplan’sinvestments.

LongevityRisk:

The present value of the defined benefit liability iscalculated by reference to the best estimate of themortality of plan participants both during and aftertheiremployment.Anincreaseinthelifeexpectancyoftheplanparticipantswillincreasetheplan’sliability.

176

^m.H$.{Z.

C.C.I.


SalaryRisk:

The present value of the defined benefit liability iscalculatedbyreferencetothefuturesalariesofplanparticipants.Assuch,anincreaseinsalaryoftheplanparticipantswillincreasetheplan’sliability.

Themostrecentactuarialvaluationoftheplanassetsand the present value of defined obligation werecarried out as on 31.03.2019 by M/s. K.A. PanditConsultantsandActuaries,Fellowof the InstituteofActuariesof India.Thepresentvalueof thedefinedbenefit obligation and related current service costweremeasuredusingtheprojectedunitcreditmethod.

The following tables summaries the components ofdefinedbenefitexpenserecognizedinthestatementofProfitorLoss/OCIandtheamountsrecognizedinthebalancesheet:

doVZ OmopI‘ :

`moOZm à{V^m{J`m| Ho$ ^mdr doVZ H$mo XoIVo hþE n[a^m{fV bm^

Xo`Vm Ho$ dV©‘mZ ‘yë` H$s JUZm H$s OmVr h¡ & O¡go {H$ `moOZm

à{V^m{J`m| Ho$ doVZ ‘| d¥{Õ go `moOZm Xo`Vm ‘| d¥{Õ hmoJr &

hmb hr ‘| 31 ‘mM©, 2019 H$mo EŠMw[aO Am°’$ B§{S>`m Ho$

BÝñQ>rQ>çyQ> Ho$ AYrZ n§OrH¥$V ’$‘© ‘ogg© Ho$. E. n§{S>V Ûmam

ßbmZ EgoQ²g H$s ~r‘m§{H$H$ ‘yë`m§H$Z VWm n[a^m{fV Xm{`Ëd H$m

dV©‘mZ ‘yë` bJm`m J`m & n[a^m{fV bm^ Xm{`Ëd VWm g§~§{YV

Mmby godm bmJV H$m AmH$bZ h‘Zo dV©‘mZ ‘yë` àmoOoŠQ>oS> `y{ZQ>

H«o${S>Q> ‘oWS> Ho$ à`moJ Ûmam bJm`m h¡ &

{ZåZ{bpIV {ddaUr n[a^m{fV bm^ ì`` Ho$ gmam§{eV KQ>H$m| H$mo bm^ AWdm hm{Z / AmogrAmB© H$s {ddaUr ‘| ‘mÝ`Vm XoVr h¢ VWm ({dÎm nmo{fV pñW{V am{e Ho$) g§~§{YV ßbmÝg Ho$ {bE VwbZ nÌ ‘| ‘mÝ`Vm XoVr h¡ &

‘mÝ`VmE§ : Assumptions:

{ddaUr Particulars

{dÎmr` df©

2018-19FY2018-19

{dÎmr` df©

2017-18 FY2017-18

{dÎmr` df©

2016-17FY2016-17

{dÎmr` df©

2015-16FY2015-16

godm {Zd¥Îmr H$s ‘mZr JB© Am¶wRetirementAgetobeassumedat

60 60 60 60

`moOZm n[ag§n{Îm`m| na Ano{jV [aQ>Z© ExpectedReturnonPlanAssets

N.A. N.A. N.A. N.A.

{S>ñH$mD$§qQ>J H$s Xa / RateofDiscounting 7.78% 7.78% 7.27% 8.12%

{M{H$Ëgm bmJV ‘| hþB© ‘wÐm pñ’$VrMedicalCostInflation

3.00% 3.00% 3.00% 3.00%

H$‘©Mmar Q>Z©Amoda H$s Xa RateofEmployeeTurnover

2.00% 2.00% 2.00% 2.00%

amoOJma Ho$ Xm¡amZ ‘m°aQ>¡{bQ>r Xa MortalityRateDuringEmployment

^maVr` AmœmgZ OrdZ ‘m°aQ>o{bQ>r (2006-08)

IndianAssuredLives

Mortality(2006-08)


IndianAssuredLives

Mortality(2006-08)


IndianAssuredLives

Mortality(2006-08)


IndianAssuredLives

Mortality(2006-08)

177


^m.H$.{Z.

C.C.I.

amoOJma Ho$ nümV ‘m°aQ>¡{bQ>r Xa MortalityRateAfterEmployment

^maVr` AmœmgZ OrdZ ‘m°aQ>¡{bQ>r (2006-08)

IndianAssuredLives

Mortality(2006-08)


IndianAssuredLives

Mortality(2006-08)


IndianAssuredLives

Mortality(2006-08)


IndianAssuredLives

Mortality(2006-08)

Medical Disclosure Statement as Per Indian AccountingStandard19(IndAs19)

ForThePeriod01/04/2018-31/03/2019CurrentPeriod

PreviousPeriod

TypeofBenefit Medical MedicalCountry India IndiaReportingCurrency INR INR

ReportingStandard



FundingStatus Unfunded Unfunded

StartingPeriod 01-Apr-18 01-Apr-17DateofReporting 31-Mar-19 31-Mar-18PeriodofReporting 12Months 12Months

Assumptions(PreviousPeriod)CurrentPeriod

PreviousPeriod

ExpectedReturnonPlanAssets N.A N.A


MedicalCostofInflation 3.00% 3.00%



IndianAssuredLives

Mortality(2006-08)

IndianAssuredLives

Mortality(2006-08)

^maVr` boIm§{H$V ‘mZH$ 19 Ho$ AZwgma (B§S>EEg19)

{M{H$Ëgm H$m àH$Q>rH$aU

{XZm§H$ 01.04.2018 go 31.03.2019 hoVw


bm^ Ho$ àH$ma {M{H$Ëgm {M{H$Ëgm

Xoe ^maV ^maV

[anmo{Q>ªJ ‘wÐm AmB©EZAma AmB©EZAma

[anm{Q>ªJ ‘mZH$

^maVr` boIm§{H$V‘mZH$ 19

(B§S>EEg 19)


(B§S>EEg 19)

{dÎm nmo{fV pñW{V {dÎm nmo{fV {dÎm nmo{fV

Ama§{^H$ H$s Ad{Y 01-Aà¡b-18 01-Aà¡b-17


[anmo{Q>ªJ H$s Ad{Y 12 ‘{hZo 12 ‘hrZo

YmaUmE°§ (JV Ad{Y)



bm.Z. bm.Z.

{S>ñH$mD$§qQ>J H$s Xa 7.78% 7.27%

doVZ ‘| d¥{Õ H$s Xa 3.00% 3.00%

H$‘©Mmar Q>Z©Amoda H$s Xa

2.00% 2.00%

amoOJma Ho$ Xm¡amZ ‘m°aQ>¡{bQ>r Xa



178

^m.H$.{Z.

C.C.I.





YmaUmE°§ (Mmby Ad{Y)


`moOZm n[ag§n{Îm`m| na

Ano{jV [aQ>Z© bm.Z. bm.Z.

{S>ñH$mD$§qQ>J H$s Xa 7.78% 7.78%

{M{H$Ëgm ì¶¶ ‘| ‘wÐm

ñ’$s{V3.00% 3.00%



^maVr` AmœmgZ OrdZ

‘m°aQ>¡{bQ>r (2006-08)

^maVr` AmœmgZ OrdZ

‘m°aQ>¡{bQ>r (2006-08)


^maVr` AmœmgZ OrdZ

‘m°aQ>¡{bQ>r (2006-08)

^maVr` AmœmgZ OrdZ

‘m°aQ>¡{bQ>r (2006-08)

MortalityRateAfterEmployment

IndianAssuredLives

Mortality(2006-08)

IndianAssuredLives

Mortality(2006-08)

Assumptions(CurrentPeriod)

CurrentPeriod

PreviousPeriod

ExpectedReturnonPlanAssets N.A N.A


MedicalCostInflation 3.00% 3.00%



IndianAssuredLives

Mortality(2006-08)

IndianAssuredLives

Mortality(2006-08)

MortalityRateAfterEmployment

IndianAssuredLives

Mortality(2006-08)

IndianAssuredLives

Mortality(2006-08)

àmoOoŠQ>S> bm^ Xm{`pËd Ho$ dV©‘mZ ‘yë` ‘| n[adV©Z Xem©Zodmbr Vm{bH$m TableShowingChangeinthePresentValueofProjectedBenefitObligation




Ad{Y Ho$ àma§^ na bm^ Xm{`Ëd H$m dV©‘mZ ‘yë` PresentValueofBenefitObligationattheBeginningofthePeriod 418.92 445.69


Mmby g{d©g bmJV / CurrentServiceCost 12.00 14.58

JV g{d©g bmJV / PastServiceCost - -

Xo`VmE°§ A§VaU / YmaU / LiabilityTransferredIn/Acquisitions - -

Xo`VmE°§ ~mha A§VaU/ {d{Zdoe (LiabilityTransferredOut/Divestments) - -

(bm^)/H$Q>m¡{V na hm{Z`m± / (Gains)/LossesonCurtailment - -

({ZnQ>mZ na Xo`VmE°§ {ZH$mbr JB©) / (LiabilitiesExtinguishedonSettlement) - -

179


^m.H$.{Z.

C.C.I.

({Z`moº$m Ûmam grYo bm^ ^wJVmZ) / (BenefitPaidDirectlybytheEmployer) (16.43) (23.47)

({Z{Y go bm^ ^wJVmZ) / (BenefitPaidFromtheFund) - -

{dXoer ‘wÐm Xam| ‘| hþE n[adV©Zm| Ho$ à^md TheEffectofchangesinForeignExchangeRates - -

OZgm§p»`H$s` YmaUmAm| ‘| n[adV©Z Ho$ H$maU Xm{`Ëdm| na ~r‘m§{H$H$ bm^/hm{Z`m± Actuarial(Gains)/LossesonObligations-DuetoChangeinDemographicAssumptions - -

{dÎmr` YmaUmAm| ‘| n[adV©Z Ho$ H$maU Xm{`Ëd na ~r‘m§{H$H$ bm^/hm{Z Actuarial(Gains)/LossesonObligations-DuetoChangeinFinancialAssumptions - (29.19)

AZw^d Ho$ H$maU Xm{`Ëd na ~r‘m§{H$H$ bm^/hm{Z Actuarial(Gains)/LossesonObligations-DuetoExperience (27.38) (21.10)

Ad{Y H$s g‘m{á na bm^ Xm{`Ëd H$m dV©‘mZ ‘yë` PresentValueofBenefitObligationattheEndofthePeriod 419.70 418.91

`moOZm n[ag§n{Îm Ho$ C{MV ‘yë` ‘| n[adV©Z Xem©Zodmbr Vm{bH$mTable Showing Change in the Fair Value of Plan Assets




Ad{Y Ho$ Ama§^ ‘| bm^ Xm{`Ëd H$m C{MV ‘yëæm FairvalueofPlanAssetsattheBeginningoftheperiod - -

ã`mO Am` / InterestIncome - -

{Z`moº$mÛmam A§eXmZ / ContributionsbytheEmployer (4.81) -

H$‘©Mmar Ûmam Ano{jV A§eXmZ / ExpectedContributionsbytheEmployees 4.81 -

n[ag§n{Îm`m± A§VaU ‘|/YmaU / AssetsTransferredIn/Acquisitions - -

(n[ag§n{Îm`m± A§VaU Ho$ ~mha/ {d{Zdoe) (AssetsTransferredOut/Divestments) - -

({Z{Y go ^wJVmZ {H$`m J`m bm^) / (BenefitPaidfromtheFund) - -


n[ag§n{Îm grqbJ Ho$ à^md / EffectsofAssetCeiling - -

{dXoer ‘wÐm Xam| ‘| n[adV©Z Ho$ à^md TheEffectofChangesInForeignExchangeRates - -


Ad{Y H$s g‘m{á na `moOZm n[ag§n{Îm`m| H$m C{MV ‘yë` FairValueofPlanAssetsattheEndofthePeriod - -

180

^m.H$.{Z.

C.C.I.


VwbZ nÌ ‘| ‘mÝ`Vm àmá am{e AmountRecognizedintheBalanceSheet




(Ad{Y H$s g‘m{á na bm^ Xm{`Ëd H$m dV©‘mZ ‘yë`)(PresentValueofBenefitObligationattheendofthePeriod) (419.70) (418.92)

Ad{Y H$s g‘m{á na `moOZm n[ag§n{Îm H$m C{MV ‘yë` FairValueofPlanAssetsattheendofthePeriod - -

{dÎm$nmo{fV pñW{V (A{Yeof/KmQ>m) / FundedStatus(Surplus/(Deficit) (419.70) (418.92)

VwbZ nÌ ‘| ‘mÝ`Vm àmá ewÕ Xo`VmE°§/ n[ag§n{Îm Net(Liability)/AssetRecognizedintheBalanceSheet (419.70) (418.92)

Mmby Ad{Y Ho$ {bE ewÕ ã`mO bmJV / Net Interest Cost for Current Period(ê$. bmI ‘|) /(Rs.inlakh)



Ad{Y Ho$ Ama§^ ‘| bm^ Xm{`Ëd H$m dV©‘mZ ‘yë`PresentValueofBenefitObligationattheBeginningofthePeriod 418.92 445.69

(Ad{Y Ho$ Ama§^ ‘| `moOZm n[ag§n{Îm H$m C{MV ‘yë`) (FairValueofPlanAssetsattheBeginningofthePeriod) - -

Ama§^ ‘| ewÕ (Xo`VmE°§)/n[ag§n{Îm NetLiability/(Asset)attheBeginning 418.92 445.69




Mmby Ad{Y Ho$ {bE bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àmá ì``ExpensesRecognizedintheStatementofProfitorLossforCurrentPeriod





ewÕ ã`mO bmJV/ NetInterestCost 32.59 32.40

VËH$m{bZ godm bmJV / PastServiceCost - -

(H$‘©Mm[a`m| Ûmam Ano{jV A§eXmZ) (ExpectedContributionsbytheEmployees) (4.81) -

(bm^)/ H$Q>m¡{V na hm{Z`m± Am¡a {ZnQ>mZ (Gains)/LossesonCurtailmentsAndSettlements - -


‘mÝ`Vm àmá ì`` / ExpensesRecognized 39.78 46.99

181


^m.H$.{Z.

C.C.I.

Mmby Ad{Y Ho$ {bE AÝ` ì`mnH$ Am` (AmogrAm`) ‘| ‘mÝ`Vm àmá ì`` ExpensesRecognizedintheOtherComprehensiveIncome(OCI)forCurrentPeriod




Ad{Y Ho$ {bE Am¡{MË` na ~r‘m§{H$H$ (bm^)/hm{ZActuarial(Gains)/LossesonObligationForthePeriod (27.37) (50.29)

ã`mO Am` N>moS>H$a `moOZm n[ag§n{Îm`m| na [aQ>Z© ReturnonPlanAssets,ExcludingInterestIncome - -

n[ag§n{Îm`m| H$s grqbJ ‘| n[adV©Z / ChangeinAssetCeiling - -

AmogrAmB© ‘| ‘mÝ`Vm àmá Ad{Y Ho$ {bE ewÕ Am`/ìæm` Net(Income)/ExpenseForthePeriodRecognizedinOCI (27.37) (50.29)

VwbZ nÌ g‘mYmZ /BalanceSheetReconciliation(ê$. bmI ‘|) /(Rs.inlakh)



Ama§{^H$ ewÕ Xo`VmE°§ / OpeningNetLiability 418.92 445.69

bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àmá ì``ExpensesRecognizedinStatementofProfitorLoss 39.78 46.99

AmogrAmB© ‘| ‘mÝ`Vm àmá ìæm` / ExpensesRecognizedinOCI (27.37) (50.29)

A§VaU ‘| ewÕ Xo`VmE°§ / (n[ag§n{Îm) NetLiability/(Asset)TransferIn - -

A§VaU Ho$ ~mha ewÕ Xo`VmE°§/(n[ag§n{Îm) Net(Liability)/AssetTransferOut - -

({Z`moº$m Ûmam ^wJVmZ {H$`m J`m bm^)(BenefitPaidDirectlybytheEmployer) (16.42) (23.47)

({Z`moº$m H$m A§eXmZ) / (Employer'sContribution) 4.81 -

VwbZ nÌ ‘| ‘mÝ`Vm àmá ewÕ Xo`VmE°§ / n[ag§n{Îm`m± NetLiability/(Asset)RecognizedintheBalanceSheet 419.70 418.92

182

^m.H$.{Z.

C.C.I.


n[ag§n{Îm`m| H$s loUr / Category of Assets(ê$. bmI ‘|) /(Rs.inlakh)



^maV gaH$ma H$s n[ag§n{Îm / GovernmentofIndiaAssets

Nil Nil

amÁ` gaH$ma à{V^y{V`m± / StateGovernmentSecurities

{deof O‘m `moOZm / SpecialDepositsScheme

So>ãQ> B§ñQ¯>‘|Q²g / DebtInstruments

H$m°nm}aoQ> ~m°ÝS²>g / CorporateBonds

ZH$X d ZH$X g‘Vwë` / CashAndCashEquivalents

~r‘m {Z{Y / Insurancefund

EgoQ²>g-~¡ŠS> à{V^y{V`m± / Asset-BackedSecurities

g§a{MV F$U / StructuredDebt

AÝ` / Other

`moJ / Total

AÝ` OmZH$m[a`m± / OtherDetails(ê$. bmI ‘|) /(Rs.inlakh)




g{H«$` gXñ`m| Ho$ {bE à{V ‘mh doVZPerMonthSalaryForActiveMembers - -

H$da {H$E JE ì¶{º$¶m| H$s g§»¶m / NoOfPersonsCovered 891 817

àmoOoŠQ>²oS> ~oZo{’$Q> Am°~{bJoeZ Ho$ ^m[aV Am¡gV Ad{YWeightedAverageDurationoftheProjectedBenefitObligation 19 19

Ano{jV ^mdr godm H$m Am¡gV / AverageFutureTerm 30 29

àmoOo³Q>oS> ~oZo{’$Q> Am°~{bJoeZ (nr~rAmo)ProjectedBenefitObligation(PBO) 419.70 418.92

AJbo df© (12 ‘hrZo) Ho$ {bE {ZYm©[aV A§eXmZ PrescribedContributionForNextYear(12Months) - -

183


^m.H$.{Z.

C.C.I.

AJbo df© Ho$ {bE ewÕ ã`mO bmJV / Net Interest Cost for Next Year (ê$. bmI ‘|) /(Rs.inlakh)



Ad{Y H$s g‘m{á na bm^ Xm{`Ëdm| H$m C{MV ‘yë` PresentValueofBenefitObligationattheEndofthePeriod 419.70 418.92

(Ad{Y H$s g‘m{á na n[ag§n{Îm`m| H$m C{MV ‘yë`)(FairValueofPlanAssetsattheEndofthePeriod) - -

Ad{Y H$s g‘m{á na ewÕ Xo`VmE°§/ (n[ag§n{Îm) NetLiability/(Asset)attheEndofthePeriod 419.70 418.92



AJbo df© Ho$ {bE ewÕ ã`mO bmJV / NetInterestCostforNextYear 32.65 32.59

AJbo df© Ho$ {bE bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àm{á ì`` ExpensesRecognizedintheStatementofProfitorLossforNextYear

(ê$. bmI ‘|) /(Rs.inlakh) Mmby Ad{Y

CurrentPeriodnyd© Ad{Y

PreviousPeriod



(H$‘©Mm[a`m| Ûmam Ano{jV A§eXmZ) (ExpectedContributionsbytheEmployees) - -


bm^ ^wJVmZ Ho$ n[an¹$Vm {dûcoUfU: {Z{Y go MaturityAnalysisoftheBenefitPayments:FromtheFund




[anmo{Q>ªJ H$s VmarI go ^mdr dfm] ‘| ^wJVmZ `mo½` àmoOoŠQ>oS> bm^ ProjectedBenefitsPayableinFutureYearsFromtheDateofReporting

1bm df© / 1stFollowingYear - -

2am df© / 2ndFollowingYear - -

3am df© / 3rdFollowingYear - -

4Wm df© / 4thFollowingYear - -

5dm± df© / 5thFollowingYear - -

6 go 10 do df© VH$ Hw$b / SumofYears6To10 - -

184

^m.H$.{Z.

C.C.I.


