Development of non -contact, full -field, stress and ...
Transcript of Development of non -contact, full -field, stress and ...
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Lorenzo Capponi - 33rd CycleSupervisor: Prof. Gianluca Rossi
06/11/2020
Presentation
Lorenzo Capponi 2
Lorenzo Capponi April 16th 1991, Perugia
Background:
• Bachelor’s degree at the DI of the University of Perugia (2014)
• Erasmus at the LADISK of the University of Ljubljana (2016-2017)
• Master’s degree at the DI of the University of Perugia (2017)
• Visiting PhD student at the LADISK of the University of Ljubljana (2019-2020)
Admission to final exam:
• PhD degree at the CISAS G. Colombo of the University of Padova (in progress)
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Overview• Research goals
• Thermoelasticity-based modal damage identification• Theory
• Thermoelasticity• Structural dynamics in frequency domain• Fatigue damage evaluation• Modal damage using thermoelasticity
• Experiments• Setup• Modal analysis• Excitation
• Results• Additional research outputs
• Side projects• Papers and conferences
• Conclusions
Lorenzo Capponi 3Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Research goals
• Development of a new measurement method using image-based and non-contact techniques
• Introduction of measurement techniques in Terex industry processes
• Software development
• Production of scientific papers
• Participation at conferences and scientific events
• National and international collaborations
Lorenzo Capponi 4Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Theory
Thermoelasticity
Lorenzo Capponi 5
𝑡𝑡𝑡𝑡Δ𝜎𝜎𝑥𝑥𝑥𝑥 Δ𝜎𝜎𝑥𝑥𝑦𝑦 Δ𝜎𝜎𝑥𝑥𝑧𝑧Δ𝜎𝜎𝑦𝑦𝑥𝑥 Δ𝜎𝜎𝑦𝑦𝑦𝑦 Δ𝜎𝜎𝑦𝑦𝑧𝑧Δ𝜎𝜎𝑧𝑧𝑥𝑥 Δ𝜎𝜎𝑧𝑧𝑦𝑦 Δ𝜎𝜎𝑧𝑧𝑧𝑧
= −ΔT𝜌𝜌𝐶𝐶𝜎𝜎
𝑇𝑇0𝛼𝛼 Δ𝜎𝜎 ∝ ΔT
Adiabatic process, Linearity, Homogeneity, Elasticity, Isotropy
Über die specifische warme fester korper, insbesondere der metalleW. Weber; Annalen der Physik (1839)On the Dynamical Theory of HeatW. Thomson; Earth and Environmental Science Transactions of The Royal Society of Edinburgh (1853)
Km =𝜌𝜌𝐶𝐶𝜎𝜎
𝑇𝑇0𝛼𝛼 =ΔTavg(1 − ν)
E Δϵρ = Density [kg/m3]Cσ = Specific heat at constant pressure [K J/kg]T0 = Ambient temperature [K]α = Thermal coefficient expansion coefficient [1/K]ΔTavg = Averaged temperature on strain-gauge area [K]ν = Poisson’s ratioΔϵ = Measured reference strain [ϵ]E = Young Modulus [Pa]
