Design & Build South East 2015-2016
description
Transcript of Design & Build South East 2015-2016
![Page 1: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/1.jpg)
Design and Build South East — 2015-2016 — 1
&design build
SOUTH EAST2015-2016
Your building & renovation magazine
Times House Publishing Ltd
South East in demand • new subdivisions • major transport initiatives• housing boom
New Builds & RenovationArchitecture
Interiors & DecorKitchens & Bathrooms
Landscaping & Pools
Cover: Rockcote INTEGRA Lightweight Concrete Facade SystemCymon Allfrey Architects. Stephen Goodenough Photographer
![Page 2: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/2.jpg)
2 — Design and Build South East — 2015-2016
dreaming of a home to
love?dreaming dreaming dreaming dreaming dreaming dreaming dreaming dreaming of of of of of of of of of of of of of of of of of of
aaaaaaaaa home home home home home home home home home dreaming
home dreaming dreaming dreaming
home dreaming
home dreaming
home dreaming dreaming dreaming
home dreaming dreaming dreaming dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming
home dreaming dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming
home dreaming dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming
home dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming dreaming dreaming
home dreaming dreaming
home dreaming dreaming
home dreaming dreaming dreaming dreaming
home dreaming dreaming
tototototototototolove?love?love?love?love?love?love?love?love?
for sale now...0800 4 EQ HOMESeqgroup.co.nz
Better
hom
esho
mes
BetterLive Life
live life
SC3427
![Page 3: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/3.jpg)
Design and Build South East — 2015-2016 — 3
dreaming of a home to
love?dreaming dreaming dreaming dreaming dreaming dreaming dreaming dreaming of of of of of of of of of of of of of of of of of of
aaaaaaaaa home home home home home home home home home dreaming
home dreaming dreaming dreaming
home dreaming
home dreaming
home dreaming dreaming dreaming
home dreaming dreaming dreaming dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming
home dreaming dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming
home dreaming dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming
home dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming dreaming dreaming dreaming
home dreaming dreaming dreaming dreaming
home dreaming dreaming
home dreaming dreaming
home dreaming dreaming dreaming dreaming
home dreaming dreaming
tototototototototolove?love?love?love?love?love?love?love?love?
for sale now...0800 4 EQ HOMESeqgroup.co.nz
Better
hom
esho
mes
BetterLive Life
live life
SC3427
![Page 4: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/4.jpg)
4 — Design and Build South East — 2015-2016
Welcome to Design & Build – South East, a new annual publication which comprehensively covers subdivision development, lifestyle opportunities,
building expansion and general growth throughout south-eastern parts of Auckland.
Designed to give newcomers to the region, and anyone interested in settling within the wider area, a picture of its varied communities, Design & Build is an informative and instant guide to the district as it is now and as it is developing for the future.
For anyone thinking of buying or selling locally, the publication covers opportunities ranging from urban living to coastal subdivisions and even semi-rural locations. It looks at housing initiatives within Howick Ward, such as Ormiston then across to Beachlands and Maraetai going as far south as Takanini and Papakura.
Infrastructure, industry, schools, housing, and retail are covered as more and more people turn their eyes east and south for a fresh start in life.
For some, new coastal developments are the weekend escape busy professionals crave whilst
being equally attractive to retirees. Others are looking for smaller lifestyle blocks while others want modern convenience and less land at a budget-friendly price.
To the south, whole new communities with affordable townhouses and dedicated green spaces, are attracting young families especially as they have access to excellent sports and leisure facilities, schools and amenities.
An added attraction for many in these areas is easy access to the motorway and to planned transport improvements.
Of course, Design & Build covers far more than new housing opportunities. There is plenty of information for renovators, and new residents moving into existing homes.
While steering readers towards professionals and companies which know and work within the local area, and which have a keen knowledge of local requirements, services, and more, Design & Build South East also showcases all that Auckland’s popular south-eastern quarter has to offer and the exciting future it is facing.
Welcome
Freephone: 0800 456 789 Phone: 09 271 8080Email: [email protected]: www.ruralliving.co.nzLevel 1, The Lane, Botany Town Centre, Chapel Road, Auckland PO Box 259-243, Botany, Akld 2163
Editor: Helen Perry Sales: Kate Ockelford-Green Caroline Boe Rachel Watts Art Director: Clare McGillivray Manager: Karla Wairau
Contributing Writer: Angela KempContributing Photographers: Paul Vettoretti, Wayne MartinPublisher: Brian NebenA publication of Times House Publishing Ltd
DISCLAIMER: Articles published in Design & Build Franklin do not necessarily reflect the views of the publishers or editor. All material is provided as a general information service only. Times House Publishing Ltd does not assume or accept any responsibility for, and shall not be liable for, the accuracy or appropriate application of any information in this magazine. All the material in this magazine has the protection of international copyright. All rights reserved. No content may be reproduced without the prior written consent of Times House Publishing Ltd.