àmoOoŠQ>oS> Xm{`Ëd bm^ Ho$ n[an¹$Vm {dûcofU : {Z`moº$m goMaturityAnalysisofProjectedBenefitObligation:FromtheEmployer




[anmo{Q>ªJ H$s VmarI go ^mdr dfm] ‘| ^wJVmZ `mo½` àmoOoŠQ>oS> bm^ ProjectedBenefitsPayableinFutureYearsfromthedateofreporting

1bm df© / 1stFollowingYear 32.74 42.74

2am df© / 2ndFollowingYear 38.26 39.38

3am df© / 3rdFollowingYear 35.09 35.04

4Wm df© / 4thFollowingYear 34.40 32.63

5dm± df© / 5thFollowingYear 37.51 31.51

6 go 10 do df© VH$ Hw$b / SumofYears6To10 68.21 66.64

g§doXZerb {dûcofU / Sensitivity Analysis(ê$. bmI ‘|) /(Rs.inlakh)



Mmby YmaUmAm| na àmoOoŠQ>oS> bm^ Xm{`Ëd ProjectedBenefitObligationonCurrentAssumptions 419.70 418.92

{S>ñH$mD§$qQ>J Xa ‘| So>ëQ>m à^md H$m +1% n[adV©Z DeltaEffectof+1%ChangeinRateofDiscounting (76.18) (76.04)

{S>ñH$mD§$qQ>J H$s Xa ‘| So>ëQ>m à^md H$m -1% n[adV©Z DeltaEffectof-1%ChangeinRateofDiscounting 87.01 86.85

doVZ d¥{Õ H$s Xa ‘| S>oëQ>m à^md H$m +1% n[adV©Z DeltaEffectof+1%ChangeinMedicalCostInflation 87.51 87.34

doVZ d¥{Õ H$s Xa ‘| S>oëQ>m à^md H$m -1% n[adV©ZDeltaEffectof-1%ChangeinMedicalCostInflation (80.91) (80.76)

H$‘©Mmar Q>Z©Amoda H$s Xa ‘| So>ëQ>m à^md H$m +1% n[adV©ZDeltaEffectof+1%ChangeinRateofEmployeeTurnover (61.97) (61.85)

H$‘©Mmar Q>Z©Amoda H$s Xa ‘| S>oëQ>m à^md H$m -1% n[adV©Z DeltaEffectof-1%ChangeinRateofEmployeeTurnover 64.02 63.90

185


^m.H$.{Z.

C.C.I.

· g§doXZerb {dûcofU H$mo [anmo{Q>ªJ Ad{Y H$s g‘m{á na

hmoZodmbo g§~§{YV ‘mÝ`VmAm| Ho$ {Za§Va g§^m{dV n[adV©Zm|

Ho$ AmYma na {ZYm©[aV {H$`m J`m h¡ O~{H$ AÝ` ‘mÝ`VmE°§

pñWa aIr JB© h¡ &

· Cnamoº$ àñVw{V g§doXZerb {dûcofU àmoOoŠQ>oS> ~oZr{’$Q>

Xm{`Ëd ‘| dmñV{dH$ n[adV©Z H$m à{V{Z{YËd Zht H$aVr

Š`m|{H$ `h g§^mdZm Zht h¡ {H$ ‘mÝ`VmAm| ‘| n[adV©Z

EH$ Xygao go AbJ hmo & Hw$N> ‘mÝ`VmE°§ EH$ Xygao go Ow‹S>r

hþB© h¡ &

· AmJo Cnamoº$ g§doXZerb {dûcofU H$mo àñVwV H$aZo ‘|

àmoOoŠQ>oS> Am°~brJoeZ H$s dV©‘mZ ‘yë` àmoOoŠQ>oS> `y{ZQ>

H«o${S>Q> ‘oWS> H$m Cn`moJ H$aHo$ JUZm H$s JB© h¡ Omo

VwbZ nÌ ‘| ‘mÝ`Vm {XE AZwgma àmoOoŠQ>oS> ~oZr{’$Q>

Am°~brJoeZ H$s JUZm ‘| Cgr nÕ{V H$m Cn`moJ {H$`m

J`m h¡ &

· g§doXZerb {dûcofU H$mo V¡`ma H$aZo ‘| {nN>bo dfm] go Cn`moJ H$s JB© nÕ{V d ‘mÝ`VmAm| ‘| H$moB© n[adV©Z Zht

h¡ &

ZmoQ²g

· [anmoQ>© ‘| {XE JE {ddaU Ho$ AZwgma {M{H$Ëgm H§$nZr H$s

ñH$s‘ Ho$ AZwgma ^wJVmZ `mo½` h¡ &

· AÝ` ì`mnH$ Am` Ho$ A§VJ©V KQ>Zm H$s Ad{Y ‘| ~r‘m§{H$H$ bm^/hm{Z H$mo ‘mÝ`Vm Xr JB© h¡ & Cn`w©º$ g^r [anmoQ>© H$s JB© AÝ`> ì`mnH$ Am` Ho$ Am±H$‹S>o H$amYmZ H$m gH$b h¡ &

· doVZ EgHo$boeZ VWm E{Q´EeZ H$mo H§$nZr Ûmam gy{MV

{H$E AZwgma {dMma {H$`m J`m h¡ H$‘©Mm[a`m| H$s nXmoÞ{V

VWm ‘m±J d Amny{V© H$m {dMma H$aVo hþE CÚmoJ H$s àWm

Ho$ AZwgma àH$Q> {H$`m J`m h¡ &

· bm^ ^wJVmZ Ho$ ‘¡À`w[aQ>r {dûcofU ^{dî` Ho$ AmJo 10

dfm] Ho$ {bE Cn`w©º$ ~Vm`o JE gXñ`m| hoVw g§~§{YV df©

‘| ^mdr doVZ, EQ´>rEeZ VWm ‘¥Ë`w H$mo Ü`mZ ‘| aIVo hþE

AZ{S>ñH$mD§$Q>oS> ZH$X àdmh h¡ &

· Am¡gV Ano{jV ^mdr godm AZw‘m{ZV nX H$s Ad{Y

amoOJma bm^ Xm{`Ëd H$m à{V{Z{YËd H$aVm h¡ &

• Thesensitivityanalysishavebeendeterminedbasedon reasonablypossiblechangesof therespective assumptions occurring at the endof the reportingperiod,whileholdingallotherassumptionsconstant.

• Thesensitivity analysispresentedabovemaynot be representative of the actual change intheprojectedbenefitobligationasitisunlikelythat the change in assumptions would occurin isolation of one another as some of theassumptionsmaybecorrelated.

• Furthermore,inpresentingtheabovesensitivityanalysis, the present value of the projectedbenefit obligation has been calculated usingtheprojectedunitcreditmethodat theendofthereportingperiod,whichisthesamemethodasapplied in calculating theprojectedbenefitobligationasrecognizedinthebalancesheet.

• There was no change in the methods andassumptions used in preparing the sensitivityanalysisfromprioryears.

Notes

• Medical ispayableaspercompany'sschemeasdetailedinthereport.

• Actuarial gains/losses are recognizedin the period of occurrence under OtherComprehensive Income (OCI). All abovereportedfiguresofOCIaregrossoftaxation.

• Salaryescalation&attritionrateareconsideredasadvisedbythecompany;theyappeartobein line with the industry practice consideringpromotion and demand & supply of theemployees.

• Maturity Analysis of Benefit Payments isundiscounted cash flows considering futuresalary, attrition& death in respective year formembersasmentionedaboveforforeseeablefutureofnext10years.

• Average Future Term represents EstimatedTermofPost-EmploymentBenefitObligation.

186

^m.H$.{Z.

C.C.I.


n[a^m{fV bm^ CnXmZ `moOZm ({dÎm nmo{fV)

H§$nZr ‘| AnZo H$‘©Mm[a`m| Ho$ {bE n[a^m{fV bm^ CnXmZ

`moOZm h¡ {Og‘| AbJ go àemg{ZH$ {Z{Y Ho$ A§eXmZ H$s

Amdí`H$Vm h¡ (X H$m°Q>Z H$m°anmoaoeZ Am°’$ B§{S>`m {b. H$‘©Mmar

CnXmZ {Z{Y) & `h CnXmZ ^wJVmZ A{Y{Z`‘ 1972 Ho$ Ûmam

{Z`§{ÌV {H$`m OmVm h¡ & Bg A{Y{Z`‘ Ho$ AYrZ do H$‘©Mmar

BgHo$ nmÌ hm|Jo {OÝhm|Zo 5 dfm] H$s godm nyU© H$s h¡ & Bg bm^

Ho$ ñVa H$m àmdYmZ godm{Zd¥{Îm Ho$ g‘` gXñ` H$s BgHo$ godm

H$s Ad{Y Ed§ godm {Zd¥{Îm Ho$ g‘` doVZ na {Z^©a h¡ & `h {Z{Y

Ý`mg ‘§S>b Ûmam {Z`§{ÌV EH$ Ý`mg h¡ & Ý`mZgr ‘§S>b ^maV

gaH$ma Ûmam {ZYm©[aV ‘mZX§S>m| Ho$ AZwgma {Z{Y Ho$ {Zdoe H$mo

em{‘b H$aVo hþE n[ag§n{Îm`m| Ho$ ßbmZ EgoQ²g Ho$ àemgZ hoVw

{Oå‘oXma h¡ &

hmb hr ‘| 31 ‘mM©, 2019 H$mo EŠMw[aO Am°’$ B§{S>`m Ho$

BÝñQ>rQ>çyQ> Ho$ AYrZ n§OrH¥$V ’$‘© ‘ogg© Ho$. E. n§{S>V Ûmam

ßbmZ EgoQ²g H$s ~r‘m§{H$H$ ‘yë`m§H$Z VWm n[a^m{fV Xm{`Ëdm| H$m

dV©‘mZ ‘yë` bJm`m J`m & n[a^m{fV bm^ Xm{`Ëd VWm g§~§{YV

Mmby godm bmJV H$m AmH$bZ h‘Zo dV©‘mZ ‘yë` àmoOoŠQ>oS> y{ZQ>

H«o${S>Q> ‘oWS> Ho$ à`moJ Ûmam bJm`m &

{ZåZ{bpIV {ddaUr n[a^m{fV bm^ ì`` Ho$ gmam§{eV KQ>H$m|

H$mo bm^ AWdm hm{Z / AmogrAmB© H$s {ddaUr ‘| ‘mÝ`Vm XoVr

h¢ VWm ({dÎm nmo{fV pñW{V am{e Ho$) g§~§{YV ßbmÝg Ho$ {bE

VwbZ nÌ ‘| ‘mÝ`Vm XoVr h¡ &

^maVr` boIm§{H$V ‘mZH$ 19 Ho$ AZwgma (B§S>EEg19)

CnXmZ {Z{Y H$m àH$Q>rH$aU

{XZm§H$ 01.04.2018 go 31.03.2019 hoVw

Mmby Ad{Y {nN>br Ad{Y

bm^ Ho$ àH$ma {M{H$Ëgm {M{H$Ëgm

Xoe ^maV ^maV

[anmo{Q>ªJ ‘wÐm AmB©EZAma AmB©EZAma

[anmo{Q>ªJ ‘mZH$ ^maVr` boIm§{H$V‘mZH$ 19

(B§S>EEg 19)


(B§S>EEg 19)

{dÎm nmo{fV pñW{V {dÎm nmo{fV {dÎm nmo{fV

DefinedbenefitGratuityplan(Funded)

The company has defined benefit gratuity plan forits employees, which requires contributions to bemadetoaseparatelyadministeredfund(TheCottonCorporationof IndiaLtdEmployees’GratuityFund).ItisgovernedbythePaymentofGratuityAct,1972.Under the Act, employee who has completed fiveyearsofserviceisentitledtospecificbenefit.Thelevelofbenefitsprovideddependsonthemember’slengthofserviceandsalaryatretirementage.ThefundhastheformofatrustanditisgovernedbytheBoardofTrustees.TheBoardofTrusteesisresponsiblefortheadministrationoftheplanassetsincludinginvestmentofthefundsinaccordancewithnormsprescribedbytheGovernmentofIndia.

Themostrecentactuarialvaluationoftheplanassetsand the present value of defined obligation werecarriedoutasat31stMarch,2019byM/sK.A.Pandit,firm registered under Institute ofActuaries of India.The present value of the defined benefit obligationand the related current service cost we measuredusingtheprojectedunitcreditmethod.

The following tables summarize the components ofdefinedbenefitexpenserecognisedinthestatementof Profit or loss/OCI and the funded status andamounts recognized in the Balance sheet for therespectiveplans:

Gratuity Disclosure Statement as Per Indian AccountingStandard19(IndAS19)

ForThePeriod01/04/2018-31/03/2019

CurrentPeriod

PreviousPeriod

TypeofBenefit Gratuity GratuityCountry India IndiaReportingCurrency INR INRReportingStandard Indian

AccountingStandard19(IndAS19)


FundingStatus Funded Funded

187


^m.H$.{Z.

C.C.I.

Ama§{^H$ H$s Ad{Y 01-Aà¡b-18 01-Aà¡b-17


[anmo{Q>ªJ H$s Ad{Y 12 ‘{hZo 12 ‘hrZo

YmaUmE°§ (JV Ad{Y)

`moOZm n[ag§n{Îm`m| na

Ano{jV [aQ>Z© 7.78% 7.27%

{S>ñH$mD$§qQ>J H$s Xa 7.78% 7.27%

doVZ ‘| d¥{Õ H$s Xa 7.00% 7.00%

H$‘©Mmar Q>Z©Amoda H$s

Xa 2.00% 2.00%

amoOJma Ho$ Xm¡amZ

‘m°aQ>¡{bQ>r Xa

^maVr` AmœmgZOrdZ

‘m°aQ>¡{bQ>r

(2006-08)

^maVr` AmœmgZOrdZ

‘m°aQ>¡{bQ>r (2006-08)

amoOJma Ho$ nümV

‘m°aQ>¡{bQ>r Xabm.Z. bm.Z.

YmaUmE°§ (Mmby Ad{Y)


7.76% 7.78%

{S>ñH$mD$§qQ>J H$s Xa 7.76% 7.78%

doVZ ‘| d¥{Õ H$s Xa 7.00% 7.00%

H$‘©Mmar Q>Z©Amoda H$s Xa

2.00% 2.00%


^maVr` AmœmgZOrdZ

‘m°aQ>¡{bQ>r (2006-08)

^maVr` AmœmagZOrdZ

‘m°aQ>¡{bQ>r (2006-08)


bm.Z. bm.Z.

StartingPeriod 01-Apr-18 01-Apr-17DateofReporting 31-Mar-19 31-Mar-18PeriodofReporting 12Months 12Months

Assumptions(PreviousPeriod)

ExpectedReturnonPlanAssets 7.78% 7.27%

RateofDiscounting 7.78% 7.27%RateofSalaryIncrease 7.00% 7.00%



IndianAssuredLives

Mortality(2006-08)

IndianAssuredLives

Mortality(2006-08)


Assumptions(CurrentPeriod)ExpectedReturnonPlanAssets 7.76% 7.78%





IndianAssuredLives

Mortality(2006-08)

IndianAssuredLives

Mortality(2006-08)


188

^m.H$.{Z.

C.C.I.


àmoOoŠQ>oS> bm^ Xm{`Ëd Ho$ dV©‘mZ ‘yë` ‘| n[adV©Z Xem©Zodmbr Vm{bH$mTableShowingChangeinthePresentValueofProjectedBenefitObligation




Ad{Y Ho$ àma§^ na bm^ Xm{`Ëd H$m dV©‘mZ ‘yë` PresentValueofBenefitObligationattheBeginningofthePeriod 4,012.79 3,034.86


Mmby g{d©g bmJV / CurrentServiceCost 150.09 95.80

JV g{d©g bmJV / PastServiceCost - 893.36

Xo`VmE°§ A§VaU /YmaU / LiabilityTransferredIn/Acquisitions 17.51 -

Xo`VmE°§ ~mha A§VaU / {d{Zdoe (LiabilityTransferredOut/Divestments) - -

(bm^)/H$Q>m¡{V na hm{Z`m± / (Gains)/LossesonCurtailment - -

({ZnQ>mZ na Xo`VmE°§ {ZH$mbr JB©)(LiabilitiesExtinguishedonSettlement) - -

({Z`moº$m Ûmam grYo bm^ ^wJVmZ) (BenefitPaidDirectlybytheEmployer) - -

({Z{Y go bm^ ^wJVmZ) / (BenefitPaidFromtheFund) (919.57) (493.18)

{dXoer ‘wÐm Xam| ‘| hþE n[adV©Zm| Ho$ à^md TheEffectOfChangesinForeignExchangeRates - -

OZgm§p»`H$s` YmaUmAm| ‘| n[adV©Z Ho$ H$maU Xm{`Ëdm| na ~r‘m§{H$H$ bm^ /hm{Z`m± Actuarial(Gains)/LossesonObligations-DuetoChangeinDemographicAssumptions - -

{dÎmr` YmaUmAm| ‘| n[adV©Z Ho$ H$maU Xm{`Ëd na ~r‘m§{H$H$ bm^/hm{Z Actuarial(Gains)/LossesonObligations-DuetoChangeinFinancialAssumptions 5.28 (131.76)

AZw^d Ho$ H$maU Xm{`Ëd na ~r‘m§{H$H$ bm^/hm{Z Actuarial(Gains)/LossesonObligations-DuetoExperience (144.30) 393.07

Ad{Y H$s g‘m{á na bm^ Xm{`Ëd H$m dV©‘mZ ‘yë` PresentValueofBenefitObligationattheEndofthePeriod 3434.00 4012.79

`moOZm n[ag§n{Îm Ho$ C{MV ‘yë`d ‘| n[adV©Z Xem©Zodmbr Vm{bH$mTable Showing Change in the Fair Value of Plan Assets




Ad{Y Ho$ Ama§^ ‘| bm^ Xm{`Ëd H$m C{MV ‘yëæmFairValueofPlanAssetsattheBeginningoftheperiod 2,815.53 2,900.70

ã`mO Am` / InterestIncome 219.05 210.88

{Z`moº$m Ûmam A§eXmZ / ContributionsbytheEmployer 1,197.26 134.16

189


^m.H$.{Z.

C.C.I.

H$‘©Mmar Ûmam Ano{jV A§eXmZ ExpectedContributionsbytheEmployees - -

n[ag§n{Îm`m± A§VaU ‘|/YmaU / AssetsTransferredin/Acquisitions 17.51 -

(n[ag§n{Îm`m± A§VaU Ho$ ~mha/{d{Zdoe) (AssetsTransferredOut/Divestments) - -

({Z{Y go ^wJVmZ {H$`m J`m bm^) / (BenefitsPaidfromtheFund) (919.57) (493.18)


n[ag§n{Îm grqbJ Ho$ à^md / EffectsofAssetCeiling - -

{dXoer ‘wÐm Xam| ‘| n[adV©Z Ho$ à^md TheEffectofChangesinForeignExchangesRates - -

ã`mO Am` H$mo N>mo‹S>H$a `moOZm n[ag§n{Îm`m| na [aQ>Z© ReturnonPlanAssets,ExcludingInterestIncome 60.64 62.97

Ad{Y H$s g‘m{á na `moOZm n[ag§n{Îm`m| H$m C{MV ‘yë` FairValueofPlanAssetsattheEndoftheperiod 3390.42 2815.53

VwbZ nÌ ‘| ‘mÝ`Vm àmá am{e / AmountRecognizedintheBalanceSheet(ê$. bmI ‘|) /(Rs.inlakh)



(Ad{Y H$s g‘m{á na bm^ Xm{`Ëd H$m dV©‘mZ ‘yë`)(PresentValueofBenefitObligationattheendofthePeriod) (3,434.00) (4,012.79)

Ad{Y H$s g‘m{á na ¶moOZm n[ag§n{Îm H$m C{MV ‘yë¶ FairValueofPlanAssetsattheendofthePeriod 3,390.42 2,815.53

{dÎm nmo{fV pñW{V (A{Yeof/KmQ>m) / FundedStatus(Surplus/(Deficit) (43.58) (1,197.26)

VwbZ nÌ ‘| ‘mÝ`Vm àmá ewÕ Xo`VmE°§ / n[ag§n{Îm Net(Liability)/AssetRecognizedintheBalanceSheet (43.58) (1,197.26)

Mmby Ad{Y Ho$ {bE ewÕ ã`mO bmJV / Net Interest Cost for Current Period(ê$. bmI ‘|) /(Rs.inlakh)



Ad{Y Ho$ Ama§^ ‘| bm^ Xm{`Ëd H$m dV©‘mZ ‘yë` PresentValueofBenefitObligationattheBeginningofthePeriod 4012.79 3034.86

(Ad{Y Ho$ Ama§^ ‘| `moOZm n[ag§n{Îm H$m C{MV ‘yë`) (FairValueofPlanAssetsattheBeginningofthePeriod) (2815.53) (2900.70)

Ama§^ ‘| ewÕ (Xo`VmE°§)/n[ag§n{Îm NetLiability/(Asset)attheBeginning 1197.26 134.16


(ã`mO Am`) / (InterestIncome) (219.05) (210.88)


190

^m.H$.{Z.