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Similar effect for gasses and solids:
Applications
Lorenzo Capponi 6
Investigating additive manufactured lattice structures: a multi-instrument approachG. Allevi, L. Capponi, G.. Rossi et al.; IEEE (2019)Structural Characterization of Complex Lattice Parts by Means of Optical Non-Contact MeasurementsR. Montanini, G. Rossi, A. Quattrocchi, D. Alizzio, L. Capponi, R. Marsili, T. Tocci; IEEE (2020)
Development of non-contact full-field stress-strain measurement techniques applied to lifting machinery’s components
PRIN Project 2015-2020: Experimental verification of stress distribution on complex structures realized using additive manufacturing technologies
Trabecular structures
Airless wheel prototype
Model Experiments Numerical
Applications
Lorenzo Capponi 7Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Thermoelasticity-based stress identification on scaled lifting machinery components
Stress distribution identification on a lifting machinery welded component using
thermoelasticity
Applications
Lorenzo Capponi 8
Experimental tests on CFRP robot for the online-monitoring of San Giorgio’s Bridge
Thermoelasticity and arUCO markers-based model validation of polymer structure: application to San Giorgio's bridge online-monitoring CFRP robotL. Capponi, T. Tocci, M. D’Imperio, S. Haider, M. Scaccia, F. Cannella, G. Rossi (In Press)
Development of non-contact full-field stress-strain measurement techniques applied to lifting machinery’s components
Open-source software development
Lorenzo Capponi 9
• pysfmov: Allows to get raw data and metadata from thermal video saved from FLIR camera software
• pyLIA: Performs digital lock-in analysis, giving amplitude and phase of thermoelastic signal
• ThermCoeff: Allows the thermoelastic coefficient identification by means of strain-gauge calibration procedure
• IR_FLife: Complete package for thermoelasticity-based modal damage identification
Thermoelasticity-based analysis: collection of python packagesL. Capponi; Zenodo (2020)