C.C.I.


Mmby Ad{Y Ho$ {bE bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àmá ì`` ExpensesRecognizedintheStatementofProfitorLossforCurrentPeriod






VËH$m{bZ godm bmJV / PastServiceCost - 893.36


(bm^)/ H$Q>m¡{V na hm{Z`m± Am¡a {ZnQ>mZ (Gains)/LossesonCurtailmentsAndSettlements - -



Mmby Ad{Y Ho$ {bE AÝ`² ì`m§nH$ Am` (AmogrAm`) ‘| ‘mÝ`Vm àmá ì`` ExpensesRecognizedintheOtherComprehensiveIncome(OCI)forCurrentPeriod




Ad{Y Ho$ {bE Am¡{MË` na ~r‘m§{H$H$ (bm^)/hm{Z Actuarial(Gains)/LossesonObligationForthePeriod (139.02) 261.32

ã`mO Am` N>moS>H$a `moOZm n[ag§n{Îm`m| na [aQ>Z© ReturnonPlanAssets,ExcludingInterestIncome (60.64) (62.97)

n[ag§n{Îm`m| H$s grqbJ ‘| n[adV©Z / ChangeinAssetCeiling - -

AmogrAmB© ‘| ‘mÝ`Vm àmá Ad{Y Ho$ {bE ewÕ Am` /ì``Net(Income)/ExpenseForthePeriodRecognizedinOCI (199.66) 198.35

VwbZ nÌ g‘mYmZ / Balance Sheet Reconciliation(ê$. bmI ‘|) /(Rs.inlakh)



Ama§{^H$ ewÕ Xo`VmE°§ / OpeningNetLiability 1,197.26 134.16

bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àmá ì``ExpensesRecognizedinStatementofProfitorLoss 243.23 998.91

AmogrAmB© ‘| ‘mÝ`Vm àmá ìæm` / ExpensesRecognizedinOCI (199.66) 198.35

A§VaU ‘| ewÕ Xo`VmE°§/(n[ag§n{Îm) / NetLiability/(Asset)TransferIn - -

A§VaU Ho$ ~mha ewÕ Xo`VmE°§ /(n[ag§n{Îm) Net(Liability)/AssetTransferOut - -

191


^m.H$.{Z.

C.C.I.

({Z`moº$m Ûmam ^wJVmZ {H$`m J`m bm^)(BenefitPaidDirectlybytheEmployer) - -

({Z`moº$m H$m A§eXmZ) / (Employer'sContribution) (1,197.26) (134.16)

VwbZ nÌ ‘| ‘mÝ`Vm àmá ewÕ Xo`VmE°§/ n[ag§n{Îm`m± NetLiability/(Asset)RecognizedintheBalanceSheet 43.58 1,197.26

n[ag§n{Îm`m| H$s loUr / Category of Assets(ê$. bmI ‘|) /(Rs.inlakh)



^maV gaH$ma H$s n[ag§n{Îm / GovernmentofIndiaAssets 498.74 421.79

amÁ` gaH$ma à{V^y{V`m± / StateGovernmentSecurities 746.85 746.85

{deof O‘m `moOZm / SpecialDepositsScheme 187.77 187.77

So>ãQ> B§ñQ¯>a‘|Q²g / DebtInstruments - -

H$m°nm}aoQ> ~m°ÝSg / CorporateBonds 1957.06 1459.11

ZH$X d ZH$X g‘Vwë` / CashAndCashEquivalents - -

~r‘m {Z{Y / Insurancefund - -

EgoQ²g ~¡ŠS à{V^y{V`m± / Asset-BackedSecurities - -

g§a{MV F$U / StructuredDebt - -

AÝ` / Other - -

`moJ /Total 3390.42 2815.52

AÝ` OmZH$m[a`m± / OtherDetails(ê$. bmI ‘|) /(Rs.inlakh)




g{H«$` gXñ`m| Ho$ {bE à{V ‘mh doVZ PerMonthSalaryForActiveMembers 360.05 372.08

àmoOoŠQ>oS> ~oZo{’$Q> Am°~{bJoeZ Ho$ ^m[aV Am¡gV Ad{Y WeightedAverageDurationoftheProjectedBenefitObligation 9 8

Ano{jV ^mdr godm H$m Am¡gV / AverageExpectedFutureService 13 13

àmoOoŠQ>oS> ~oZo{’$Q> Am°~{bJoeZ / ProjectedBenefitObligation 3434.00 4012.79

AJbo df© (12 ‘hrZo) Ho$ {bE {ZYm©[aV A§eXmZ PrescribedContributionForNextYear(12Months) 195.83 372.09

192

^m.H$.{Z.

C.C.I.


AJbo df© Ho$ {bE ewÕ ã`mO bmJV / Net Interest Cost for Next Year(ê$. bmI ‘|) /(Rs.inlakh)



Ad{Y H$s g‘m{á na bm^ Xm{`Ëdm| H$m C{MV ‘yë` PresentValueofBenefitObligationattheEndofthePeriod 3434.00 4012.79

(Ad{Y H$s g‘m{á na n[ag§n{Îm`m| H$m C{MV ‘yë`)(FairValueofPlanAssetsattheEndofthePeriod) (3390.42) (2815.53)

Ad{Y H$s g‘m{á na ewÕ Xo`VmE°§/(n[ag§n{Îm) NetLiability/(Asset)attheEndofthePeriod 43.58 1197.26


(ã`mO Am`)/ (InterestIncome) (263.10) (219.05)

AJbo df© Ho$ {bE ewÕ ã`mO bmJV / NetInterestCostforNextYear 3.38 93.15

AJbo df© Ho$ {bE bm^ AWdm hm{Z H$s {ddaUr ‘| ‘mÝ`Vm àm{á ì`` ExpensesRecognizedintheStatementofProfitorLossforNextYear








bm^ ^wJVmZ Ho$ n[an¹$Vm {dûcofU: {Z{Y go MaturityAnalysisoftheBenefitPayments:FromtheFund





1bm df© / 1stFollowingYear 347.66 1,123.22

2am df© / 2ndFollowingYear 210.60 189.20

3am df© / 3rdFollowingYear 311.91 302.10

4Wm df© / 4thFollowingYear 284.78 292.88

5dm± df© / 5thFollowingYear 329.95 263.54

6 go 10 do df© VH$ Hw$b / SumofYears6To10 1,543.96 1,464.05

11 df© Am¡a CgHo$ Cna H$m ¶moJSumofYears11andabove 4,474.71 4,261.89

193


^m.H$.{Z.

C.C.I.

àmoOoŠQ>oS> Xm{`Ëd bm^ Ho$ n[an¹$Vm {dûcofU : {Z`moº$m goMaturityAnalysisoftheBenefitPayments:FromtheEmployer

(ê$. bmI ‘|) /(Rs.inlakh))




1bm df© / 1stFollowingYear - -

2am df© / 2ndFollowingYear - -

3am df© / 3rdFollowingYear - -

4Wm df© / 4thFollowingYear - -

5dm± df© / 5thFollowingYear - -

6 go 10 do df© VH$ Hw$b / SumofYears6To10 - -

11 df© Am¡a CgHo$ Cna H$m ¶moJSumofYears11andabove

- -

g§doXZerb {dûcofU / Sensitivity Analysis (ê$. bmI ‘|) /(Rs.inlakh)



Mmby YmaUmAm| na àmoOoŠQ>oS> bm^ Xm{`Ëd ProjectedBenefitObligationonCurrentAssumptions 3,434.00 4,012.79

{S>ñH$mD$§qQ>J Xa ‘| So>ëQ>m> à^md H$m +1% n[adV©Z DeltaEffectof+1%ChangeinRateofDiscounting (246.81) (232.18)

{S>ñH$mD$§qQ>J H$s Xa ‘| So>ëQ>m à^md H$m -1% n[adV©Z DeltaEffectof-1%ChangeinRateofDiscounting 284.50 267.95

doVZ d¥{Õ H$s Xa ‘| So>ëQ>m à^md H$m +1% n[adV©Z DeltaEffectof+1%ChangeinRateofSalaryIncrease 238.96 235.22

doVZ d¥{Õ H$s Xa ‘| So>ëQ>m à^md H$m -1% n[adV©Z DeltaEffectof-1%ChangeinRateofSalaryIncrease (225.89) (217.54)

H$‘©Mmar Q>Z©Amoda H$s Xa ‘| So>ëQ>m à^md H$m +1% n[adV©Z DeltaEffectof+1%ChangeinRateofEmployeeTurnover 24.48 21.57

H$‘©Mmar Q>Z©Amoda H$s Xa ‘| So>ëQ>m à^md H$m -1% n[adV©Z DeltaEffectof-1%ChangeinRateofEmployeeTurnover (27.58) (24.26)

194

^m.H$.{Z.

C.C.I.


· g§doXZerb {dûcofU H$mo [anmo{Q>ªJ Ad{Y H$s g‘m{á na

hmoZodmbo g§~§{YV ‘mÝ`VmAm| Ho$ {Za§Va g§^m{dV n[adV©Zm|

Ho$ AmYma na {ZYm©[aV {H$`m J`m h¡ O~{H$ AÝ` ‘mÝ`VmE°§

pñWa aIr JB© h¡ &

· Cnamoº$ àñVw{V g§doXZerb {dûcofU àmoOoŠQo>S> ~oZr{’$Q>

Xm{`Ëd ‘| dmñV{dH$ n[adV©Z H$m à{V{Z{YËd Zht H$aVr

Š`m|{H$ `h g§^mdZm Zht h¡ {H$ ‘mÝ`VmAm| ‘| n[adV©Z

EH$ Xygao go AbJ hmo & Hw$N> ‘mÝ`VmE°§ EH$ Xygao go Ow‹S>r

hþB© h¡&

· AmJo Cnamoº$ g§doXZerb {dûcofU H$mo àñVwV H$aZo ‘|

àmoOoŠQ>oS> Am°~brJoeZ H$s dV©‘mZ ‘yë` àmoOoŠQ>oS> `y{ZQ>

H«o${S>Q> ‘oWS> H$m Cn`moJ H$aHo$ JUZm H$s JB© h¡ Omo

VwbZ nÌ ‘| ‘mÝ`Vm {XE AZwgma àmoOoŠQ>oS> ~oZr{’$Q>

Am°~brJoeZ H$s JUZm ‘| Cgr nÕ{V H$m Cn`moJ {H$`m

J`m h¡ &

· g§doXZerb {dûcofU H$mo V¡`ma H$aZo ‘| {nN>bo dfm] go

Cn`moJ H$s JB© nÕ{V d ‘mÝ`VmAm| ‘| H$moB© n[adV©Z Zht

h¡&

ZmoQ²g

· [anmoQ>© ‘| {XE JE {ddaU Ho$ AZwgma CnXmZ {Z{Y H$s

ñH$s‘ Ho$ AZwgma ^wJVmZ `mo½` h¡ &

· AÝ` ì`mnH$ Am` Ho$ A§VJ©V KQ>Zm H$s Ad{Y ‘|

~r‘m§{H$H$ bm^/hm{Z H$mo ‘mÝ`Vm Xr JB© h¡ & Cn`wº$$

g^r [anmoQ>© H$s JB© AÝ`> ì`mnH$ Am` Ho$ Am±H$‹S>o H$amYmZ

H$m gH$b h¡ &

· doVZ EgHo$boeZ VWm EQ´>r[Q>eZ H$mo H§$nZr Ûmam gy{MV

{H$E AZwgma {dMma {H$`m J`m h¡ H$‘©Mm[a`m| H$s nXmoÞ{V

VWm ‘m±J d Amny{V© H$m {dMma H$aVo hþE CÚmoJ H$s àWm

Ho$ AZwgma àH$Q> {H$`m J`m h¡ &

· bm^ ^wJVmZ Ho$ ‘¡À`w[aQ>r {dûcofU ^{dî` Ho$ AmJo dfm]

Ho$ {bE Cn`wº$ ~Vm`o JE gXñ`m| hoVw g§~§{YV df© ‘|

^mdr doVZ, EQ´>r{Q>eZ VWm ‘¥Ë`w H$mo Ü`mZ ‘| aIVo hþE

AZ{S>ñH$mD§$Q>oS> ZH$X àdmh h¡ &

• Thesensitivityanalysishavebeendeterminedbasedon reasonablypossiblechangesof therespective assumptions occurring at the endof the reportingperiod,whileholdingallotherassumptionsconstant.

• Thesensitivity analysispresentedabovemaynot be representative of the actual change intheprojectedbenefitobligationasitisunlikelythat the change in assumptions would occurin isolation of one another as some of theassumptionsmaybecorrelated.

• Furthermore,inpresentingtheabovesensitivityanalysis, the present value of the projectedbenefit obligation has been calculated usingtheprojectedunitcreditmethodat theendofthereportingperiod,whichisthesamemethodasapplied in calculating theprojectedbenefitobligationasrecognizedinthebalancesheet.

• There was no change in the methods andassumptions used in preparing the sensitivityanalysisfromprioryears.

Notes

• Gratuity ispayableaspercompany'sschemeasdetailedinthereport.

• Actuarial gains/losses are recognizedin the period of occurrence under OtherComprehensive Income (OCI). All abovereportedfiguresofOCIaregrossoftaxation.

• Salaryescalation&attritionrateareconsideredasadvisedbythecompany;theyappeartobein line with the industry practice consideringpromotion and demand & supply of theemployees.

• Maturity Analysis of Benefit Payments isundiscounted cashflows considering futuresalary, attrition& death in respective year formembersasmentionedabove.

195


^m.H$.{Z.

C.C.I.

· Am¡gV Ano{jV ^mdr godm AZw‘m{ZV nX H$s Ad{Y amoOJma bm^ Xm{`Ëd H$m à{V{Z{YËd H$aVm h¡ &

· H§$nZr Ûmam CnbãY H$am`r JB© n[ag§n{Îm H$m ‘yë` [anmo{Q>ªJ Ad{Y Ho$ {bE ßbmZ n[ag§n{Îm Ho$ C{MV ‘yë` na {dMma {H$`m J`m h¡ Š`m|{H$ h‘mao Ûmam CgH$m ‘yë`m§H$Z Zht {H$`m J`m h¡ &

JwUmË‘H$ àH$Q>rH$aU

· n¡am 139 (H$) n[a^m{fV bm^ `moOZm H$s {deofVmE°§

H§$nZr ^maV ‘| n[a^m{fV bm^ CnXmZ {Z{Y `moOZm h¡

({dÎm nmo{fV) & H§$nZr H$s n[a^m{fV bm^ CnXmZ moOZm

H$‘©Mm[a`m| Ho$ {bE A§{V‘ doVZ `moOZm h¡ {Og‘| AbJ

go àgme{ZH$ {Z{Y Ho$ A§eXmZ H$s Amdí`H$Vm h¡&

CnXmZ {Z{Y H$m Ý`mg ‘§S>b Ûmam {Z`§{ÌV Ý`mg go

à~§Y {H$`m OmVm h¡ & Ý`mg ‘§S>b `moOZm n[ag§n{Îm Ho$

àemgZ Ho$ {bE VWm {Zdoe Zr{V H$s n[a^mfm Ho$ {bE

CÎmaXm`r h¡&

· n¡am 139 (I) n[a^m{fV bm^ `moOZm go Ow‹S>o OmopI‘

CnXmZ {Z{Y n[a^m{fV bm^ `moOZm h¡ VWm H§$nZr

{ZåZ{bpIV OmopI‘ H$m Iwbmgm H$aVr h¡ &

· ã`mO Xa OmopI‘ : {S>ñH$mD§$Q> Xa ‘| {JamdQ> Omo gaH$mar à{V^y{V`m| go qbH$ h¡ & Bg Xa go Xo`VmAm| Ho$ dV©‘mZ ‘yë` ‘| d¥{Õ hmoJr {Oggo Cƒ àmdYmZm| H$s Amdí`H$Vm hmoJr & {S>ñH$mD§$Q> Xa ‘| {JamdQ> gm‘mÝ`V: n[ag§n{Îm H$s Ad{Y na {Z^©a n[ag§n{Îm Ho$ ‘mH}$Q> ‘yë` ‘| d¥{Õ Xem©Vr

h¡ &

· doVZ OmopI‘ : n[a^m{fV bm^ moOZm Xo`Vm H$m dV©‘mZ

‘yë`mo H$s gXñ`m| Ho$ ^mdr doVZ Ho$ g§X^© go JUZm

H$s OmVr h¡ & Bg àH$ma gXñ`m| Ho$ doVZ ‘| d¥{Õ Ho$

AZw‘m{ZV ñVa H$s VwbZm go `moOZm Xo`Vm ‘| d¥{Õ hmoJr&

· {Zdoe OmopI‘ : n[a^m{fV bm^ moOZm Xo`Vm Ho$ dV©‘mZ

‘yë` H$m {S>ñH$mD§$Q> Xa AnZmH$a JUZm H$s OmVr h¡ Omo

gaH$mar ~m°ÝS>g na [anmo{Q>ªJ Ad{Y H$s g‘m{á na ‘mH}$Q>

• Average Expected Future Service representsEstimatedTermofPost -EmploymentBenefitObligation.

• Value of asset provided by the company isconsidered as fair value of plan asset for theperiodofreportingassameisnotevaluatedbytheus.

Qualitative Disclosures

• Para 139 (a) Characteristics of definedbenefitplan

The Company has a defined benefit gratuityplaninIndia(funded).Thecompany’sdefinedbenefit gratuity plan is a final salary plan foremployees,whichrequirescontributions tobemadetoaseparatelyadministeredfund.

The fund is managed by a trust which isgovernedbytheBoardofTrustees.TheBoardofTrusteesareresponsiblefortheadministrationof theplanassetsandfor thedefinitionof theinvestmentstrategy.

• Para139(b)Risksassociatedwithdefinedbenefitplan

GratuityisadefinedbenefitplanandcompanyisexposedtotheFollowingRisks:

• Interest rate risk :A fall in the discount ratewhichislinkedtotheG.Sec.Ratewillincreasethepresentvalueoftheliabilityrequiringhigherprovision.A fall in the discount rate generallyincreases the mark to market value of theassetsdependingonthedurationofasset.

• SalaryRisk:Thepresentvalueofthedefinedbenefitplan liability iscalculatedby referencetothefuturesalariesofmembers.Assuch,anincrease in the salary of the members morethan assumed level will increase the plan'sliability.

• Investment Risk : The present value of thedefinedbenefitplanliabilityiscalculatedusingadiscountratewhichisdeterminedbyreferenceto market yields at the end of the reporting

196

^m.H$.{Z.

C.C.I.


period on government bonds. If the returnon plan asset is below this rate, itwill createa plan deficit. Currently, for the plan in India,ithasarelativelybalancedmixofinvestmentsin government securities, and other debtinstruments.

• Asset Liability Matching Risk : The planfaces the ALM risk as to the matching cashflow.SincetheplanisinvestedinlinesofRule101ofIncomeTaxRules,1962,thisgenerallyreducesALMrisk.

• Mortality risk : Since the benefits under theplanisnotpayableforlifetimeandpayabletillretirement age only, plan does not have anylongevityrisk.

• Para 139 (c) Characteristics of definedbenefitplans

During the year, there were no planamendments,curtailmentsandsettlements.

• Para147(a)

A separate trust fund is created to managetheGratuityplanandthecontribution towardsthetrustfundisdoneasguidedbyrule103ofIncomeTaxRules,1962.

41 Auditor’s Remuneration (Excluding Service Tax/GST)

(Rs.inlakh)

ParticularYearended31stMarch

2019

Yearended31stMarch

2018a)AuditFee 28.20* 21.60*b)Tax/VATAuditFees 7.50** 6.92**c)Forcertification 5.60 2.80d)ReimbursementofExpenses 1.33 1.10Total: 42.63 32.42

CnO H$mo {ZYm©[aV H$aVr h¡ & `{X `moOZm n[ag§n{Îm H$m

[aQ>©Z Bg Xa go {ZåZ hmo Vmo h ßbmZ KmQ>m CËnÞ H$aVm

h¡ & dV©‘mZ ‘| ^maV ‘| Bg `moOZm Ho$ {bE gaH$mar

à{V^y{V`m| VWm AÝ` CYma {bpIV Ho$ ê$n ‘| {Zdoe H$m

g§Vw{bV {‘{lV {Zdoe h¢ &

· n[ag§n{Îm Xo`Vm ‘¡qMJ OmopI‘ : Bg `moOZm ‘| ‘¡qMJ ZH$X àdmh hmoZo Ho$ H$maU EEbE‘ OmopI‘ h¡, My±{H$ `h ßbmZ Am`H$a {Z`‘mdbr 1962 Ho$ {Z`‘ 101 H$s bmB©Ýg Ho$ {Z{hV h¡ Bgr{bE `h gm‘mÝ`V: EEbE‘ OmopI‘ H$mo H$‘ H$aVm h¡ &

· ‘m°aQ>¡{bQ>r OmopI‘ : My±{H$ Bg `moOZm H$m bm^ AmOrdZ ^wJVmZ `mo½`$Z hmoH$a Ho$db [aQ>m`a‘|Q> H$s Am`w VH$ hr ^wJVmZ mo½` h¡ AV: Bg moOZm ‘| XrKm©d{Y OmopI‘ Zht

h¡ &

· n¡am 139 (J) n[a^m{fV bm^ ßbmZ H$s {deofVmE°§:

Bg df© Ho$ Xm¡amZ H$moB© ¶moOZm, g§emoYZ, n[aË¶mJ Am¡a

{ZnQ>mZ Zht Wo &

· n¡am 147 (H$) :

CnXmZ {Z{Y ßbmZ H$s ì`dñWm H$aZo Ho$ {bE EH$ AbJ

go Ý`mg {Z{Y g¥{OV H$s JB© h¡ VWm Am`H$a {Z`‘mdbr

1962 Ho$ {Z`‘ 103 Ûmam {XE JE ‘mJ©Xe©Z Ho$ AZwgma

Q´ñQ {Z{Y ‘| A§eXmZ {H$`m OmVm h¡ &

41. boIm narjH$m| H$m nm[al{‘H$ (godm H$a/OrEgQ>r H$mo

N>mo‹S>H$a)

(ê$. bmI ‘|)

{ddaUr31 ‘mM©, 2019 H$mo g‘má df©

31 ‘mM©, 2018 H$mo g‘má df©

H$) boIm narjm ewëH$ 28.20* 21.60*

I) H$a/d°Q> boIm narjm

ewëH$ 7.50** 6.92**

J) à‘mUrH$aU Ho$ {bE 5.60 2.80

K) ì`` H$s à{Vny{V© 1.33 1.10

Hw$b: 42.63 32.42

197


^m.H$.{Z.

C.C.I.

*IncludesincrementaldifferencesofAuditFeesofRs.4.20Lakh (PreviousYearRs.1.80) for thefinancialyear2017-18,paidduringthefinancialyear2018-19.

**IncludesincrementaldifferencesofTaxAuditFeesof Rs. 1.00 Lakh (Previous Year 0.50 lakh) for thefinancialyear2017-18,paidduringthefinancialyear2018-19.

42 Corporate Social Responsibility

TheBoardofDirectorshasapprovedasumofRs.37.79lakh(PreviousyearRs.32.44lakh)tobeincurredforCorporateSocialResponsibility(CSR)duringtheyear2018-19.

ThenatureofactualCSRexpenditureincurredisasfollows:

(Rs.inlakh)

Sr.No. Nature

Yearended31stMarch

2019

Yearended31stMarch

20181 Construction/

Acquisitionofany assets

- -

2 Onpurposeotherthanabove

37.79 32.44

Total 37.79 32.44

43 Fraud and Misappropriation

(a) InAkolabranchamisappropriationof1212FPbales at MSWC godown, Pusad Centre wasnoticed on 06.05.2010. A Criminal case wasregisteredagainsttheaccusedatpolicestationPusad videFirst InformationReport (FIR) no.117/10 dated 08.05.2010. The value of thesaid1212FPBalesisapproxRs.150.63lakh.Thesaidcaseisstillunderinvestigationbytheconcernedpoliceauthorities.

Duringtheinvestigation,Policerecovered900FPBalesandceased.Further,valueof300FPbales amounting to Rs. 37.49 lakh has beenrecovered from the accused and depositedwith the Investigating office L.C.B. Yeotmal.For balance 12 FP bales police investigation

*{dÎmr` df© 2017-18 Ho$ {bE BZH«$s‘|Q>b A§Va H$mo em{‘b

H$aHo$ 4.20 bmI ê$. (JV df© 1.80) boIm narjm ewëH$ H$m

^wJVmZ {dÎm df© 2018-19 ‘| àXmZ {H$`m J`m & ** {dÎmr¶ df© 2017-18 Ho$ {bE BZH«$s‘|Q>b A§Va H$mo em{‘b

H$aHo$ 1.00 bmI ê$. (JV df© 0.50 bmI) boIm narjm ewëH$

H$m ^wJVmZ {dÎm df© 2018-19 ‘| àXmZ {H$`m J`m &

42. {ZJ{‘V gm‘m{OH$ Xm{`Ëd

{ZXoeH$ ‘§S>b Zo df© 2018-19 Ho$ Xm¡amZ {ZJ{‘V gm‘m{OH$ Xm{`Ëd (grEgAma) Ho$ {bE 37.79 bmI (JVdf© 32.44 bmI) ê$. H$s IM© H$s OmZo dmbr am{e

H$mo AZw‘mo{XV {H$`m h¡ &

dmñV{dH$ ê$n go grEgAma ‘| IM© H$s JB© am{e H$s

àH¥${V {ZåZmZwgma h¡ &

(ê$. bmI ‘|)

H«$.g§.

{df` 31 ‘mM©, 2019 H$mo g‘má$ df©

31 ‘mM©, 2018 H$mo g‘má$ df©

1.{Z‘m©U/g§n{Îm

A{^YmaU - -

2.Cn`w©º$m H$mo N>mo‹S>H$a

H$moB© bú` 37.79 32.44

Hw$b 37.79 32.44

43. YmoIm Am¡a Xw{d©{Z`moJ

H$) AH$mobm emIm ‘| {X. 06.05.2010 H$mo nwgX H|$Ð Ho$

E‘EgS>ãë¶ygr$ JmoXm‘ ‘| 1212 nyU©~§{YV Jm±R>m| H$m EH$

Xw{d©{Z`moJ nm`m J`m & Xmofr Ho$ {dê$Õ nw{bg ñQ>oeZ nwgX

‘| E’$Am`Ama g§. 117/10 {X. 08.05.2010 Ûmam

EH$ Anam{YH$ ‘m‘bm XO© {H$`m J`m & H${WV 1212

nyU©~§{YV Jm±R>m| H$m ‘yë` bJ^J 150.63 bmI ê$. h¡&

g§~§{YV nw{bg àm{YH$mar Ûmam A^r ^r ‘m‘bo H$s Om±M

Omar h¡ & Om§M Ho$ Xm¡amZ nw{bg Zo 900 Jm§R>o ~am‘X

H$aHo$ grO H$s h¡ & AmJo 37.49 bmI ê$. H$s am{e

Omo 300 nyU©~§{YV Jm±R>m| H$s h¡ Xmofr go dgyb H$aHo$

Eb.gr.~r `dV‘mb H$m`m©b` ‘| O‘m H$s J`r h¡ & eof

198

^m.H$.{Z.

C.C.I.


is in progress. Currently the case is beinginvestigatedbyCID,Amravati.Theaboveisnotconsidered in thevaluationof thestock.Afterthe approval of Hon’ble session court, Pusadthe 900 bales has been sold through onlinee-auctionanddeposited the saleproceedsofRs.179lakhinCourttillfurtherproceedings.AnyrealizationonthisaccountwillbeaccountedforasandwhenreceivedfromL.C.BYeotmalandCourt.

(b) In Guntur branch, during the year 2007-08,misappropriation of stock of 233 cotton balesand28882metersofGreyClothwasobservedand thesamewasnot consideredasClosingStockforvaluationpurpose.Thematterisnowunder Trial Court. During investigation Policerecovered100cottonbales,whichwerehandedover by the police to theCompany. The said100cottonbalesweresoldduring2010-11asperorderoftheHonorableCourt,ChilakaluripetandanamountofRs.20.81lakhwasrealizedthereof. The amount of Rs. 19.98 lakh afterdeductingexpensesondisposalofbalesofRs.0.83lakhhasbeendepositedwiththecourton19.4.2011.Thesamewillbeaccountedasandwhenthecaseissettled.

(c) During theCotton season 2014-15, abnormaldifference in press and delivery weight wereobserved at Maur and Talwandi centers ofBathinda Branch. The Center-incharge andsubordinate staff were charge-sheeted andpenaltyofrecoveryof80%oflosswasimposeduponthecenter-incharge(amountinvolvedRs.18.79lakh).Thesubordinatestaffwasimposedapenaltyof reduction toa lower stage in thetime scale of pay. Further, it was found thatthe factories at these centers hadnot carriedout ginningworkasper thequality standardsof the Corporation. After following the dueprocedure of law, the security amount of theconcernedfactorywasforfeitedandthefactorywas blacklisted. The Center-in charge andsubordinate staff have been charge-sheetedundertherulepertainingtomajorpenalty.The

12 nyU©~§{YV Jm±R>m| Ho$ {bò nw{bg Om±M Mb ahr h¡ &

dV©‘mZ ‘| `h Om±M grAmB©S>r, A‘amdVr Ûmam H$s Om ahr

h¡ & Cnamoº$ H$mo ñQ>m°H$ Ho$ ‘yë`m§H$Z ‘| em{‘b Zht {H$`m

J`m h¡ & ‘mZZr` goeZ H$moQ>© Ho$ AZw‘moXZ Ho$ nümV 900

Jm±R>| B© Am°ŠeZ Ûmam ~oMr JB© VWm {~H«$s go àmá 1.79

H$amo‹S> ê$. AJbr H$ma©dmB© VH$ H$moQ>© Ho$ nmg O‘m H$s

JB©& Ebgr~r `dV‘mb d Ý`m`mb` go Bg ~mao ‘| {H$gr

àH$ma H$s àm{á H$mo O~ H$^r ^r àmá {H$`m OmòJm V~

boIm ImVm| ‘| XO© H$a {b`m OmòJm &

I) Jw§Vya emIm ‘| df© 2007-08 Ho$ Xm¡amZ 233 ê$B© H$s

Jm±R>m| Ho$ ñQ>m°H$ Am¡a 28882 ‘rQ>g© J«o Šbm°W Ho$ ñQ>m°H$

H$m Xw{d©{Z`moOZ nm`m J`m VWm ‘yë`m§H$Z à`moOZ Ho$ {bE

Bgo A§{V‘ ñQ>m°H$ Ho$ ê$n ‘| Zht ‘mZm J`m h¡ & ‘m‘bm

A~ Q´>m`b H$moQ>© Ho$ AYrZ h¡ & Om§M Ho$ Xm¡amZ nw{bg

Zo 100 ê$B© Jm±R>| àmá H$s h¡ Omo nw{bg Ûmam H§$nZr H$mo

gm¢nr J`r Wr & H${WV 100 nyU©~§{YV ê$B© H$s Jm±R>|

‘mZZr` Ý`m¶mb` {MbH$mbyarnoQ> Ho$ AmXoe Ho$ AZwgma

df© 2010-11 ‘| ~oMr J`r Wr Am¡a 20.81 bmI ê$.

H$s am{e àmá hþB© & 0.83 bmI ê$. H$s am{e Jm±R>m| Ho$

{ZnQ>mZ Ho$ {bE IM© Ho$ ê$n ‘| H$mQ>Zo Ho$ ~mX 19.98

bmI ê$. H$s am{e {X. 19.04.2011 H$mo Ý`m`mb` ‘|

O‘m H$s J`r & ‘m‘bo H$m {ZnQ>mZ hmoZo Ho$ ~mX Bgo boIm

ImVm| ‘| {JZm OmòJm &

J) H$nmg ‘m¡g‘ 2014-15 Ho$ Xm¡amZ ^qQ>S>m emIm Ho$ ‘m¡a

d Vb~§Xr H|$Ðmo na àog d {S>brdar doQ> ‘| Agm‘mÝ` A§Va

nm`m J`m & Ho$ÝÐ à^mar d CZHo$ AYrZñW H$‘©Mm[a`m|

H$mo MmO©erQ> Omar {H$`m J`m VWm Ho$ÝÐ à^mar H$mo H$s JB©

hm{Z H$m 80% dgyb H$aZo H$m X§S> bJm`m J`m (18.79

bmI ê$. H$s am{e em{‘b) AYrZñW H$‘©Mm[a`m| H$mo

dV©‘mZ go {ZMbo ñVa na doVZ {ZYm©aU H$aZo H$m X§S>

bJm`m J`m & AmJo h nm`m J`m {H$ BZ Ho$ÝÐm| na {OqZJ

’¡$ŠQ>m[a`m| Zo {OqZJ H$m`© {ZJ‘ Ho$ ¹$m{bQ>r ‘mZX§S>m|

Ho$ AZwgma nyU© Zht {H$`m & {d{YH$ H$m`©dmhr H$aZo Ho$

nümV g§~§{YV ’¡$ŠQ>ar H$s A‘mZV am{e OãV H$s JB©

VWm ’¡$³Q´>r`m| H$mo ãb¡H$ {bñQ {H$`m J`m & Ho$ÝÐ à^mar

d AYrZñW ñQ>m’$ H$mo ~‹S>m X§S> XoZo Ho$ CÔoí` Ho$ A§VJ©V

MmO©erQ> Omar H$s JB©& g‘rjm àm{YH$mar Zo 15.37

199


^m.H$.{Z.

C.C.I.

ReviewingAuthority has passed the order bylevyingpenaltyofRs.15.37lakhs,whichisfullyrecoveredtillSeptember2018.

(d) A cotton seed buyer complained that neithertheyhavepurchasednorliftedanycottonseedvaluing Rs. 57.65 lakh from Sadashivpethcentre ofWarangal branch pertaining to cropyear2014-15underonecontractnumberwhichis totally false and fabricated. After internalinvestigation the matter has been referred toCBI.Thereisnofinancialimpactonthefinancialstatementsofthecompany.

(e) During the cotton season 2017-18, a centrein-charge of Kaledia, Naswadi and Palej ofAhmadabad branch purchase the kapas ofbelow prescribed quality parameter. Further,hemisappropriated kapas equivalents to 697FPbalesvaluingtoRs.122.00lakhand1600quintalsofcottonseedvaluingtoRs.30.00lakhoutof thekapaspurchasedbyhimatKalediacentre.FIRhasbeenlodgedagainstthecentrein-charge on 22.06.2018 at Naswadi PoliceStation.Policeinvestigationisunderprogress.Theaboveisnotconsideredinthevaluationofthestock.

44 (A)EarningsinForeignCurrency:(Rs.inlakh)

ParticularsYearended31stMarch

2019

Yearended31stMarch

2018ExportofGoodson:-

FOBbasis5151.60 Nil

CIFbasisNil Nil

Carryingcharges 77.75 NilInterest 20.61 Nil

ExchangedifferenceonExport 148.60 Nil

bmI ê$. X§S> bJmZo H$m AmXoe nm[aV {H$`m h¡, {OgHo$

gm‘Zo 31.09.2018 VH$ nyU©V: dgybr H$s br JB© h¡ &

K) EH$ H$m°Q>Z erS> IarXXma Zo {eH$m¶V H$s {H$ Z Vmo CÝhm|Zo H$moB© H$m°Q>Z erS> ‘yë¶ ê$. 57.65 bmI H$m H$moB© H$m°Q>Z erS> {b¶m h¡, Omo dma§Jb emIm Ho$ gXm{ednoQ> H|$ÝX go EH$ AZw~§Y g§»¶m Ho$ VhV ’$gb df© 2014-15 go g§~§{YV h¡, Omo nyar Vah go JbV Am¡a ‘ZJT>§V h¡& Am§V[aH$ Om§M Ho$ ~mX Bg ‘m‘bo H$mo gr~rAmB© H$mo ^oOm J¶m h¡, H§$nZr Ho$ {dÎmr¶ {ddaU na H$moB© {dÎmr¶ à^md

Zht h¡ &

S>.) H$m°Q>Z grOZ 2017-18 Ho$ Xm¡amZ Ah‘Xm~mX emIm Ho$

H$bmo{S>¶m, Zgdm‹S>r Am¡a nmboO Ho$ÝÐ à^mar Zo {ZYm©[aV

JwUdÎmm n¡am ‘rQ>a go ZrMo IarX H$s h¡ & BgHo$ Abmdm,

CÝhm|Zo 697 E’$nr~oëg Jm§R>m| Ho$ {bE 122.00 bmI

ê$. Am¡a 1600 q¹$Q>b H$m°Q>Z erS> H$m ê$. 30.00 bmI

H$bo{S>¶m Ho$ÝÐ ‘| CZHo$ Ûmam IarXo J¶o / Ho$ÝÐ à^mar

Ho$ pIbm’$ 22.06.2018 H$mo Zmgdm‹S>r nw{bg ñQ>oeZ

‘| E’$AmB©Ama XO© H$s JB© h¡ & nw{bg H$s Om±M Mb ahr

h¡& ¶h {X¶o J¶o ñQ>m°H$ Ho$ ‘yë¶m§H$Z ‘| {dMma Zht {H$¶m

J¶m h¡ &

44 (H$) {dXoer ‘wÐm ‘| AO©Z :

(ê$. bmI ‘|)

{ddaUr31 ‘mM©, 2019

H$mo g‘má df©

31 ‘mM©, 2018

H$mo g‘má df©

‘mb Ho$ {Z`m©V na:-

E’$.Amo.~r Ho$ AmYma

na 5151.60 {Za§H$

gr.AmB©.E’$ Ho$

AmYma na {Za§H$ {Za§H$

bXmZ à^ma 77.75 {Za§H$

ã`mO 20.61 {Za§H$

{Z`m©V na {d{Z‘`

A§Va148.60 {Za§H$

200

^m.H$.{Z.

C.C.I.


(B)Expenditureinforeigncurency:(Rs.inlakh)

S.No. Particulars

Yearended31stMarch

2019

Yearended31stMarch

2018i) Travelling 7.66 1.73ii) Books,

PeriodicalsandSubscription

3.01 2.74

iii) Commissiononexport 52.12 Nil

iv) CarryingchargesandExchangedifferenceonExport

Nil Nil

45 Segment Reporting:

The Company is predominantly engaged incotton trading and this is the only reportablebusiness segment which is reviewed by thecompany’s chief operating decision maker.Further, revenues from external/foreigncustomers does not exceed quantitativethresholdlimitasperIndAS108–‘OperatingSegments’ during the financial year 2018-19,hence thecompany isnot required topresentsegmentinformation.

46. Related Party Disclosure

46.1 ListofRelatedParties:

A) GovernmentRelatedEntity:

S.No.

NameofRelatedParty Relation

1 NationalTextilesCorporationLtd.

UnderMinistryofTextiles,GovernmentofIndia(SignificantControloverboththeCompanies).

2 HindustanPetroleumCorporationLtd

CentralPSU

(I) {dXoer ‘wÐm ‘| ì``

(ê$. bmI ‘|)

H«$.

g§. {ddaUr

31 ‘mM©, 2019

H$mo g‘má df©

31 ‘mM©, 2018

H$mo g‘má df©

i) `mÌm 7.66 1.73ii) nwñVHo$,

n{ÌH$mE°§ Ed§

A{^XmZ

3.01 2.74

iii) {Z`m©V na H$‘reZ 52.12 {Za§H$

iv) {Z`m©V na H¡$[a¨J MmO}g VWm {d{Z‘` A§Va

{Za§H$ {Za§H$

45. goJ‘|Q> [anmo{Qª>J :

H§$nZr ‘w»¶ ê$n go H$m°Q>Z ì¶mnma H$m H$m¶© H$aVr h¡

Am¡a EH$‘mÌ [anmoQ>© ¶mo½¶ ì¶mnma H$m EH$ ^mJ h¡, {OgH$s

g‘rjm H§$nZr Ho$ à‘wI {ZU©¶ ~mOma Ûmam H$s OmVr h¡&

BgHo$ Abmdm, ~mhar/{dXoer J«mhH$m| go amOñd {dÎmr¶

df© 2018-19 Ho$ Xm¡amZ B§S>EEg 108 Ho$ àMmbZ I§S>

Ho$ AZwgma ‘mÌmË‘H$ gr‘m go A{YH$ Zht h¡, Bg{bE

H§$nZr goJ‘|Q> H$s OmZH$mar àñVwV H$aZo H$s Amdí¶H$Vm

Zht h¡ &

46. g§~§{YV nmQ>u H$m àH$Q>rH$aU

46.1 g§~§{YV nm{Q©>`m| H$s gyMr:

H$) gaH$ma g§~§Yr gÎmm :

H«$.

g§.g§~§{YV nmQ>u H$m Zm‘ g§~§Y

1 ZoeZb Q>oŠgQ>mB©b

H$m°nm}aoeZ {b.