2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020%00.0
%00.2
%00.4
%00.6
%00.8
%00.10
%00.12
%00.14
%00.16
% o
f Sta
ck O
verf
low
que
stio
ns th
at m
onth
c#pythonjavascriptjavaphpc++objective-crswiftctypescriptmatlab
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Theory
Structural dynamics in frequency domain
Lorenzo Capponi 10
𝐾𝐾1 𝐾𝐾2 𝐾𝐾𝑁𝑁
𝐷𝐷1 𝐷𝐷2 𝐷𝐷𝑁𝑁
𝑀𝑀1 𝑀𝑀2 𝑀𝑀𝑁𝑁
𝑥𝑥1 𝑥𝑥2 𝑥𝑥𝑁𝑁
𝑓𝑓1 𝑓𝑓2 𝑓𝑓𝑁𝑁
𝑋𝑋 𝜔𝜔 = 𝐾𝐾 + 𝜔𝜔𝐷𝐷 − 𝜔𝜔2𝑀𝑀 −1𝐹𝐹 𝜔𝜔 = 𝐻𝐻 𝜔𝜔 𝐹𝐹 𝜔𝜔
𝑀𝑀�̈�𝑥 𝑡𝑡 + 𝐷𝐷�̇�𝑥 𝑡𝑡 + 𝐾𝐾𝑥𝑥 𝑡𝑡 = 𝑓𝑓 𝑡𝑡
𝐻𝐻 𝜔𝜔 = Φ 𝜔𝜔𝑟𝑟2 1 + 𝜂𝜂𝑟𝑟 − 𝜔𝜔2 −1Φ𝑇𝑇
𝑋𝑋𝑠𝑠 𝜔𝜔 = Φ𝑠𝑠 𝜔𝜔𝑟𝑟2 1 + 𝜂𝜂𝑟𝑟 − 𝜔𝜔2 −1Φ𝑇𝑇𝐹𝐹 𝜔𝜔 = 𝐻𝐻𝑠𝑠𝑠𝑠 𝜔𝜔 𝐹𝐹 𝜔𝜔
𝐻𝐻𝑠𝑠𝑠𝑠 𝜔𝜔 = �𝑟𝑟=1
𝑁𝑁
𝐻𝐻𝑠𝑠𝑠𝑠𝑟𝑟 𝜔𝜔 = �
𝑟𝑟=1
𝑁𝑁𝑋𝑋𝑠𝑠
𝑟𝑟 𝜔𝜔𝐹𝐹 𝜔𝜔
�𝐻𝐻𝑠𝑠𝑠𝑠 𝜔𝜔 = �𝑟𝑟=1
𝑚𝑚<𝑁𝑁
𝐻𝐻𝑠𝑠𝑠𝑠𝑟𝑟 𝜔𝜔
�𝑺𝑺𝒔𝒔𝒔𝒔 𝝎𝝎 = �𝒓𝒓=𝟏𝟏
𝒎𝒎<𝑵𝑵
�𝑺𝑺𝒔𝒔𝒔𝒔𝒓𝒓 𝝎𝝎 = �
𝒓𝒓=𝟏𝟏
𝒎𝒎<𝑵𝑵
𝑯𝑯𝒔𝒔𝒔𝒔𝒓𝒓 𝝎𝝎 ⋅ 𝑺𝑺𝒔𝒔𝒔𝒔 𝝎𝝎 ⋅ 𝑯𝑯𝒔𝒔𝒔𝒔
𝒓𝒓∗𝑻𝑻 𝝎𝝎
Vibration Fatigue by Spectral Methods: From Structural Dynamics to Fatigue DamageJ. Slavic, M. Mršnik, M. Cesnik, J. Javh, and M. Boltežar, Elsevier (2020)Theoretical and experimental modal analysisN. M. M. Maia and J. M. M. Silva ; Research Studies Press (1997)
Discrete Fourier Transform (DFT)
𝑋𝑋 𝜔𝜔 = �𝑛𝑛=0
𝑁𝑁−1
𝑋𝑋𝑛𝑛𝑒𝑒𝑥𝑥𝑒𝑒 −i𝑛𝑛𝜔𝜔𝑁𝑁
Power Spectral Density (PSD)
𝑆𝑆𝑥𝑥𝑥𝑥 𝜔𝜔 =1𝑞𝑞 �
𝑢𝑢=1
𝑞𝑞1𝑊𝑊 |𝑋𝑋𝑇𝑇𝑤𝑤𝑤𝑤 𝜔𝜔 |2
Modal reduction:
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Frequency Response Function:
Stress response Power Spectral Density:
Applications
Lorenzo Capponi 11
Engine suspension experimental characterization for cooling fan and radiator damageability reduction
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Theory
Damage evaluation
Lorenzo Capponi 12
�𝐷𝐷𝑇𝑇𝑇𝑇 = 𝑏𝑏 + 1 − 𝑏𝑏 𝛼𝛼2𝑘𝑘−1 �𝐷𝐷𝑁𝑁𝑇𝑇 = �𝑫𝑫𝑻𝑻𝑻𝑻 �𝑺𝑺𝒔𝒔𝒔𝒔 𝝎𝝎 , 𝑻𝑻, 𝒌𝒌
�𝐷𝐷𝐷𝐷𝐷𝐷 = 𝐶𝐶−1𝜈𝜈𝑝𝑝𝑚𝑚0
𝑘𝑘2 𝐺𝐺1𝑄𝑄𝑘𝑘Γ 1 + 𝑘𝑘 + 2
𝑘𝑘Γ 1 +
𝑘𝑘2 𝐺𝐺2 𝑅𝑅 𝑘𝑘 + 𝐺𝐺3 = �𝑫𝑫𝑫𝑫𝑫𝑫 �𝑺𝑺𝒔𝒔𝒔𝒔 𝝎𝝎 , 𝑻𝑻, 𝒌𝒌
Tovo-Benasciutti:
Dirlik:
�𝑫𝑫𝑵𝑵𝑻𝑻 = 𝜈𝜈𝑝𝑝𝐶𝐶−1𝛼𝛼2 2𝑚𝑚0𝑘𝑘
𝛤𝛤 1 +𝑘𝑘2
𝝂𝝂𝒑𝒑 =1
2𝜋𝜋𝑚𝑚4
𝑚𝑚2
𝚪𝚪 𝒛𝒛 = �0
∞𝑡𝑡𝑧𝑧−1𝑒𝑒−𝑡𝑡d𝑡𝑡
𝜶𝜶𝒊𝒊 =𝑚𝑚𝑖𝑖
𝑚𝑚0𝑚𝑚2𝑖𝑖
𝒃𝒃 =(𝛼𝛼1 − 𝛼𝛼2)(1.112 1 + 𝛼𝛼1𝛼𝛼2 − 𝛼𝛼1 − 𝛼𝛼2
2.11𝛼𝛼2 + 𝛼𝛼1 − 𝛼𝛼2
𝛼𝛼2 − 1 2𝑸𝑸 =1.25(𝛼𝛼2 − 𝐺𝐺3 − 𝐺𝐺2𝑅𝑅)
𝐺𝐺1
𝒙𝒙𝒎𝒎 =𝑚𝑚1
𝑚𝑚0
𝑚𝑚2
𝑚𝑚4
12
𝑮𝑮𝟏𝟏 =2(𝑥𝑥𝑚𝑚 − 𝛼𝛼2
2)1 + 𝛼𝛼2
2 𝑮𝑮𝟐𝟐 =1 − 𝛼𝛼2 𝐺𝐺1 + 𝐺𝐺2
1 − 𝑅𝑅𝑮𝑮𝟑𝟑 = 1 − 𝐺𝐺1 − 𝐺𝐺2𝑹𝑹 =
𝛼𝛼2 − 𝑥𝑥𝑚𝑚 − 𝐺𝐺12
1 − 𝛼𝛼2 − 𝐺𝐺1 + 𝐺𝐺12
𝒎𝒎𝒊𝒊 = �0
∞𝜔𝜔𝑖𝑖�̃�𝑆𝑠𝑠𝑠𝑠 𝜔𝜔 d𝜔𝜔