^maV gaH$ma, dó$ ‘§Ìmb` Ho$ AYrZ (XmoZmo H§$nZr`m| na ‘hÎd nyU© {Z`§ÌU)

2 qhXwñVmZ noQ´>mo{b`‘

H$m°nm}aoeZ {b.

H|$Ðr` gmd©O{ZH$ joÌ H$m CnH«$‘

201


^m.H$.{Z.

C.C.I.

3 BharatSancharNigamLimited

CentralPSU

4 MahanagarTelephoneNigamLimited

CentralPSU

5 BalmerLawrie&CoLtd

CentralPSU

B) Trusts(includingpostretirementemployeebenefit trust) wherein the Corporationhaving control

i. The Cotton Corporation of India LimitedEmployeeContributoryProvidentFund.

ii. The Cotton Corporation of India LimitedContributorySuperannuationFund.

iii. The Cotton Corporation of India LimitedEmployeesGratuityFund.

C) KeyManagementPersonnel C.1 Whole Time Director

i. Dr. P.Alli Rani, Chairman-cum-ManagingDirector

ii. Shri Pradeep Kumar Agarwal, Director(Finance)

iii. ShriM.M.Chockalingam,Director(Marketing) C.2 Company Secretary

i. ShriL.K.Gupta,CompanySecretary

C.3 Independent Director

i. Ms.GracePinto(Non-ExecutiveDirector)

ii. Ms. Rajika T. Kacheria (Non-ExecutiveDirector)

C.4 Government Nominee Director

i. ShriS.R.Gaikwad(Non-ExecutiveDirector)

3 ^maV g§Mma {ZJ‘ {b. H|$Ðr` gmd©O{ZH$ joÌ H$m CnH«$‘

4 ‘hmZJa Q>o{b’$moZ {ZJ‘ br.


5 ~m‘a bm°ar E§S> H§$nZr {b.


I) Ý¶mg (godm{Zd¥{Îm Ho$ ~mX Ho$ H$‘©Mmar bm^ Ý¶mg

g{hV) {Og‘| {ZJ‘ H$m {Z¶§ÌU hmo

i. ^maVr` H$nmg {ZJ‘ {b{‘Q>oS> H$‘©Mmar A§eXm`r

^{dî` {Z{Y

ii. ^maVr` H$nmg {ZJ‘ {b{‘Q>oS> A§eXm`r A{Yd{f©Vm

{Z{Y

iii. ^maVr` H$nmg {ZJ‘ {b{‘Q>oS> H$‘©Mmar CnXmZ

{Z{Y

J) ‘w»` à~§YZ A{YH$mar

J.1 nyU©H$m{bH$ {ZXoeH$

i. S>m°. nr A{„ amZr, AÜ`j Ed§ à~§Y {ZXoeH$

ii. lr àXrn Hw$‘ma AJ«dmb, {ZXoeH$ ({dÎm)

iii. lr E‘. E‘. Mmo¸$mqbJ‘, {ZXoeH$ ({dnUZ)

J.2 H§$nZr g{Md

i. lr Eb. Ho$. Jwám, H§$nZr g{Md

J.3 ñdV§Ì {ZXoeH$

i. gwlr J«og qnQ>mo, (J¡a H$m`©H$mar {ZXoeH$)

ii. gwlr am{OH$m Q>r. H$Mo[a`m, (J¡a H$m`©H$mar {ZXoeH$)

J.4 gaH$ma Ûmam Zm{‘V {ZXoeH$

i. lr Eg. Ama. Jm`H$dm‹S>, (J¡a H$m`©H$mar {ZXoeH$)

202

^m.H$.{Z.

C.C.I.


46.2 Details of Transactions:

46.2.1.TransactionwithGovernmentRelatedEntity

(Rs.inlakh)

NameofRelatedParty

NatureOfTransaction

Year ended31stMarch2019

Year ended

31stMarch2018

NationalTextiles

Corporation Ltd.

SaleofFPBales 29117.08 18143.57

TheCompanyhasalsoenteredintoothertransactionssuchasrent income,telephoneexpenses,air traveland deposits etc. with other various governmentrelated entities.These transactions are insignificantindividuallyandcollectivelyandhencenotdisclosedasperIndAS24–‘RelatedPartyDisclosures’.Thetransitions with government related entities weremade on terms equivalent to those that prevail inarm’slengthtransactions.

46.2.2 Outstanding Balance with GovernmentRelatedEntity

(Rs.Inlakh)

NameofRelatedParty

NatureOf

Transaction

As at 31.03.2019

As at 31.03.2018

NationalTextile

Corporation Ltd.

TradeReceivable 6853.83 5850.54

46.2 boZ XoZ H$m {ddaU

46.2.1 gaH$ma g§~§{YV BH$mB© Ho$ gmW boZ-XoZ

(ê$. bmI ‘|)

g§~§{YV nmQ>u

Ho$ Zm‘

boZoXoZ H$s

àd¥{Îm

31 ‘mM© 2019

H$mo g‘má df©

31 ‘mM© 2018

H$mo g‘má df©

ZoeZb Q>oŠgQ>mB©b H$m°nm}aoeZ

{b.

E’$nr Jm±R>m| H$s {~H«$s

29117.08 18143.57

H§$nZr Zo AÝ¶ boZ-XoZ ‘| ^r O¡go H$s {H$am¶m Am¶, Q>obr’$moZ

ì¶¶, hdmB© ¶mÌm Ed§ {S>nmo{PQ> ‘| AÝ¶ g§~§{YV gaH$mar g§ñWmAm|

go boZ-XoZ {H$¶m h¡ & ¶o boZ XoZ ì¶{º$JV Ed§ gm‘y{hH$ ê$n go

ZJÝ¶ h¡ & Bg{bE BgH$m Iwbmgm B§S> EEg 24 "g§~§{YV nmQ>u

Ho$ àH$Q>rH$aU' ‘| Zht {H$¶m J¶m h¡ & gaH$mar g§~§{YV g§ñWmAm|

Ho$ gmW boZ XoZ CZ eVm} na {H$¶m J¶m h¡ Omo {H$ AÝ¶ Ho$ gmW

CZHo$ Ûmam Am‘©g boÝW ì¶dhma na {H$¶m J¶m h¡ &

46.2.2 gaH$ma g§~§{YV BH$mB© Ho$ gmW ~H$m`m am{e

(ê$. bmI ‘|)

g§~§{YV

nmQ>u Ho$ Zm‘

boZoXoZ H$s

àd¥{Îm

31 ‘mM© 2019

H$mo g‘má df©

VH$

31 ‘mM© 2018

H$mo g‘má df©

VH$

ZoeZb Q>oŠgQ>mB©b H$m°nm}aoeZ

{b.

àmß`

ì`mmnma6853.83 5850.54

46.2.3 ‘w»` à~§YZ A{YH$mar H$mo nm[al{‘H$ ^wJVmZ46.2.3RemunerationpaidtoKeyManagementPersonnel.

(ê$. bmI ‘|)/(Rs.Inlakh)

‘w»` à~§YZ A{YH$mar KeyManagement

Personnel

Aënmd{Y H$‘©Mmar bm^ ShortTermEmployeeBenefit

godm-{Zd¥{Îm Ho$ ~mX H$m bm^ Post-EmploymentBenefit

31 ‘mM© 2019 H$mo g‘má df©

Yearended31stMarch2019

31 ‘mM© 2018 H$mo g‘má df©


31 ‘mM© 2019 H$mo

g‘má df© Yearended

31stMarch2019

31 ‘mM© 2018 H$mo g‘má df©


AÜ`j Ed§ à~§Y {ZXoeH$ Chairman-Cum-ManagingDirector 61.28 25.67 23.95 4.03

203


^m.H$.{Z.

C.C.I.

1. dV©‘mZ [anmo{Q>ªJ Ad{Y ‘| à‘wI à~§YZ H${‘©¶m| H$mo AÝ¶

XrK©H$m{bH$ bm^, g‘m{á bm^ Am¡a eo¶a ~og ^wJVmZ

"eyÝ¶' (JV df© eyÝ¶) h¡ &

2. H§$nZr A{Y{Z¶‘ 2013 Ho$ I§S> 197 Ho$ àmdYmZ

à{Vny{V© Ho$ g§~§Y ‘| {‘ZrñQ´>r Am°’$ H$mnm}aoQ> A’o$¶a

(^maV gaH$ma) Ûmam Omar A{YgyMZm g§»¶m OrEgAma

463 (B©) {XZm§H$ 05 OyZ, 2015 VH$ H§$nZr Ho$ {bE

bmJy Zht hmoVo h¢ &

‘w»` à~§YZ A{YH$mar Ho$ godm{Zd¥{Îm Ho$ ~mX H$m bm^

{ZXoeH$ ({dÎm) Director(Finance) 49.24 42.76 35.18 29.13

{ZXoeH$ ({dnUZ) Director(Marketing) 42.57 45.71 28.80 15.49

H§$nZr g{Md CompanySecretary 42.00 39.91 22.58 23.89

Hw$b / Total 195.09 154.05 110.51 72.54

1. Other long term benefit, termination benefitandsharebasedpaymenttoKeyManagementPersonnelinthecurrentreportingperiodisNil(previousyearNil).

2. The provisions of Section 197 of theCompaniesAct,2013inrespectofManagerialRemuneration are not applicable to theCompany vide notification no. GSR 463(E)dated 05th June 2015 issued by Ministry ofCorporateAffairs(GovernmentofIndia).

Breakup of Post Post-Employment Benefit to KeyManagementPersonnel


‘w»` à~§YZ

A{YH$mar Key

ManagementPersonnel

31 ‘mM© 2019 H$mo g‘má df© Yearended31stMarch2019

31 ‘mM© 2018 H$mo g‘má df© Yearended31stMarch2018

CnXmZ Gratuity

Nw>Å>rLeave

godm {Zd¥{Îm Ho$ nümV

{M{H$Ëgm bm^ `moOZm PostRetirementMedicalBenefit

Scheme

Hw$b Total

CnXmZGratuity

Nw>Q¥>Q>rLeave

godm {Zd¥{Îm Ho$ nüm¥V

{M{H$Ëgm bm^ `moOZm PostRetirementMedicalBenefit

Scheme

Hw$b Total

AÜ`j Ed§

à~§Y {ZXoeH$ Chairman-Cum-ManagingDirector

0.04 23.41 0.50 23.95 0.00 3.57 0.46 4.03

{ZXoeH$ ({dÎm) Director(Finance)

15.19 19.60 0.39 35.18 14.24 14.54 0.35 29.13

{ZXoeH$ ({dnUZ) Director(Marketing)

8.61 19.65 0.54 28.80 6.81 8.18 0.50 15.49

H§$nZr g{Md CompanySecretary

11.32 10.98 0.28 22.58 10.72 12.92 0.25 23.89

Hw$b / Total 35.16 73.64 1.71 110.51 31.77 39.21 1.56 72.54

204

^m.H$.{Z.

C.C.I.


46.2.4 ñdV§Ì {ZXoeH$m| H$mo ^wJVmZ H$s JB© {gqQ>J ’$sg

(ê$. bmI ‘|)

ñdV§Ì {ZXoeH$ 31 ‘mM© 2019 H$mo g‘má df©

31 ‘mM© 2018 H$mo g‘má df©

lr‘Vr J«og E. qnQ>mo 1.20 0.40

lr‘Vr am{OH$m Q>r.

H$Mo[a`m 1.40 0.40

Hw$b 2.60 0.80

46.2.4SittingfeespaidtoIndependentDirectors

(Rs.inlakh)

IndependentDirectors



Ms.GraceA.Pinto 1.20 0.40Ms.RajikaT.Kacheria 1.40 0.40Total 2.60 0.80

46.2.5 ‘w»` à~§YZ A{YH$mar Ho$ gmW ~H$m`m am{e 46.2.5OutstandingBalancewithKeyManagementPersonnel


{ZXoeH$m| Ho$ Zm‘DirectorsName

01/04/2018 H$mo Ama§{^H$ eof Opening

Balanceason01/04/2018

df© Ho$ Xm¡amZ {b`m J`m

Takenduringtheyear

df© Ho$ Xm¡amZ dmng {H$`m J`m

Repaidduringtheyear

31/03/2019 H$mo ~H$m`m am{e Balance

outstandingason31/03/2019

df© Ho$ Xm¡amZ A{YH$V‘ eof am{e

MaximumBalance

OutstandingDuringtheyear

{ZXoeH$ ({dnUZ) Director(Marketing)

4.24(10.00)

0.00(0.00)

4.24(5.76)

0.00(4.24)

4.24(10.00)

H§$nZr g{Md CompanySecretary

0.66(1.00)

0.00(0.00)

0.33(0.33)

0.33(0.66)

0.66(1.00)

(JV df© Ho$ Am±H$‹S>o H$moð>H$ ‘| {XImE JE h¡)(Previousyearfiguresareshowninbracket)

46.2.6 Q´>ñQ> Ho$ gmW boZXoZ (H$‘©Mmar bm^ `moOZm) 46.2.6.TransactionwithTrust(EmployeeBenefitPlan)

(ê$. bmI ‘|) / (Rs.InLakh)

g§~§{YV nmQ>u H$m Zm‘ NameofRelatedParty

boZXoZ H$s àd¥{Îm NatureOfTransaction

31 ‘mM© 2019 H$mo g‘má df©


31 ‘mM© 2018 H$mo g‘má df©


grgrAmB© H$‘©Mmar A§eXm`r ^{dî` {Z{Y CCIEmployeeContributoryProvidentFund

A§eXmZ Contribution 448.15 388.78

grgrAmB© A§eXm`r A{Yd{f©Vm {Z{Y CCIContributorySuperannuationFund.

A§eXmZContribution

85.67 1,196.81

grgrAmB© H$‘©Mmar CnXmZ {Z{Y CCIEmployeesGratuityFund.

A§eXmZContribution

1,214.78 134.16

205


^m.H$.{Z.

C.C.I.

46.2.7 Q´>ñQ> go ~H$m`m am{e / 46.2.7.OutstandingbalancewithTrusts(ê$. bmI ‘|) / (Rs.inlakh)

g§~§{YV nmQ>u H$m Zm‘ NameofRelatedParty

boZoXoZ H$s àd¥{Îm NatureofTransaction

31 ‘mM© 2019 H$mo

g‘má df© Asat31.03.2019

31 ‘mM© 2018 H$mo

g‘má df©Asat31.03.2018

grgrAmB© H$‘©Mmar A§eXm`r ^{dî` {Z{Y CCIEmployeeContributoryProvidentFund

{H$E JE ^wJVmZ Ho$ {dê$Õ

Q´ñQ> go àmß`

Receivablefromtrustagainstpaymentmadetoemployeesonbehalfof

trust

200.16 56.20


3.10 0.00

grgrAmB© H$‘©Mmar CnXmZ {Z{Y CCIEmployeesGratuityFund.

128.32 363.80


A§eXmZ Ho$ à{V

{dœmg H$aZo `mo½`Payabletotrusttowards

contribution

H$) H$‘©Mmar H$m A§eXmZ (a)Employee’sContribution

11.13 10.33

I) {Z`moº$m H$m A§eXmZ (b)Employer’sContribution

694.50 85.67

grgrAmB© H$‘©Mmar CnXmZ {Z{YCCIEmployeesGratuityFund.

43.58 1214.78

47. {dÎmt` df© 2018-19 Ho$ Xm¡amZ {ZJ‘ Zo JV df© 10.77

bmI Jm±R>m| Ho$ gm‘Zo (`m{Z 6.94 bmI dm{UpÁ`H$

IarX n[aMmbZ d 3.83 bmI Jm±R>o Ý`y²ZV‘ g‘W©Z

‘yë` n[aMmbZ) 11.03 bmI Jm±R>| `m{Z (0.25 bmI

Jm±R> dm{UpÁ`H$ IarXr n[aMmbZ VWm 10.78 bmI Jm±R>|

Ý`yZV‘ g‘W©Z ‘yë` n[aMmbZ) H$s IarX H$s h¡ VWm

{nN>bo df© 2.81 bmI Jm±R>m| (`m{Z 1.59 dm{UpÁ`H$

IarX n[aMmbZ VWm 1.22 bmI Jm±R>o Ý`yZV‘ g‘W©Z

‘yë` n[aMmbZ) H$s VwbZm ‘| dV©‘mZ df© ‘| 8.35

bmI Jm±R>| (`m{Z 5.94 bmI dm{UpÁ`H$ n[aMmbZ VWm

2.41 bmI Jm±R>o Ý`yZV‘ g‘W©Z ‘yë` n[aMmbZ) ~oMr

h¡ & Bg{bE bm^ hm{Z {ddaUr Ho$ {nN>bo df© Ho$ Am±H$‹S>m|

go VwbZm `mo½` Zht h¡ &

48. XrKm©d{Y g§{dXm Ho$ ~mao ‘| àH$Q>rH$aU

So>[ado{Q>d g§{dXmAm| H$mo em{‘b H$aVo hþE H§$nZr Ho$ nmg

H$moB© XrKm©d{Y g§{dXm Zht h¡ {OgHo$ H$maU H§$nZr H$mo

H$moB© ^mdr Am{W©H$ hm{Z hmo gHo$ &

47 During the financial year 2018-19, theCorporation has procured 11.03 lakh bales(i.e. 0.25 lakh under commercial operationsand 10.78 lakh under MSP operations) asagainst10.77 lakhbales (i.e.6.94 lakhundercommercial operations and 3.83 lakh underMSP operations) during the previous yearandsold8.35 lakhbales (i.e. 5.94 lakhbalesunder commercial operations and 2.41 lakhbales underMSP) during the current year ascompared to 2.81 lakh bales (i.e. 1.59 lakhunder commercial operations and 1.22 lakhbalesunderMSPoperation)duringthepreviousyear.Therefore,thestatementofprofitandlossfigures is not comparable to previous year’sfigures.

48 Disclosures about long-term contracts

The company does not have any long–termcontractsincludingderivativescontractsforwhichtherecouldbeanymaterialforeseeablelosses.

206

^m.H$.{Z.

C.C.I.


49. BZdoñQ>a ES>çyHo$eZ VWm àmoQ>oŠeZ ’§$S>

H§$nZr Ûmam BZdoñQ>a ES>çyHo$eZ VWm àmoQ>oŠeZ ’§$S> ‘|

ñWmZm§VaU H$aZo `mo½` H$moB© am{e Zht h¡ &

50. brO à{V~ÕVm

H$) {dÎmr` brO

H§$nZr H$s AnZr {dÎmr` brO ì`dñWm h¡ `m{Z H§$nZr

Zo lrJ§JmZJa, ^rbdm‹S>m d Zdr ‘w§~B© ‘| brO na ^y{‘

br h¡ VWm H$mobH$mVm ‘| H$m`m©b` n[aga brO na {b`m

h¡ {dÎmr` brO Ho$ A§VJ©V Ym[aV n[ag§n{Îm`m| H$s brO

Q>‘© H$s Ad{Y gm‘mÝ`V: 99 dfm] Ho$ ^rVa g‘má hmoVr

h¡& H§$nZr Zo brO Ad{Y H$s Ama§^ ‘| EH$‘wíV> am{e

na brO ^wJVmZ {H$`m h¡ VWm brO Ad{Y Ho$ Xm¡amZ

^wJVmZ `mo½` H$moB© AmH$pñ‘H$ a|Q> Zht h¡ & brO Q>‘© H$s

g‘m{á na H§$nZr H$mo nÅ>m H$Vm© Ûmam {ZYm©[aV H$s JB©

brO a|Q> H$m ^wJVmZ H$aZo na Cgr Ad{Y Ho$ {bE brO

{dñVma na H$aZo H$m {dH$ën h¡ & brO YmaU g§n{Îm H$m

H¡$[a¨J ‘yë` H$m àH$Q>rH$aU ßbm§Q>, g§n{Îm d CnH$aU

VWm {Zdoe g§n{Îm ‘| {H$`m OmVm h¡ & brO H$s eVm] Ho$

AZwgma H§$nZr {bE JE à`moOZ Ho$ {bE brÁS> àmnQ>u H$m

BñVo‘mb H$a gH$Vr h¡ VWm nÅ>m H$Vm© Ûmam Bg na AÝ`

H$moB© ~§YZ Zht h¡ &

H$mobH$mVm ‘| brO na br JB© {~pëS§>J Ho$ ~mao ‘| H§$nZr

àË`oH$ df© 4.8 ê$. à{V ñ¹o$Aa ’w$Q> H$s Xa go dm{f©H$

a|Q> Ho$ ê$n ‘| wJVmZ H$aVr Am ahr h¡ {Og‘| brO Ad{Y

Ho$ Xm¡amZ àË`oH$ 10 dfm] Ho$ nyU© hmoZo na 10% H$s d¥Õr

H$s OmVr h¡ & {dî` ‘| Ý`yZV‘ brO wJVmZ VWm CZH$m

dV©‘mZ ‘yë`${ZåZmZwgma h¡ :-

49 Investor Education and Protection Fund

There were no amounts which were requiredtobetransferredtotheInvestorEducationandProtectionFundbytheCompany.