Spectral methods for lifetime prediction under wideband stationary random processesD. Benasciutti and R. Tovo; International Journal of Fatigue (2013)Application of computers in fatigue analysis,T. Dirlik; PhD thesis, University of Warwick (1985).Frequency-domain methods for a vibration fatigue-life estimation: Application to real dataM. Mršnik, J. Slavic, and M. Boltežar; International Journal of Fatigue (2013)
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
𝜎𝜎 = 𝐵𝐵𝑁𝑁−1𝑘𝑘
Cycles
Stre
ssPalmgren-Miner: �𝐷𝐷 = �𝑖𝑖
�𝐷𝐷𝑖𝑖 = �𝑖𝑖
𝑛𝑛𝑖𝑖
𝑁𝑁𝑖𝑖
Endurance curve
Theory
Damage evaluation using thermal information
Lorenzo Capponi 13
�𝐷𝐷𝑇𝑇𝑇𝑇𝑖𝑖,𝑗𝑗 = �𝐷𝐷𝑇𝑇𝑇𝑇𝑖𝑖,𝑗𝑗 �̃�𝑆𝑠𝑠𝑠𝑠𝑖𝑖,𝑗𝑗 𝜔𝜔 , 𝐵𝐵, 𝑘𝑘
�𝐷𝐷𝐷𝐷𝐷𝐷𝑖𝑖,𝑗𝑗 = �𝐷𝐷𝐷𝐷𝐷𝐷𝑖𝑖,𝑗𝑗 �̃�𝑆𝑠𝑠𝑠𝑠𝑖𝑖,𝑗𝑗 𝜔𝜔 , 𝐵𝐵, 𝑘𝑘
�̃�𝑆𝑠𝑠𝑠𝑠𝑖𝑖,𝑗𝑗 𝜔𝜔 =1𝑞𝑞 �
𝑢𝑢=1
𝑞𝑞1𝑊𝑊 Δ𝜎𝜎𝑖𝑖,𝑗𝑗 𝑡𝑡
2
=1𝑞𝑞 �
𝑢𝑢=1
𝑞𝑞1𝑊𝑊
Δ𝑇𝑇𝑖𝑖,𝑗𝑗(𝑡𝑡)𝐾𝐾𝑚𝑚
2
Δ𝜎𝜎𝑖𝑖,𝑗𝑗 (𝑡𝑡) = Δ𝑇𝑇𝑖𝑖,𝑗𝑗(𝑡𝑡)𝐷𝐷𝑚𝑚
ithro
w
jth columnDevelopment of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Δ𝑇𝑇𝑖𝑖,𝑗𝑗
(𝑡𝑡)
Time [s]
Stress Spectrum
ℱΔ𝑇𝑇𝑖𝑖,𝑗𝑗(𝑡𝑡)
𝐾𝐾𝑚𝑚
Modal damage using thermoelasticity
Lorenzo Capponi 14
�𝐷𝐷 = �𝑟𝑟=1
𝑁𝑁
�𝐷𝐷𝑟𝑟 = �𝑟𝑟=1
𝑁𝑁𝑛𝑛𝑟𝑟
𝑁𝑁𝜎𝜎𝑖𝑖,𝑗𝑗(𝜔𝜔𝑟𝑟)
𝑁𝑁𝜎𝜎𝑖𝑖,𝑗𝑗(𝜔𝜔𝑟𝑟)
Endurance curve
𝜎𝜎 = 𝐵𝐵𝑁𝑁−1𝑘𝑘
𝑛𝑛𝑟𝑟 =𝜔𝜔𝑟𝑟
2𝜋𝜋
Δ𝜎𝜎𝑖𝑖,𝑗𝑗 𝜔𝜔𝑟𝑟
�𝑫𝑫𝒓𝒓 = 𝒏𝒏𝒓𝒓𝟏𝟏𝑻𝑻
𝓕𝓕 𝚫𝚫𝝈𝝈 𝝎𝝎𝒓𝒓
𝒌𝒌= 𝒏𝒏𝒓𝒓
𝟏𝟏𝑻𝑻
𝓕𝓕 𝚫𝚫𝑻𝑻𝒊𝒊,𝒋𝒋(𝒕𝒕)𝑫𝑫𝒎𝒎
𝒌𝒌
𝑛𝑛𝑟𝑟
Δ𝜎𝜎𝑖𝑖,𝑗𝑗 𝜔𝜔𝑟𝑟
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
𝑁𝑁𝜎𝜎𝑖𝑖,𝑗𝑗 =𝐵𝐵
ℱΔ𝑇𝑇𝑖𝑖,𝑗𝑗(𝑡𝑡)
𝐾𝐾𝑚𝑚
𝑘𝑘
Damage intensity caused by each considered mode:
Proposed modal approach:
Modal damage using thermoelasticity
Lorenzo Capponi 15Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Multiaxial random
excitation
Stress (t)
Temperature (t)
Fatigue strengthFatigue exponent
ℱStress (ω)
PSD stress response
Total damage
Spectral methods
Modal approach
Modal damage
Young modulusPoisson ratioThermoelastic
coefficient
Thermoelasticity-based modal damage identification
Setup
Lorenzo Capponi 16
Material A-S8U3
Young Modulus 75 ⋅ 103[MPa]
Density 2710 [kg/m3]
Poisson ratio 0,33
Fatigue exponent 6,51
Fatigue strength 800,26 [MPa]
Thermoelastic coefficient 1,2 ⋅ 10−8 ± 15% [°C/Pa]
Uninterrupted and accelerated vibrational fatigue testing with simultaneous monitoring of the natural frequency and dampingM.Česnik, J. Slavič and M. Boltežar; Journal of Sound and Vibration (2012)Non-stationarity index in vibration fatigue: Theoretical and experimental research;L. Capponi, M. Česnik, J. Slavič, F. Cianetti, M. Boltežar; International Journal of Fatigue (2017)Vibration fatigue using modal decompositionM. Mršnik, J. Slavič and M. Boltežar; Mechanical Systems and Signal Processing, Vol. 98, p. 548-556 (2018)
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Km = ΔTavg(1−ν)E Δϵ
= 1,2 ⋅ 10−8 ± 15%
Strain-gauge calibration
Thermoelasticity-based modal damage identification
Modal analysis
Lorenzo Capponi 17Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Force excitationKinematicexcitation
Linear sine-sweep in 10-200 Hz range
Thermoelasticity-based modal damage identification
Modal analysis
Lorenzo Capponi 18Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Mode shapes and modal stress
𝑓𝑓1 ≅ 33 [Hz] 𝑓𝑓2 ≅ 55 [Hz]
Reconstructed FRF
Thermoelasticity-based modal damage identification
Lorenzo Capponi 19
Excitation
16 experimental combinations
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Thermal camera: FLIR A6751scNETD: < 18 mK
Infrared detector: MWIR Indium AntimonideDynamic range: 14-bit
Sampling frequency: 400 HzResolution: 128 x 160 pixels
Thermoelasticity-based modal damage identification
Lorenzo Capponi 20
Excitation
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
𝑓𝑓1 ≅ 33 [Hz] 𝑓𝑓2 ≅ 55 [Hz]
Temperature-stress time-history Temperature-stress time-history
Thermoelasticity-based modal damage identification
Lorenzo Capponi 21
Excitation
�𝐷𝐷𝑖𝑖,𝑗𝑗 = �𝑟𝑟
�𝐷𝐷𝑟𝑟𝑖𝑖,𝑗𝑗 = �𝑟𝑟
𝑛𝑛𝑟𝑟1𝐵𝐵
ℱ Δ𝜎𝜎𝑖𝑖,𝑗𝑗 𝜔𝜔𝑟𝑟
𝑘𝑘
�𝐷𝐷𝑇𝑇𝑇𝑇𝑖𝑖,𝑗𝑗 = �𝐷𝐷𝑇𝑇𝑇𝑇𝑖𝑖,𝑗𝑗
1𝑞𝑞
�𝑢𝑢=1
𝑞𝑞1
𝑇𝑇𝑤𝑤|Δ𝜎𝜎𝑇𝑇𝑤𝑤𝑤𝑤𝑖𝑖,𝑗𝑗
𝜔𝜔 |2 , 𝐵𝐵, 𝑘𝑘
�𝐷𝐷𝐷𝐷𝐷𝐷𝑖𝑖,𝑗𝑗 = �𝐷𝐷𝐷𝐷𝐷𝐷𝑖𝑖,𝑗𝑗
1𝑞𝑞
�𝑢𝑢=1
𝑞𝑞1
𝑇𝑇𝑤𝑤|Δ𝜎𝜎𝑇𝑇𝑤𝑤𝑤𝑤𝑖𝑖,𝑗𝑗
𝜔𝜔 |2 , 𝐵𝐵, 𝑘𝑘
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
A B
DC
Tovo-Benasciutti:
Dirlik:
Modal damage:
A B
C D
Thermoelasticity-based modal damage identification
Lorenzo Capponi 22
Tovo-Benasciutti Dirlik Modal damage
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
A B
DC
Thermoelasticity-based modal damage identification
Lorenzo Capponi 23
Results 𝑓𝑓1 ≅ 33 [Hz] 𝑓𝑓2 ≅ 55 [Hz]
�𝐷𝐷𝑖𝑖,𝑗𝑗 = �𝑟𝑟
�𝐷𝐷𝑟𝑟𝑖𝑖,𝑗𝑗 = �𝐷𝐷1𝑖𝑖,𝑗𝑗 + �𝐷𝐷2𝑖𝑖,𝑗𝑗 = �𝐷𝐷(33 𝐻𝐻𝑧𝑧)𝑖𝑖,𝑗𝑗 + �𝐷𝐷(55 𝐻𝐻𝑧𝑧)𝑖𝑖,𝑗𝑗