50 Lease commitments :

a) FinanceLease

The company is having finance leasearrangements i.e. land taken on lease atSriganganagar, Bhilwara, Kalamboli, NaviMumbaiandofficepremises inKolkatawhichis taken on lease. The lease term in respectofassetsacquiredunderfinance leaseexpirewithin90 to99years.Thecompanyhaspaidleaserentsinlumpsumatthebeginningofleaseterm and there is no contingent rent payableduringtheleaseterm.Atthecompletionofleaseterm,thecompanyhasoptiontoextendleaseforsimilarperiodbypayingleaserentdeterminedbylessoratthecompletionofleaseterm.Thecarrying value of the lease hold properties isseparatelydisclosedinthePlant,Propertyandequipmentsandinvestmentproperties.Asperthe leaseterms, thecompanycanuse leasedproperty for the purpose it has taken for andthere is no other restrictions imposed by thelessor.

BuildingtakenonleaseatKolkata,yearlyleaserentpaymentisRs.4.80persq.footperannumwhichistobeincreasedby10%oncompletionof every 10 years during the lease period.Thefutureminimumleasepaymentsandtheirpresentvaluesareasfollows:

207


^m.H$.{Z.

C.C.I.

As Lessee

(a) SelfOccupiedpropertyatKolkatashownunderNote2A–Plant,PropertyandEquipments

FinanceleaseobligationofthecompanyasofMarch31,2019isasfollows:

(Rs.Inlakh)

Particulars

Futureminimumlease

payments

Interest PresentValue

Notlaterthanone year 0.20 0.22 0.04

Laterthanoneyearbutnotlaterthanfiveyears

1.02 1.13 0.14

Laterthanfiveyear 19.31 16.33 0.36

Total 20.53 17.68 0.54

FinanceleaseobligationofthecompanyasofMarch31,2018isasfollows:

(Rs.Inlakh)

Particulars

Futureminimumlease

payments


Notlaterthanone year 0.19 0.22 0.04


1.02 1.12 0.16


Total 20.72 17.90 0.59

nÅ>oXma na

H$) H$mobH$mVm H$s ñd A{O©V g§n{Îm ZmoQ> 2 H$ ßbm§Q>, g§n{Îm

VWm CnH$aU Ho$ A§VJ©V Xem©`m J`m h¡ &

31 ‘mM©, 2019 Ho$ AZwgma H§$nZr H$m {dÎmr` brO Xm{`Ëd

{ZåZmZwgma h¡ :

(ê$. bmI ‘|)

{ddaUr^{dî` ‘|

Ý`yVZV‘ brO ^wJVmZ

ã`mO dV©‘mZ ‘yë`

EH$ df© Ho$ nümV

Zht 0.20 0.22 0.04

EH$ df© Ho$ nümV

na§Vw nm±M df© Ho$

nümV Zht 1.02 1.13 0.14

nm±M df© Ho$ nümV 19.31 16.33 0.36

Hw$b 20.53 17.68 0.54

31 ‘mM©, 2018 Ho$ AZwgma H§$nZr H$m {dÎmr` brO Xm{`Ëd

{ZåZmZwgma h¡ :

(ê$. bmI ‘|)

{ddaUr^{dî` ‘|

Ý`yVZV‘ brO ^wJVmZ

ã`mO dV©‘mZ ‘yë`

EH$ df© Ho$ nümV

Zht 0.19 0.22 0.04

EH$ df© Ho$ nümV

na§Vw nm°M df© Ho$

nümV Zht 1.02 1.12 0.16

nm±M df© Ho$ nümV 19.51 16.56 0.39

Hw$b 20.72 17.90 0.59

208

^m.H$.{Z.

C.C.I.


(b) Assets classifies as Investment Property atKolkataunderNoteno.3

FinanceleaseobligationofthecompanyasofMarch31,2019isasfollows:-

(Rs.Inlakh)

Particulars

Futureminimumlease

payments


Notlaterthanoneyear

0.17 0.18 0.03


0.83 0.92 0.12


Total 16.74 14.41 0.45

FinanceleaseobligationofthecompanyasofMarch31,2018isasfollows:-

(Rs.Inlakh)

Particulars

Futureminimumlease

payments


Notlaterthanoneyear

0.15 0.18 0.03

Laterthanone year butnotlaterthanfiveyears

0.83 0.92 0.13


Total 16.88 14.60 0.48

I) H$mobH$mVm H$s {Zdoe g§n{Îm H$s n[ag§n{Îm¶m| H$m dJuH$aU

ZmoQ> g§. 3 Ho$ A§VJ©V h¡ &

31 ‘mM©, 2019 Ho$ AZwgma H§$nZr H$m {dÎmr¶ brO Xm{¶Ëd

{ZåZmZwgma h¡ :-

(ê$. bmI ‘|)

ã¶m¡am

^{dî¶ ‘|

Ý¶yZV‘ brO

^wJVmZã¶mO

dV©‘mZ ‘yë¶

EH$ df© Ho$

nümV Zht 0.17 0.18 0.03

EH$ df© Ho$

nümV na§Vw nm±M

dfm] Ho$ nümV

Zht

0.83 0.92 0.12

nm±M dfm] Ho$

nümV15.74 13.31 0.30

Hw$b 16.74 14.41 0.45

31 ‘mM©, 2018 Ho$ AZwgma H§$nZr H$m {dÎmr¶ brO Xm{¶Ëd

{ZåZmZwgma h¡ :-

(ê$. bmI ‘|)

ã¶m¡am

^{dî¶ ‘|

Ý¶yZV‘ brO

^wJVmZã¶mO dV©‘mZ ‘yë¶

EH$ df© Ho$

nümV Zht 0.15 0.18 0.03

EH$ df© Ho$

nümV na§Vw

nm°§M dfm] Ho$

nümV Zht

0.83 0.92 0.13

nm±M dfm] Ho$

nümV15.90 13.50 0.32

Hw$b 16.88 14.60 0.48

209


^m.H$.{Z.

C.C.I.

I) n[aMmbZ brO

brO EH$ H$ama h¡ {Og‘| ^wJVmZ AWdm ^wJVmZ H$s

l¥I§bm Ho$ ñWmZ na nÅ>oXma H$mo gh‘{V Ad{Y Ho$ {bE

g§n{Îm H$m Cn`moJ H$aZo H$m A{YH$ma h¡ & Am°naoqQ>J brO

{dÎmr` brO Ho$ Abmdm h¡ & brO Q>‘© H$mo aÔ {H$E ~J¡a

H$s OmZo dmbr Ad{Y {Og‘| nÅ>oXma Zo n[ag§n{Îm H$s AÝ`

eVm] Ho$ gmW g§{dXm H$s h¡ {Og‘| nÅ>oXma H$s n[ag§n{Îm

H$mo AmJo ^wJVmZ Ho$ ~J¡a AWdm ^wJVmZ na brO na XoZo

H$m {dH$ën h¢ O~ nÅ>o Ho$ Ama§^ ‘| `h C{MV ê$n go

{Z{üV h¡ {H$ nÅ>o Ho$ {dH$ën H$m à`moJ hmoJm & AmJo aÔ

H$aZo `mo½`> brO dh brO h¡ Omo Ho$db aÔ H$s Om gH$Vr

h¡ &

- Hw$N> [a‘moQ> AmH$pñ‘Vm Ho$ KQ>Zo na

- nÅ>mXmVm H$s AZw‘{V go

- `m nÅ>oXma {X, Cgr nÅ>mXmVm dhr brO na AWdm CgHo$

g‘Vwë` n[ag§n{Îm boVm h¡ &

- nÅ>oXmar Ûmam Eogo {H$gr A{V[aº$ am{e Ho$ ^wJVmZ na

brO Ho$ àma§^ ‘|, nÅ>oXma H$s {Za§VaVm C{MV ê$n go

{Z{üV h¡ &

nÅ>o na

{ZJ‘ Zo AnZr Hw$N> B‘maVm|/^dZm|/JmoXm‘m| H$mo Zdr ‘w§~B©,

H$b§~mobr Am¡a B§Xm¡a ‘| nÅ>o na {X¶m J¶m h¡& brO a|Q> agrX|

ñQ>oQ>‘|Q> Am°’$ àm°{’$Q> Am¡a ZmoQ> Z§~a Ho$ VhV ZwH$gmZ Ho$ ê$n

‘| ‘mÝ¶Vm àmá h¢ & Am°naoqQ>J brO Ho$ VhV 23 Ý¶yZV‘ brO

a|Q> ê$. 877.37 bmI ({nN>bo df© 858.51 bmI ê$n¶o) brO

EJ«r‘|Q> Ho$ AZwgma brO Ad{Y Ho$ Xm¡amZ H$moB© AmH$pñ‘H$ {H$am¶m

àmá Zht h¡ & nÅ>o H$s eVm] Ho$ AZwgma nÅ>o na H$s JB© g§n{Îm H$m

Cn¶moJ Cg CÔoí¶ Ho$ {bE H$a gH$Vo h¢, {OgHo$ {bE H§$nZr Zo

H$moB© à{V~§Y Zht bJm¶m h¡ &

¶o brO Amdí¶H$Vm ‘ogg© qhXþñVmZ H$mo {X¶o J¶o H$m¶m©b¶ H$mo N>mo‹S>H$a nÅ>oXma / nÅ>oXma Ho$ {dH$ënm| na aÔ H$aZo ¶mo½¶ h¡ & ‘B© 2017 go 55 ‘hrZo H$s Ad{Y Ho$ {bE B§Xm¡a emIm ‘| qhXþñVmZ noQ´>mo{b¶‘ H$m°nm}aoeZ {b{‘Q>oS> H$mo {X¶m J¶m h¡&

b) OperatingLeases

A lease is an agreement whereby the lessorconveys to the lessee in return forapaymentorseriesofpaymentstherighttouseanassetforanagreedperiodoftime.Anoperatingleaseis a lease other than a finance lease.As perdefinition,theleasetermisthenon-cancellableperiod forwhich the lesseehas contracted toleasetheassettogetherwithanyfurthertermsforwhichthelesseehastheoptiontocontinueto lease the asset, with or without furtherpayment,whenattheinceptionoftheleaseitisreasonablycertain that the leasewillexercisetheoption.Further,anon-cancellableleaseisaleasethatiscancellableonly:

- Upon the occurrence of some remotecontingency;

- Withthepermissionofthelessor;

- If the lessee enters into a new lease for thesame or an equivalent asset with the samelessor;or

- Upon payment by the lessee of such anadditionalamountthat,atinceptionofthelease,continuationofthelesseeisreasonablycertain.

As a Lessor

The Corporation has given some portion of itsbuildings/godowns situated at Navi Mumbai,Kalamboli and Indore on lease. The lease rentreceiptsare recognized in theStatementofProfit&Loss under the Note no. 23. Minimum lease rentsunderoperatingleaseareRs.877.37lakh(previousyearRs.858.51lakh).Asperleaseagreementsthereare no contingent rent receivable during the leaseterm.Aspertheleaseterms,theleasecanuseleasedpropertyforthepurposeithastakenforandthereisnootherrestrictionsimposedbythecompany.

These lease arrangements are cancelable at theoptionsof lessor/lesseeexceptofficepremisegiventoM/s Hindustan PetroleumCorporation Limited atIndorebranchforperiodof55monthsfromMay2017.

210

^m.H$.{Z.

C.C.I.


Detailsoffutureminimumleasepaymentsundernon-cancellableoperatingleaseareasunder:

(Rs.inlakh)

Particulars Asat31st March2019

Asat31st March2018

Notlaterthanoneyear 25.17 23.86


44.88 70.04

Laterthanfiveyear 0.00 0.00

TotalFutureMinimumLeasePayment

70.05 93.90

As a Lessee

Thecompanyhastakentheofficepremisesonleaseatvarious locations for3 to5years.The leaserentpaymentsarerecognizedintheStatementofProfit&LossundertheNoteno.28(c).MinimumleaserentsrecognizedunderoperatingleaseareRs.97.39lakh(previousyearRs.89.72lakh).

Asperleaseagreementstherearenocontingentrentpayableduringtheleaseterm.Aspertheleaseterms,thecompanycanuseleasedpropertyforthepurposeit has taken for and there is no other restrictionsimposedbythelessor.Theseleasearrangementsarecancelableattheoptionsoflessor/lesseeexceptofficepremisetakenonleaseatCoimbatore(Tamilnadu)forperiod of 3 year (from 15th September 2017 to 14th

September2020).

J¡a aÔ H$aZo `mo½` Ho$ A§VJ©V ^mdr Ý`yZV‘ brO ^wJVmZ Ho$ {ddaU {ZåZmZwgma h¢ :

(ê$n`o bmI ‘|)

{ddaUr 31 ‘mM©,

2019 VH$

31 ‘mM©,

2018 VH$

EH$ df© Ho$ nümV Zht 25.17 23.86

EH$ df© Ho$ nümV na§Vw

nm°§M dfm] Ho$ nümV Zht 44.88 70.04

nm±M dfm] Ho$ nümV 0.00 0.00

Hw$b ^mdr Ý`yZV‘ brO

^wJVmZ 70.05 93.90

EH$ nÅ>oXma Ho$ ê$n ‘|

H§$nZr Zo 3 go 5 dfm} Ho$ {bE {d{^Þ ñWmZm| na H$m¶m©b¶ H$mo

brO na bo {b¶m h¡ & brO a|Q> no‘|Q> H$mo ñQ>oQ>‘|Q> Am°’$ àm{’$Q>

E§S> bm°g Ho$ ZmoQ> g§»¶m 28 gr Ho$ VhV ‘mÝ¶Vm àmá h¡ & ZmoQ>

Z§. 28 gr Am°naoqQ>J brO Ho$ VhV ‘mÝ¶Vm àmá brO a|Q> ê$.

97.39 bmI ({nN>bo df© 89.72 bmI ê$n¶o)

brO EJ«r‘|Q> Ho$ AZwgma brO Ad{Y Ho$ Xm¡amZ Xo¶ H$moB© {H$am¶o

na boZ H$s ì¶dñWm Zht h¡ & brO eVm] Ho$ AZwgma, H§$nZr

brO H$s JB© g§n{Îm H$m Cn¶moJ Cg CÔoí¶ Ho$ {bE H$a gH$Vr

h¡, {OgHo$ {bE CgZo {b¶m h¡ Am¡a nÅ>oXma H$moB© [apñQ´>ŠeZ Zht

bJm¶m J¶m h¡ & ¶o nÅ>m ì¶dñWm nÅ>oXma / nÅ>oXma Ho$ {dH$ënm|

na aÔ H$s OmVr h¡ & Ho$db 3 df© H$s Ad{Y Ho$ {bE H$mo¶§~Îmya

(V{‘bZmSy>) ‘| brO na {b¶m J¶m h¡ (15 {gV§~a, 2017 go

14 {gV§~a 2020 VH$)

211


^m.H$.{Z.

C.C.I.

Am°naoQ>a brO H$s Ad{Y EH$ df© go H$‘ h¡ AV: J¡a aÔ H$aZo `mo½` Am°naoqQ>J brO Ho$ A§VJ©V ^mdr Ý`yZV‘ brO ^wJVmZ brO ^wJVmZ H$s Amdí`H$Vm Zht h¡ &

51. {dÎmr` [anmo{Q>ªJ Am¡a CgH$s n`m©á na Am§V[aH$ {dÎmr`

{Z`§ÌU àUmbr (AmBE’$grAmoAma) :

à~§YZ H$s am` h¡ {H$ {dÎmr` [anmoQ>© na H§$nZr H$s

Am§V[aH$ {dÎmr` {Z`§ÌU nÕ{V n`m©á h¡, Omo à~§YH$

Ûmam n[aMmbZ Ho$ AmH$ma, ñH$sb d O{Q>bVm Ho$

AZwê$n h¡ &

AnZr g^r emImAm| na {Z`{‘V ê$n go Am°naoqQ>J

{gñQ>‘, boIm H$m`©{d{Y VWm Zr{V`m| Ho$ gmW Am§V[aH$

{Z`§ÌU Ho$ ñWmnZ, {Z`§ÌU VWm à^mdembr ê$n

Operating leasewhere lease term is less than oneyear, future minimum lease payments under non-cancellableoperatingleasearenotrequired.

51 Internal Financial Control System over Financial reporting and their adequacy (IFCOR):

In the opinion of theManagement, Companyhas an adequate internal financial controlsystem over financial reporting, which isconsidered commensurate with the size,scale and complexity of its operations by theManagement.

Theessential componentsof internal controlsas stated in the Guidance Note on Audit ofInternal Financial Controls Over FinancialReporting issuedby the InstituteofCharteredAccountantsofIndiahasbeenconsideredbythe

emImAm| Ho$ J¡a aÔ H$aZo ¶mo½¶ Ho$ A§VJ©V ^mdr Ý¶yZV‘ brO ^wJVmZ Ho$ {ddaU {ZåZmZwgma h¢ &Detailsoffutureminimumleasepaymentsundernon-cancellableoperatingleaseofbranchesareasunder:

(ê$n`o bmI ‘|) /(Rs.inlakh)

{ddaUrParticulars

H$mo`§~ÎmyaCoimbatore

^rbdm‹S>mBhilwara

31 ‘mM©, 2019 VH$ As at

31stMarch2019

31 ‘mM©, 2018 VH$ As at

31stMarch2018

31 ‘mM©, 2019 VH$ As at

31st March2019

31 ‘mM©, 2018 VH$As at

31stMarch2018

EH$ df© Ho$ nümV

Zht Notlaterthanoneyear

5.54 5.54 0.00 8.78

EH$ df© Ho$ nümV na§Vw

nm±M dfm] Ho$ nümV

Zht Laterthanoneyearbutnotlaterthanfiveyears

2.55 8.05 0.00 0.00

nm±M dfm] Ho$ nümV Laterthanfiveyear

0.00 0.00 0.00 0.00

Hw$b ^mdr Ý`yZV‘ brO

^wJVmZ TotalFutureMinimumLeasePayment

8.09 13.59 0.00 8.78

212

^m.H$.{Z.

C.C.I.


go ‘yë`m§H$Z H$aZo Ho$ {bE ^maV Ho$ gZXr boInmb

BÝñQ>rQ>çyQ> Ûmam Omar {dÎmr` [anmoQ>© na Am§V[aH$ {Z`§ÌU

H$mo A{Zdm`© KQ>H$ ‘mZm h¡ & H§$nZr A{Y{Z`‘ 2013

Ho$ VhV Amdí`H$Vm H§$nZr H$s Zr{V`m| Ho$ nmbZ,

n[ag§n{Îm`m| H$mo N>b H$nQ> H$mo ImoOZo d amoH$Zo, boIm

[aH$m°S©>g H$s Wm©WVm d nyU© H$aZo VWm {dœgZr` {dÎmr¶

gyMZm H$mo g‘` na V¡`ma H$aZo H$mo em{‘b H$aVo hþE

ì`mnma H$mo ì`dpñWV H$aZo VWm Hw$ebVmnyd©H$ AmMaU

gw{Z{üV H$aZo Ho$ {bE Bg‘| {S>OmBZ, H$m`m©Ýd`rZ VWm

n`m©á Am§V[aH$ {dÎmr` {Z`§ÌU H$m aIaImd em{‘b h¡&

{ZJ‘ ‘| à~§YZ Zo AnZr Amoa go {dÎmr` [anmoQ>© na

Am§V[aH$ {dÎmr` {Z`§ÌU H$mo narjU H$aZo d ‘mÝ` H$aZo

Ho$ {bE gZXr boInmb H$s ’$‘© H$mo {Z`wº$ {H$`m h¡ &

VX²Zwgma CÝhm|Zoo narjU {H$`m VWm CZH$s am` ‘| {ZJ‘

Am§V[aH$ {dÎmr` {Z`§ÌU H$m H$m`m©Ýd¶rZ {ZJ‘ Ho$ ì`mnma

Ho$ AmH$ma Ho$ AZwê$n d n`m©á h¡ &

52. à{Veo`a AO©Z H$s JUZm

{ddaUr31.03.2019

VH$

31.03.2018

VH$

H$) {d{Z`moOZ Ho$

{bE CncãY bm^

(bmI ê$n`o ‘|) 5099.36 417.48

I) B©{¹$Q>r eo`g© H$s

doQ>oO Am¡gV g§»`m 25,00,000 25,00,000

J) à{V B©{¹$Q>r eo`g©

Zm‘‘mÌ ‘yë` 100.00 100.00

K) ‘yb Am¡a VZwH¥$V

Am`/(hm{Z) à{V

eo`g© (ê$.)(H$/I)203.97 16.70

ManagementoftheCompanyforestablishing,monitoringandtoevaluatetheefficacyofinternalcontrol system in the Company regularly, itscompliancewithoperatingsystems,accountingprocedures and policies at all branches /locations of the Company. These include thedesign, implementation and maintenanceof adequate internal financial controls thatwere operating effectively for ensuring theorderly and efficient conduct of its business,includingadherencetoCompany’spolicies,thesafeguardingof itsassets, thepreventionanddetectionoffraudsanderrors,theaccuracyandcompleteness of the accounting records, andfor the timely preparation of reliable financialinformation,asrequiredundertheCompaniesAct, 2013.ThemanagementhasappointedaCharteredAccountantfirmtotestandvalidateinternal financial control implemented in theCorporation.Accordingly,theyhavecarriedoutthecompliance testingand is inview that theInternal financial control implemented in theCorporation is adequate and commensuratewithsizeofbusinessoftheCorporation.

52 Calculation of Earnings per Share

Particulars Asat31st March2019

Asat31stMarch2018

A)ProfitAvailableforAppropriation (Rs.inLakh)

5099.36 417.48

B)WeightedAverageNo.ofEquityShares(No’s)

25,00,000 25,00,000

C)NominalValuePerEquityShare(inRs.)

100.00 100.00

D)BasicandDilutedEarningspershare(inRs.)(A/B)

203.97 16.70

213


^m.H$.{Z.

C.C.I.

53 Financial Instruments

A. Fair Value

The carrying value and fair value of financialinstrumentsbycategoriesasofMarch31,2019areasfollows:

(ê$n`o bmI ‘|)/(Rs.Inlakh)

ã¶m¡aoParticulars

nrE§S>Eb Ho$

‘mÜ`‘ go C{MV

‘yë¶ FairvaluethroughP&L

AmogrAmB© Ho$

‘mÜ`‘ go

C{MV ‘yë¶FairvaluethroughOCI

bmJV naAtcost

A‘yV© bmJVAmortized

cost

Hw$b H¡$[a¨J Am¡a

C{MV ‘yë`Totalcarryingand

Fairvalue

{dÎmr` n[ag§n{Îm`m± /FinancialAssets

J¡a-Mmby / Non-Current

{Zdoe / Investment 0.01 0.01

ã`mO / Loan 227.47 227.47

AÝ` {dÎmr` n[ag§n{Îm`m± OtherFinancialAssets

177.75 177.75

Mmby / Current

ì`mnma àmß` / Tradereceivables 6895.32 6895.32

ZH$X Am¡a ZH$X g‘Vwë`Cashandcashequivalents

313.23 313.23

ã`mO / Loans 79.30 79.30


256320.99 256320.99

Hw$b / Total 264014.07 264014.07

{dÎmr` XoZXm[a`m±/FinancialLiabilities


AÝ¶ {dÎmr¶ n[ag§{Îm¶m±OtherFinancialLiabilities

1208.99 1208.99

Mmby / Current

CYma / Borrowings 474459.59 474459.59

àmß` ì`mnma / Tradepayables:

- E‘EgE‘B© / -MSME 1872.74 1872.74

- E‘EgE‘B© Ho$ Abmdm -OtherthanMSME

4222.77 4222.77

AÝ` {dÎmr` XoZXm[a`m± OtherFinancialLiabilities

4802.66 4802.66

Hw$b / Total 486566.75 486566.75

53 {dÎmr` CnH$aU

H$. C{MV ‘yë`

31 ‘mM©, 2019 VH$ lo{U¶m| Ho$ AZwgma {dÎmr¶ gmYZm|

H$m ‘yë¶ Am¡a C{MV ‘yë¶ {ZåZmZwgma h¡

214

^m.H$.{Z.

C.C.I.


ZmoQ>-

1 ì¶mnma àmß¶ ‘w»¶ ê$n go ZoeZb Q>oŠgQ>mB©b H$m°nm}aoeZ

(EZQ>rgr) go hmoVm h¡ &

2 ‘w»¶ à~§YZ ì¶{º$JV Am¡a AÝ¶ H$‘©Mm[a¶m| H$mo {XE JE

gwa{jV F$U Am¡a A{J«‘ ~mOma Xa na h¢, Bg{bE Eogo

F$U Am¡a gbmhH$ma H$s dhZ am{e CZHo$ C{MV ‘yë¶ Ho$

~am~a h¡ & AÝ¶ H$‘©Mm[a¶m| H$mo Agwa{jV F$U {nN>bo

OrEEnr ‘yë¶ na Omar aIm OmZm Mm{hE Š¶m|{H$ ‘mn

à^md An[ahm¶© h¢ &

3 F$U Am¡a ã¶mO H$s AXm¶Jr ‘| MyH$ H$m H$moB© B{Vhmg Zht

h¡, Bg{bE, Ano{jV H«o${S>Q> hm{Z H$mo ‘mÝ¶Vm Zht Xr JB©

h¡ &

4 ì¶mnma àmß¶ Am¡a Ý¶yZVZ g‘W©Z ‘yë¶ àmß¶ hm{Z go

ZH$Xr àdmh H$mo gmH$ma H$aZo ‘| H$moB© ‘Q>o[a¶b Zht h¡

gaH$ma go Ano{jV F$U hm{Z H$mo ‘mÝ¶Vm Zht {‘br h¡ &

Note–

1. Trade Receivable mainly comprises the duefromNationalTextilesCorporation(NTC).

2. Secured loans and advances given to keymanagement personnel and other employeesareatmarketrate,thereforethecarryingamountofsuchloansandadvancesareequaltotheirfairvalue.UnsecuredloanstootheremployeescontinuetobecarriedatpreviousGAAPvalueasmeasurementimpactisimmaterial.

3. There isnohistoryofdefault in repaymentofloanand interest thereupon,hence,expectedcreditlossisnotrecognized.

4. There is no material default in realizing thecashflowfromtheTradereceivableandMSPlossesreceivablesfromGovt.ofIndia,hence,expectedcreditlossisnotrecognized.

31 ‘mM©, 2018 VH$ lo{U¶m| Ho$ AZwgma {dÎmr¶ gmYZm| H$m ‘yë¶ Am¡a H¡$[a¨J ‘yë¶ {ZåZmZwgma h¡ :

ThecarryingvalueoffinancialinstrumentsbycategoriesasofMarch31,2018isasfollows:(ê$n`o bmI ‘|)/(Rs.Inlakh)


nrE§S>Eb Ho$ ‘mÜ`‘ go C{MV


AmogrAmB© Ho$ ‘mÜ`‘ go C{MV

‘yë¶FairvaluethroughOCI

bmJV naAtcost


cost

Hw$b H¡$[a¨J Am¡a C{MV ‘yë`

TotalcarryingandFairvalue

{dÎmr` n[ag§n{Îm`m± / FinancialAssets

J¡a-Mmby / Non-Current {Zdoe / Investment 0.01 0.01ã`mO / Loan 276.47 276.47AÝ` {dÎmr` n[ag§n{Îm`m± OtherFinancialAssets

171.32 171.32

Mmby / Current ì`mnma àmß` / Tradereceivables 6104.86 6104.86ZH$X Am¡a ZH$X g‘Vwë` Cashandcashequivalents

1405.00 1405.00

ã`mO / Loan 94.65 94.65

215


^m.H$.{Z.

C.C.I.

AÝ` {dÎmr` n[ag§n{Îm`m±OtherFinancialAssets

314962.94 314962.94

Hw$b / Total 323015.24 323015.25{dÎmr` XoZXm[a`m± / FinancialLiabilities



770.40 770.40

Mmby / Current CYma / Borrowings 444200.00 444200.00àmß` ì`mnma / Tradepayables:

- E‘EgE‘B© / -MSME 64.93 64.93

- E‘EgE‘B© Ho$ Abmdm -OtherthanMSME

4834.45 4834.45


6973.79 6973.79

Hw$b / Total 456843.57 456843.57

1 Aà¡b, 2017 VH$ lo{U¶m| Ho$ AZwgma {dÎmr¶ gmYZm| H$m ‘yë¶ Am¡a H¡$[a¨J ‘yë¶ {ZåZmZwgma h¡ & ThecarryingvalueoffinancialinstrumentsbycategoriesasofApril1,2017isasfollows:

(ê$n`o bmI ‘|) / (Rs.Inlakh)


nrE§S>Eb Ho$ ‘mÜ`‘ go C{MV


AmogrAmB© Ho$ ‘mÜ`‘ go C{MV

‘yë¶FairvaluethroughOCI

bmJV naAtcost


cost

Hw$b H¡$[a¨J Am¡a C{MV ‘yë`

TotalcarryingandFairvalue

{dÎmr` n[ag§n{Îm`m± / FinancialAssets


{Zdoe / Investment 0.01 0.01

ã`mO / Loan 306.02 306.02


174.25 174.25

Mmby / Current

ì`mnma àmß` / Tradereceivables 3279.24 3279.24

ZH$X Am¡a ZH$X g‘Vwë` Cashandcashequivalents

459.44 459.44

ã`mO / Loan 105.25 105.25


295894.99 295894.99

Hw$b / Total 300219.19 300219.20

{dÎmr` XoZXm[a`m± / FinancialLiabilities

216

^m.H$.{Z.

C.C.I.


C{MV ‘yë` AZwH«$‘

bodb 1: nXmZwH«$‘ ‘| CÕV ‘yë¶ H$m Cn¶moJ H$aHo$ ‘mnm J¶m {dÎmr¶ gmYZ em{‘b h¡ & Bg‘| gyMr~Õ B{¹$Q>r CnH$aU Am¡a å¶wMwAb ’§$S> em{‘b h¡, {OÝhm|Zo ‘yë¶ CÕV {H$¶m h¡ & g^r B{¹$Q>r gmYZm| H$m C{MV ‘yë¶ Omo ñQ>m°H$ EŠgM|O ‘| H$m‘ {H$¶m OmVm h¡ & [anm{Q>ªJ Ad{Y ‘| g‘mnZ ‘yë¶ H$m Cn¶moJ H$aHo$ å¶yMwAb ’§$S> Ho$ ŠbmoqOJ ‘yë¶ H$m Cn¶moJ H$aHo$ d¡ë¶y {H$¶m OmVm h¡ Am¡a {bñQ>oS> ñQ>m°H$ EŠgM|O ‘| {bñQ>oS> ‘yë¶ na B{¹$Q>r eo¶a H$mo Ah{‘¶V Xr OmVr h¡ &

bodb 2: {dÎmr¶ gmYZ H$m C{MV ‘yë¶ Omo {H$ EH$ g{H«$¶ ~mOma ‘| H$mamo~ma ‘§Xr {H$¶m OmVm h¡ (CXmhaU Ho$ {bE Q´>oS>g, ~m±S>, Amoda X H$mC§Q>a S>oardo{Q>d) H$m {ZYm©aU ‘yë¶m§H$Z VH$ZrH$ H$m Cn¶moJ H$aHo$ {H$¶m OmVm h¡ Omo {H$ AdbmoH$Z ¶mo½¶ ~mOma S>oQ>m H$m A{YH$V‘ Cn¶moJ H$aVo h¢ AmJo BH$mB© {d{eï> na ¶Wmg§^d H$‘ AZw‘mZ ^amogm H$aVo h¢ & ¶{X g^r ‘hÎdnyU© AmXmZm| Ho$ {bE C{MV ‘yë¶ Ho$ {bE Amdí¶H$ EH$ gmYZ AdbmoH$Zr¶ h¡, Vmo gmYZ bodb - 2 ‘| em{‘b h¡ &

bodb 3: ¶{X EH$ ¶m A{YH$ {dbjU BZnwQ> AdbmoH$Zr¶ ~mOma

S>oQ>m na AmYm[aV Zht h¡, Vmo B§ñQ´y>‘|Q> bodb 3 ‘| em{‘b h¡& ¶h

J¡a-gyMr~Õ B{¹$Q>r à{V^y{V¶m|, {dMma Am¡a j{Vny{V© g§n{Îm Ho$

{bE bodb 3 ‘| em{‘b h¢ &

H§$nZr H$s Zr{V [anmo{Q>ªJ Ad{Y Ho$ A§V ‘| C{MV ‘yë¶ nXmZwH«$‘

ñVa go ~mha ñWmZm§VaU H$mo ñWmZm§V[aV H$aZm h¡ &



933.19 933.19

Mmby / Current CYma / Borrowings 278500.00 278500.00

àmß` ì`mnma / Tradepayables:

- E‘EgE‘B© / -MSME 2.73 2.73

- E‘EgE‘B© Ho$ Abmdm-OtherthanMSME

394.49 394.49


2912.95 2912.95

Hw$b / Total 282743.36 282743.36

Fair Value Hierarchy

Level 1: hierarchy includes financial instrumentsmeasured using quoted prices. This includes listedequityinstrumentsandmutualfundsthathavequotedprice.The fair valueof all equity instrumentswhicharetradedinthestockexchangesisvaluedusingtheclosingpriceasat the reportingperiod.Themutualfunds are valued using the closing NAV and listedequity instruments are being valued at the closingpricesonrecognizedstockexchange.

Level2:Thefairvalueoffinancialinstrumentsthatarenot traded inanactivemarket (for example, tradedbonds, over-the counter derivatives) is determinedusingvaluationtechniqueswhichmaximizetheuseofobservablemarketdataandrelyaslittleaspossibleon entity-specific estimates. If all significant inputsrequired to fair valuean instrumentareobservable,theinstrumentisincludedinlevel2.

Level3:Ifoneormoreofthesignificantinputsisnotbased on observable market data, the instrumentis included in level 3. This is the case for unlistedequity securities, contingent consideration andindemnificationassetincludedinlevel3.

TheCompany’spolicy is to recognize transfers intoandtransfersoutof fairvaluehierarchy levelsasattheendofthereportingperiod.

217


^m.H$.{Z.

C.C.I.

B. Maturitiesoffinancialliabilities

The tables below analyze the company’s financialliabilities into relevant maturity groupings based ontheircontractualmaturities:-

31 ‘mM©, 2019 VH$ {dÎmr¶ Xo¶VmAm| H$s g§{dXmË‘H$ n[an¹$VmContractualmaturitiesoffinancialliabilitiesasatMarch31,2019

(ê$n`o bmI ‘|)/(Rs.Inlakh)


Hw$b bm`m J`m ‘yë`TotalCarrying

Value

EH$ df© Ho$ ^rVa Ondue within1

year

1 df© go A{YH$ 3 df© VH$

Over1yearWithin3years

3 df© go A{YH$ Over3year

J¡a-Mmby AÝ` {dÎmr` Xo`VmE°§ Non-CurrentOtherFinancialLiabilities

1208.99 0.00 0.00 1208.99

CYma / Borrowings 474459.59 474459.59 0.00 0.00

àmß` ì¶mnma / TradePayables

- E‘EgE‘B© / -MSME 1872.74 1872.74 0.00 0.00

- AÝ` / -Others 4222.77 4222.77 0.00 0.00

Mmby-AÝ` {dÎmr` Xo`VmE°§ Current-OtherFinancialLiabilities

4802.66 4802.66 0.00 0.00

Hw$b / Total 486566.75 485357.76 0.00 1208.99

31 ‘mM©, 2018 VH$ {dÎmr` Xo`VmAm| H$s g§{dXmË‘H$ n[an¹$VmContractualmaturitiesoffinancialliabilitiesasatMarch31,2018




Value

EH$ df© Ho$ ^rVa Ondue within

1year

1 df© go A{YH$

3 df© VH$ Over1yearWithin3years


J¡a-Mmby AÝ` {dÎmr` Xo`VmE°§ Non-CurrentOtherFinancialLiabilities

770.40 0.00 0.00 770.40

CYma / Borrowings 444200.00 444200.00 0.00 0.00


- E‘EgE‘B© / -MSME 64.93 64.93 0.00 0.00

- AÝ` / -Others 4834.45 4834.45 0.00 0.00

Mmby-AÝ` {dÎmr` Xo`VmE°§ Current-OtherFinancialLiabilities

6973.79 6973.79 0.00 0.00

Hw$b / Total 456843.57 456073.17 0.00 770.40

I. {dÎmr` Xo`VmAm| H$s n[an¹$VmE°§

ZrMo Xr JB© Vm{bH$mAm| ‘| {dÎmr¶ XoZXm[a¶m| H$m {dûcofU CZH$s

g§{dXmË‘H$ n[an¹$Vm g‘yhm| H$s nwZamd¥{Îm ‘| {H$¶m J¶m h¡ &

218

^m.H$.{Z.

C.C.I.


01 Aà¡b, 2017 VH$ {dÎmr` Xo`VmAm| H$s g§{dXmË‘H$ n[an¹$VmContractualmaturitiesoffinancialliabilitiesasatApril1,2017




Value

EH$ df© Ho$ ^rVa Ondue within

1year

1 df© go A{YH$

3 df© VH$ Over1yearWithin3years


J¡a Mmby AÝ` {dÎmr` Xo`VmE°§ Non-CurrentOtherFinancialLiabilities

933.19 0.00 0.00 933.19

CYma / Borrowings 278500.00 278500.00 0.00 0.00


- E‘EgE‘B© / -MSME 2.73 2.73 0.00 0.00

- AÝ` / -Others 394.49 394.49 0.00 0.00

Mmby AÝ` {dÎmr` Xo`VmE°§ Current-OtherFinancialLiabilities

2912.95 2912.95 0.00 0.00

Hw$b / Total 282743.36 281810.17 0.00 933.19

ZmoQ> : J¡a-Mmby {dÎmr` Xo¶VmAm| ‘| {H$am¶oXmam| Am¡a {dH«o$VmAm| go àmá gwajm O‘m em{‘b h¡ & Note:Non-Currentfinancialliabilitiescomprisesecuritydepositreceivedfromtenantsandvenders.

54 Financialriskmanagement

TheCompanyhasadopted‘RiskManagementPlan’which is duly approvedby theBoard ofDirectorsintheirmeetingheldon23rdFebruary2018andthesameisunderimplementation.

Financialriskfactors

The company's activities expose it to a variety offinancial risks: credit risk, financial reporting risk,liquidityriskandforeignexchangerisk.Thecompany'sprimaryfocusistoforeseetheunpredictabilityintradeandseektominimizepotentialadverseeffectsonitsfinancialperformance.

a) CreditRisk

Credit risk refers to the risk of default on itsobligationbythebuyersresultinginafinancialloss.Riskmitigationmeasures:Salescontractterms tocover risksofbackingout, tohandlecomplaints and loss on resale.Systemput in

54. {dÎmr` OmopI‘ à~§YZ

{dÎmr` OmopI‘ à~§YZ H§$nZr Zo "OmopI‘ à~§YZ `moOZm'

H$mo AnZm`m h¡ Omo {ZXoeH$ ‘§S>b H$s {XZm§H$ 23 ’$adar,

2018 H$mo Am`mo{OV ~¡R>H$ ‘| {d{YdV AZw‘mo{XV h¡ Omo

H$m`m©Ýd`rZ AYrZ h¡ &

{d{Îm` OmopI‘ H$maH$

H§$nZr H$s J{V{d{Y`m| ‘| {ZåZ{bpIV ê$n go {d{^Þ {dÎmr` OmopI‘ à{Vnm{XV {H$E OmVo h¢ O¡go H«o${S>Q> OmopI‘, {dÎmr` [anmo{Qª>J OmopI‘, VabVm OmopI‘ VWm {dXoer ‘wÐm OmopI‘ & H§$nZr H$m àmW{‘H$ Ü`mZ ì`mnma ‘| AàË`mH${eVVm XoIZm VWm AnZo {dÎmr` H$m`©{ZînmXZ na g§^m{dV à{VHy$b à^mdm| H$mo H$‘

H$aZm h¡ &

H$) H«o${S>Q> OmopI‘

H«o${S>Q> OmopI‘ IarXXmam| Ûmam AnZo Xm{`Ëd na {S>’$m°ëQ> Ho$ OmopI‘ H$mo g§X{^©V H$aVm h¡ {OgHo$ n[aUm‘ñdê$n {dÎmr` hm{Z CR>mZr n‹S>r & OmopI‘ e‘Z Cnm`: {~H«$s g§{dXm H$s eVm] ‘| g§{dXm aÔ H$aZo Ho$ OmopI‘ H$mo H$da

219


^m.H$.{Z.