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Lorenzo Capponi 24
Thermoelasticity-based modal damage identification
• Spatial information
• Visual mode shape definition
• Insensitive to uncertainty even using small-dynamic-range sensor
• Modal damage information
• Robust and theoretically-supported
• Promising also for online-monitoring and off-grid applications
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Additional research outputs
Lorenzo Capponi 25Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Side projects
Lorenzo Capponi 26
• Thermoelasticity-based experimental tests for Terex lifting machinery factory.• Master thesis supervisor for four student’s traineeships in Terex lifting machinery factory.• Acoustic measurement in anechoic chamber for DeWalt circular saws noise reduction.• Optimization of wood dust emission from DeWalt circular saws.• Vibration fatigue accelerated test on Korg musical products packaging.• Vibration fatigue test on Renzacci S.p.a. machinery components.• Design of innovative solutions and experimental tests for SIS.Tg products.• Design of innovative additive manufacturing solutions for Igea Pro Srl.• Experimental tests on polymer online-monitoring robot of San Giorgio’s Bridge in collaboration with Camozzi
Group, Inse Berardi and Italian Institute of Technology (IIT).• Training courses on additive manufacturing technologies for Terex Srl and TUCEP• Training course on experimental frequency analysis for Terex Srl.• Practical exercising in Bachelor’s and Master’s in Mechanical and Thermal Measurement courses at the
Department of Engineering of University of Perugia.• Scientific collaboration with 3DFIC for the development of new technologies for medical applications• Scientific collaboration with the Laboratory for Dynamics of Machines and Structures (LADISK) of the Faculty of
Mechanical Engineering of the University of Ljubljana• Scientific collaboration in a national project on non-contact experimental characterization of trabecular
structures and airless prototype realized through additive manufacturing technologies• Scientific collaboration with medical equips for the development of optimized CPAP masks during Sars-COV-2
pandemic.