C.C.I.

H$aZm, {eH$m`Vm| na Ü`mZ XoZm Vm{H$ nwZ: {~H«$s go hm{Z Z hmo & {nN>bo boZXoZ d CZH$s à{V~§{YV loUr Ho$ AmYma na IarXXmam| H$s H«o${S>Q> `mo½`Vm Ho$ {ZYm©aU Ho$ {bE nÕ{V ñWm{nV H$s JB© h¡ & C{MV dgybr H$m à~§YZ, Ohm± VH$ g§^d hmo gm¡hmX©nyU© H$ma©dmB© H$s OmVr h¡ & H§$nZr Ho$ nmg H$B© à~§YZ gyMZm nÕ{V`m± h¢ {Oggo H§$nZr Ûmam C{MV g‘` na C{MV {ZU©` {b`m Om gH$Vm h¡ &

I) {dÎmr` [anm{Q>ªJ OmopI‘

{dÎmr` [anm{Q>ªJ OmopI‘ dh OmopI‘ h¡ (i) {Og‘| So>Q>m {ZH$mbZo Ho$ {bE {Oå‘oXma H$B© ì`{º$, S>mQ>m EH${ÌV H$aZo, Am¡a {dûcofU H$aZo Ho$ {bE {Oå‘oXma h¡ & (ii) {OgHo$ Ûmam à{H«$`m d Q>mB©‘ bmB©Z Ho$ Ûmam `h Am±H$‹S>o àmá {H$`o OmVo h¢ VWm [anmoQ>© H$s OmVr h¡ & (iii) dh nÕ{V {OgHo$ Ûmam `h {dÎmr` OmZH$mar gmW©H$ ~Zm`r OmVr h¡ & boIm, {ZJ{‘V emgZ VWm npãbH$ àH$Q>Z go g§~§{YV H$mZyZm| {d{Z`‘m| d ‘mZH$m| ‘| n[adV©Z BË`m{X go {ZJ‘ Ho$ {bE A{Z{üVVm CËnÞ H$aVr h¡ & H§$nZr {ZJ{‘V emgZ d npãbH$ àH$Q>Z Ho$ Cƒ ‘mZH$m| H$m aIaImd VWm {dH${gV H$mZyZ, {d{Z`‘ VWm ‘mZH$m| H$m

AZwnmbZ H$aVr h¡ &

J) VabVm OmopI‘

Bg‘| ZH$X à~§YZ OmopI‘ em{‘b h¡, OmopI‘ e‘Z

Cnm`: g§JR>Z Ho$ ~rM C{MV ñVa na MMm© H$s JB© {dñV¥V

dm{f©H$ ì`mnma `moOZm g{hV C{MV {dÎmr` `moOZm nÕ{V

h¡ & YmaUmAm|, n¡am‘rQ>g© BË`m{X H$s àH¥${V Am¡a JwUdÎmm

Ho$ {dûcofU H$s dm{f©H$ d {V‘mhr ~OQ> V¡`ma H$s OmVr

h¢ VWm {dñV¥V MMm© Ho$ {bE à~§YZ H$mo àñVwV H$s OmVr

h¢& Ag§JV {dûcofU Ho$ gmW BZ ~OQ>m| H$mo ~ohVa {dÎmr`

`moOZm VWm {dg§J{V`m| H$s d¥{Õ ‘| H$maH$mo Ho$ AÜ``Z

{bE V¡`ma {H$`m OmVm h¡ & X¡{ZH$ VWm ‘m{gH$ ZH$X

àdmh V¡`ma {H$E OmVo h¢ VWm BZH$m d[að> ñVa na

{Z`§ÌU {H$`m OmVm h¢ Vm{H$ {Z{Y H$s Amdí`H$Vm H$mo

g‘Pm OmE Ed§ à^mdembr VarHo$ go {Z{Y H$s Cn`mo{JVm

gw{Z{üV H$s Om gHo$ & Hw$eb g§J«h VWm {Z{Y`m| H$s

Cn`mo{JVm gw{Z{üV H$aZo Ho$ {bE ~¢H$mo Ho$ g§H$m` go ZH$X

godmE°§ àmá H$s OmVr h¡ &

place for assessment of credit worthiness ofbuyersonthebasisofpastdealingsandtheirrestricted and banned category. Appropriaterecoverymanagement,followupandamicablesettlement wherever possible. The Companyhas inplacevariousManagement Informationsystem, which enables management to takeproperdecision,intime.

b) FinancialReportingRisk

Financialreportingrisksreferstotheriskdueto(i)Avarietyofpeopleresponsibleforextracting,assembling, aggregating, and analyzing data;(ii) the processes and timelines bywhich thisdataisobtainedandreport;(iii)thesystemsthatmakesfinancialinformationandprocessitintomeaningful form. Changing laws, regulationsandstandardsrelatingtoaccounting,corporategovernanceandpublicdisclosure,etc.createsuncertaintyfor theCorporation.TheCompanyiscommitted tomaintaininghighstandardsofcorporate governance and public disclosureand to complywith evolving laws, regulationsandstandards.

c) LiquidityRisk

This includes cash management risk. Riskmitigationmeasures:properfinancialplanningisinplacewithdetailedannualbusinessplansdiscussed at appropriate levels within theorganization. Annual and quarterly budgetsare prepared and put up to management fordetaileddiscussionananalysisofthenatureand quality of the assumption, parametersetc.Thesebudgetswithvarianceanalysisarepreparedtohavebetterfinancialplanningandstudyof factorsgiving rise tovariances.Dailyand monthly cash flows are prepared andmonitored at senior levels to access the fundrequirements and ensure utilization of fundsin an effective manner. Cash managementservicesareavailedfromconsortiumofbanksto ensure efficient collection and utilization offunds.

220

^m.H$.{Z.

C.C.I.


K) {dXoer ‘wÐm OmopI‘

ê$B© Jm±R>m| H$s AÝ` Xoem| ‘| {Z`m©V H$s pñW{V Ho$ ‘m‘bo ‘|,

^maVr` ‘wÐm H$s VwbZm ‘| {dXoer ‘wÐm {d{Z‘` ‘| à{VHy$b

ApñWaVm Ho$ H$maU OmopI‘ h¡ & OmopI‘ e‘Z Cnm`:

O~ H$^r ^r H$nmg Jm±R>m| Ho$ {Z`m©V H$s Amdí`H$Vm

hmoVr h¡ & A{YH$ ^{dî`dmUr Am¡a pñWaVm àmßV H$aZo

Ho$ OmopI‘ H$mo hoqOJ H$aZo Ûmam A{Z{üVmAm| VWm {dXoer

‘wÐm H$s ApñWaVm Ho$ à~§Y Ûmam {ZJ‘ ES>dg© H$a§gr

‘yd‘|Q>g go CËnÞ OmopI‘ H$mo H$‘ H$aVm h¡ & {Z`m©V

g§{dXm hñVmja H$aVo g‘` {dXoer ‘wÐm OmopI‘ H$mo VWm

{dXoer IarXXma Ûmam H«o${S>Q> Ho$ nÌ H$mo ImobZo go nyd©

g§{dXmË‘H$ n[an¹$Vm Ho$ AZwgma ‘mÝ`Vm Xr OmVr h¡&

‘wÐm boZXoZ go {ZnQ>Zo Ho$ A{Z{üV nhby H$mo em{‘b {H$E

~J¡a {ZJ‘ hoO Ho$ gmW ^{dî`$‘| CVma-M‹T>md H$mo H$da

H$aVm h¡ &

S) ã`mO Xa OmopI‘

ã¶mO Xa OmopI‘ dh OmopI‘ h¡ Omo {H$gr {dÎmr¶ gmYZ

Ho$ C{MV ‘yë¶ ¶m {dî¶ Ho$ ZH$Xr àdmh ‘| CVma-M‹T>md

hmoJm {Oggo ~mOma H$s ã¶mO Xam| ‘| n[adV©Z &

ã¶mO Xa OmopI‘ EŠgnmoOa - g‘rjmYrZ Ad{Y Ho$

A§V ‘| ã¶mO Xam| ‘| ~Xbmd Ho$ {bE CYma boZo dmbr

H§$n{Z¶m| H$m àXe©Z Bg àH$ma h¡ :

n[adV©Zr¶ Xa CYma :

d) Foreignexchangerisk

In case of any eventuality of export of cottonbalestoothercountries,thereistheriskduetoadversevolatilityinforeigncurrencyexchangevis-a-vis Indian rupee. Risk mitigationmeasures: As &when required for export ofcotton bales, the Corporation minimizes riskarising from adverse currency movementsby managing the uncertainty and volatilityof foreign exchange fluctuations by hedgingthe risk to achieve greater predictability andstability. Foreign currency exposures arerecognizedfromthetimeanexportcontractissignedandaspercontractualmaturitypriortoopeningofLettersofCreditbyforeignbuyers.Withoutventuringintothespeculativeaspectofdealingincurrencyderivatives,Corporationaimtocoverforeseeablefluctuationswithahedge.

e) Interestraterisk

Interestrateriskistheriskthatthefairvalueorfuturecashflowsofafinancial instrumentwillfluctuatebecauseofchangesinmarketinterestrates.

Interest rate risk exposure - The exposureof the company's borrowing to interest ratechangesattheendofthereportingperiodareasfollows:

Variablerateborrowings:

(ê$n`o bmI ‘|) /(Rs.inLakh)

ã¶m¡ao Particulars

31 ‘mM©, 2019 VH$ AsatMarch31,2019

31 ‘mM©, 2018 VH$AsatMarch31,2018

~H$m`m am{e Balance

Outstanding

^m[aV Am¡gV ã`mO XaWeightedAverage

InterestRate

~H$m`m am{e Balance

Outstanding

^m[aV Am¡gV ã`mO XaWeightedAverage

InterestRate

H$m`©erb ny±Or F$UWorkingCapitalLoan

474459.59 7.96 444200.00 7.80

Ad{Y F$U / TermLoan 0 - 0 -

Hw$b / Total 474459.59 444200.00

221


^m.H$.{Z.

C.C.I.

SensitivityAnalysis

The Company is availing credit facility at MarginalCostofFundbasedLendingRate(MCLR) fromtheconsortium of banks. Profit or loss is sensitive tohigher/lower interest expense fromborrowingsasaresultofchangesininterestrates.

(Rs.inLakh)

Particulars

ImpactonProfitAfterTaxFortheyearendedMarch31,2019

FortheyearendedMarch31,2018

Interestrates–increaseby10% 41543.68 38112.36

Interestrates–decreaseby10%

33990.28 31182.84

Note : Interest on fund deployed in Support PriceOperations is reimbursable from Government ofIndia, therefore, there is nomaterial impact on theprofitabilityofthecompany.

55 The Company was not recognizing the MATcredit entitlement i.e. unused tax credits uptoprevious year as the company was payingtax under MAT. However, during the currentreporting period the company is paying taxesunder normal provisions of Income Tax.Accordingly, the company has recognizedMAT credit entitlement retrospectively. Forearlierperiodsupto1stApril,2017MATcreditentitlementofRs.2023.34lakhandforfinancialyear 2017-18 MAT Credit entitlement of Rs.487.97lakhhasbeenadjustedretrospectively.

56 TheseFinancialStatementareapprovedbytheBoardofDirectors in itsmeetingheldon28thJune 2019 There is no dividend proposed ordeclared for thefinancialyear2018-19beforethe financial statements were approved forissue.TheDividendproposedforthefinancialyear 2018-19 by the Board of Directors issubject to theapprovalof theshareholders in

g§doXmË‘H$ {dûcofU

H§$nZr ~¢H$m| Ho$ H§$gm{Q>©¶‘ go ’§$S> AmYm[aV b|qS>J aoQ>

(E‘grEbAma) H$s gr‘m§V bmJV na H«o${S>Q> gw{dYm H$m bm^

CR>m ahr h¡ & ã¶mO Xam| ‘| ~Xbmd Ho$ n[aUm‘ñdê$n CYma go

Cƒ/{ZåZ ã¶mO ì¶¶ Ho$ à{V g§doXZerb ¶m hm{Z

(ê$n`o bmI ‘|)

ã¶m¡ao

H$a Ho$ ~mX bm^ na à^md

31 ‘mM©, 2019 df© H$mo g‘má hþE

31 ‘mM©, 2019 df© H$mo g‘má hþE

ã`mO Xa - 10% ~‹T>V Ûmam 41543.68 38112.36

ã`mO Xa - 10% H$‘r Ûmam 33990.28 31182.84

ZmoQ> : g‘W©Z ‘yë¶ g§MmbZ ‘| V¡ZmV ’§$S> na ã¶mO ^maV

gaH$ma go à{Vny{V© ¶mo½¶ h¡, Bg{bE H§$nZr H$s bm^àXVm na

H$moB© gm‘J«r à^md Zht h¡ &

55. H§$nZr ‘¡Q> H«o${S>Q> E§Q>mBQ>b‘|Q> H$mo ‘mÝ¶Vm Zht Xo ahr Wr ¶m{Z Cn¶wº$ H$a H«o${S>Q> {nN>bo df© VH$ Š¶m|{H$ H§$nZr ‘¡Q> Ho$ VhV Q>¡Šg H$m ^wJVmZ H$a ahr Wr & hmbm±{H$ dV©‘mZ [anmo{Q>ªJ Ad{Y Ho$ Xm¡amZ H§$nZr Am¶H$a Ho$ gm‘mÝ¶ àmdYmZm| Ho$ VhV H$a H$m ^wJVmZ H$a ahr h¡ & VX²Zwgma H§$nZr Zo ‘¡Q> H«o${S>Q> B§Q>mBQ>b‘|Q> Ho$ nod© ì¶mnr ê$n go ‘mÝ¶Vm Xr h¡ & 01 Aà¡b 2017 go nhbo H$s Ad{Y ‘| aIr ê$. 2023.34 bmI H$m ‘¡Q>H«o${S>Q> B§Q>mBQ>b‘|Q> Am¡a {dÎmr¶ df© 2017-18 Ho$ {bE AmaQ>r H$m ‘¡Q> H«o${S>Q> EZQ>mBQ>b‘|Q> é. 487.97 bmI H$mo

nyd©ì¶mnr ê$n go g‘m¶mo{OV {H$¶m J¶m h¡ &

56. 28 OyZ 2019 H$mo Am¶mo{OV BgH$s ~¡R>H$ ‘| {ZXoeH$

‘§S>b Ûmam BZ {dÎmr¶ {ddaUm| H$mo AZw‘mo{XV {H$¶m J¶m

h¡& {dÎmr¶ df© 2018-19 Ho$ {bE H$moB© bm^m§e àñVm{dV

¶m Kmo{fV Zht {H$¶m J¶m h¡, Bggo nhbo {H$ {dÎmr¶ gÌ

Omar H$aZo Ho$ {bE AZw‘mo{XV {H$¶m J¶m hmo & {ZXoeH$

‘§S>b Ûmam {dÎmr¶ df© 2018-19 Ho$ {bE àñVm{dV

222

^m.H$.{Z.

C.C.I.


H¥$Vo Ed§ {ZXoeH$ ‘§S>b H$s Amoa goForandonbehalfofBoardofDirectors

(S>m°. nr. A{„ amZr) (Dr.P.AlliRani)

AÜ¶j Ed§ à~§Y {ZXoeH$Chairman-cum-ManagingDirector

DIN:02305257{XZm§H$ /Date:28/06/2019hñVmja H$m ñWmZ : ZB© {X„r PlaceofSignature:NewDelhi

(àXrn Hw$‘ma AJ«dmb) (PradeepKumarAgarwal)

{ZXoeH$ ({dÎm)Director(Finance)DIN:05234132

(b{bV Hw$‘ma JwßVm) (LalitKumarGupta)

H§$nZr g{MdCompanySecretary

M.No.:46871

h‘mar g‘g§»¶H$ VmarI H$s g§b¾ [anmoQ>© Ho$ AZwgmaInTermsofourReportofEvenDateAnnexed

H¥$Vo ~doOm EÊS> H$m¡bForBaweja&Kaul

gZXr boImnmbChartered Accountants

(’$‘© a{OñQ´>oeZ Z§. 005834EZ)FirmRegistrationNo.005834N

h‘mar g‘g§»¶H$ VmarI H$s g§b¾ [anmoQ>© Ho$ AZwgmaInTermsofourReportofEvenDateAnnexed

Or ~r gr E A°ÊS> Agmo{gEQ²>g EbEbnrFor G B C A & Associates LLP

gZXr boImnmbChartered Accountants

(’$‘© a{OñQ´>oeZ Z§. : 103142S>ãë¶y/S>ãë¶y100292)FirmRegistrationNo.:103142W/W100292

g§{dV Hw$. JwaQy>(SamvitK.Gurtoo)

^mJrXma$/ PartnergXñ¶Vm H«$. 090758MembershipNo.:090758{XZm§H$ / Date:28/06/2019hñVmja H$m ñWmZ : ZB© {X„rPlaceofSignature:NewDelhi

g§Ord bmbZ(SanjeevLalan)

^mJrXma$/ PartnergXñ¶Vm H«$. : 045329MembershipNo.:045329{XZm§H$ /Date:28/06/2019hñVmja H$m ñWmZ : ZB© {X„rPlaceofSignature:NewDelhi

bm^m§e AmJm‘r dm{f©H$ gm‘mÝ¶ ~¡R>H$ ‘| eo¶aYmaH$m| H$s

‘§Oyar Ho$ AYrZ h¡, O~ Bgo AZw‘mo{XV Am¡a eo¶aYmaH$m|

H$mo {dV[aV {H$¶m OmEJm Am¡a Cgr Ad{Y Ho$ Xm¡amZ

eo¶aYmaH$m| H$mo {dVaU Ho$ ê$n ‘| ‘mÝ¶Vm Xr OmEJr &

57. JV df© Ho$ Am±H$‹S>m| H$mo Ohm± Amdí`H$ Wm, ar-J«wn/ ar-

H$mñQ> {H$`m J`m h¡ &

the ensuingAnnual General Meeting andthesamewillberecognizedasdistributionto shareholders during the period whenit will be approved and distributed to theshareholders.

57 The previous year figures have beenregrouped/restatedwherevernecessary.

223


^m.H$.{Z.

C.C.I.

Bbmhm~mX ~¢H$ ALLAHABADBANK

AmÝY«m ~¢H$ ANDHRABANK

~¢H$ Am°’$ ~S>m¡Xm BANKOFBARODA

~¢H$ Am°’$ B§{S>¶m BANKOFINDIA

goÝQ´>b ~¢H$ Am°’$ B§{S>¶m CENTRALBANKOFINDIA

H$m°anmoaoeZ ~¢H$ CORPORATIONBANK

Amo[aE§Q>b ~¢H$ Am°’$ H$m°‘g© ORIENTALBANKOFCOMMERCE

n§Om~ ZoeZb ~¢H$ PUNJABNATIONALBANK

ñQ>oQ> ~¢H$ Am°’$ B§{S>¶m STATEBANKOFINDIA

qgS>rHo$Q> ~¢H$ SYNDICATEBANK

¶y{Z¶Z ~¢H$ Am°’$ B§{S>¶m UNIONBANKOFINDIA

¶yZmBQ>oS> ~¢H$ Am°’$ B§{S>¶m UNITEDBANKOFINDIA

~¢H$m| H$s gyMr (g§H$m¶)LISTOFBANKS(CONSORTIUM)

224

^m.H$.{Z.

C.C.I.


Crea

ted by

: Me

dia R

&D (I

) Pvt

Ltd., 9

8199

0798

2

dr§ dm{f©H$ [anmoQ>©> - Cotton Corporation of India · 2019-11-26 · 6 m.h.Z. C.C.I. 49th...

Documents

Transcript of dr§ dm{f©H$ [anmoQ>©> - Cotton Corporation of India · 2019-11-26 · 6 m.h.Z. C.C.I. 49th...