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Side projects
Lorenzo Capponi 27
• Theoretical and experimental analysis of lifting machinery efficiency: hydraulic and mechanical transmissions
• Theoretical and experimental verification of energy saving of an electric Gravity Lowering System
• Training courses
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Lorenzo Capponi 28
Development of optimized CPAP masks during Sars-COV-2 pandemic: snorkelling mask adapted for NIV process
MODIFIEDINPUT-OUTPUT
CONFIGURATIONSnorkelling Medical Helmet
Performance assessment of medical and non-medical CPAP interfaces used during the COVID-19 pandemicM. Marini, L. Capponi et al. (In Press)
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Snorkelling
Medical
Helmet
Original
Modified
Side projects
Papers and conferences1. Non-stationarity index in vibration fatigue: Theoretical and experimental research;
L. Capponi, M. Česnik, J. Slavič, F. Cianetti, M. Boltežar; International Journal of Fatigue (2017)
2. The relevance of non-stationarities and non-Gaussianities in vibration fatigue;M. Česnik, J. Slavič, L. Capponi, M. Palmieri, F. Cianetti, M. Boltežar; MATEC Web of Conferences (2018)
3. Census Transform Based Optical Flow for Motion Detection during Different Sinusoidal Brightness Variations;G. Allevi, L. Casacanditella, L. Capponi, R. Marsili, G. Rossi; Journal of Physics: Conference Series (2018)
4. Investigating additive manufactured lattice structures: a multi-instrument approach;G. Allevi, L. Capponi, P. Castellini, P. Chiariotti, F. Docchio, F. Freni et al.; IEEE I2MTC (2019)
5. Non-stationarity and non-Gaussianity in Vibration Fatigue;J. Slavič, M. Česnik, L. Capponi, M. Palmieri, F. Cianetti, M. Boltežar; Sensors and Instrumentation, (2020)
6. Collection of experimental data for multiaxial fatigue criteria verification;G. Morettini, L. Capponi, C. Braccesi, F. Cianetti, S.M.J. Razavi, K. Solberg; FFEMS (2020)
7. Thermoelasticity-based modal damage identification;L. Capponi, J. Slavič, G. Rossi, M. Boltežar; International Journal of Fatigue (2020)
8. Structural Characterization of Complex Lattice Parts by Means of Optical Non-Contact Measurements;R. Montanini, G. Rossi, A. Quattrocchi, D. Alizzio, L. Capponi, R. Marsili; IEEE I2MTC (2020)
9. Thermoelastic stress analysis on rotating and oscillating mechanical components;L. Capponi, R. Marsili, G. Rossi, T. Zara; International Journal of Computational Engineering Research (IJCER) (2020)
10. Suction system vapour velocity map estimation through SIFT-based algorithm;T. Tocci, L. Capponi, R. Marsili, G. Rossi, J. Pirisinu; Journal of Physics: Conference Series (2020)
Lorenzo Capponi 29Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Conclusions
Lorenzo Capponi 30
1st
2nd
3rd
PhD
• Learnt measurement techniques, dedicated software and improved laboratory skills• Experience in Terex Italia Srl factory • Deepened Thermoelasticity technique• Educational activities
• National collaborations with industries and research groups• Research projects in collaboration with Terex Italia Srl factory• Educational activities• Scientific papers and conferences
• International collaborations with industries and research groups• Educational activities• Visiting PhD period abroad• Scientific papers and conferences• PhD thesis writing
• Admission to final exam• PhD defence• PhD degree
Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Conclusions• Development of a new measurement method using image-based
and non-contact techniques
• Introduction of measurement techniques in industry processes
• Software development
• Production of scientific papers
• Participation at conferences and scientific events
• National and international collaborations
Lorenzo Capponi 31Development of non-contact, full-field, stress and strain measurement techniques applied to lifting machinery’s components
Thanks for the attention