&design build
SOUTH EAST
Your building & renovation magazine
![Page 5: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/5.jpg)
Design and Build South East — 2015-2016 — 5
Design + Build
TM
CA
R0731
Personal & ProfessionalFowler Homes pride themselves on building all homes to the highest quality.
We focus on the right design to suityour requirements.
Phone Bret to discuss your new home requirements - 0800 4 FOWLER www.FOWLERHOMES.co.nz
BRET ROBINSONMaster Builder,
Licensed Building Practitioner& Project Manager for your
new FOWLER HOME™
6 All the appeal of the east
7 Southern attributes big draw card
8-9New town centre response to rapid residential growth
10Business park investment and employment opportunities
11New era for Flat Bush
12-13Pohutukawa Coast hot spot for homeseekers
15School, sports, leisure – Takanini thrives
16Community-style developments add to south’s appeal
Contents
12-13
59
34
Site & Boundary Redefinition SurveysBuilding SetoutResource Consent ApplicationsSubdivisionsLand Development EngineeringGeotechnical EngineeringStructural EngineeringStructural Engineering
Specialists in all aspects of
SURVEYING & LAND DEVELOPMENT
152 Kolmar RdPapatoetoe
Auckland09 278 7078
www.fraserthomas.co.nz
Free Phone: 0508 2 SURVEY
CAR0743
21Road expansion bypass to south
26-27Dedicated busway to ease traffic congestion
30New ferry terminal will meet commuter demand
34A neighbourly way of living
38In search of an architect
41Plan before renovating
53Choosing window treatments
53Tips for successful interiors
59Landscaping completes the look
![Page 6: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/6.jpg)
6 — Design and Build South East — 2015-2016 6 — Design and Build South East — 2015-2016
In the eastern quarter, the suburbs of Pakuranga, Half Moon Bay, Bucklands and Eastern Beaches, Howick, and Cockle Bay all the way through to Pine Harbour, Beachlands
and Maraetai, are bounded on one side by the sea. Depending on where one sett les within
these areas, the other side embraces bustling suburban communiti es which gradually give way to countryside and wide open spaces.
Housing features character homes and new builds and the region is fl ush with services and ameniti es. Newcomers will discover excellent shopping, a cafe culture, respected schools, libraries, medical faciliti es including a 24-hour accident and medical facility, recreati on and
arts centres plus varied leisure faciliti es such as Lloyd Elsmore Park which accommodates several sport codes, an indoor swimming pool complex, skateboard park, and also the award-winning Howick Historical Village.
It’s the range of choice which appeals to many buyers, including new immigrants, extended families, young professionals and reti rees and because there is sti ll extensive development across the region, the att racti on is strong.
Wending its way to Whitf ord, Beachlands and Maraetai, the road passes through rural surrounds where pony club, outdoor recreati on and water acti viti es abound.
So, whether one is seeking seaside living,
park-like surrounds, a large secti on, a small secti on, a small house or a palati al mansion, reti rement village or close proximity to malls, schools, and professional rooms, there is much to please.
In additi on, as more land becomes available, quality housing companies are off ering land and home packages to suit diff erent budgets and household requirements.
Demand is high but for those seeking a desirable lifestyle then this part of the east, heading south-east, is likely to fi t the bill.
Well grounded in its Sett ler past but embracing upbeat, contemporary living, there is everything to gain when heading east.
Go east, young man!With entry to inner Auckland suburbs growing more diffi cult every year,
more people are looking east and south for new homes, invigorating family living, and access to urban, coastal and rural domains.
![Page 7: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/7.jpg)
Design and Build South East — 2015-2016 — 7
While the far eastern quarter of Auckland appeals to many people, the pull of the south is also strong. That’s because there has been
a resurgence of growth with the emphasis on community living – townhouses, terrace houses and apartments built around communal green spaces with excellent schools and recreati on opportuniti es nearby.
Close proximity to the Southern Motorway also makes the southern quarter and its expansion to the east extremely att racti ve. This direct route north or south off ers easy access to work in the city or to the south even as far as Hamilton – new infrastructure has considerably trimmed back driving ti me between Papakura and Te Rapa.
Importantly, burgeoning suburbs, parti cularly around Takanini, are not short of quality ameniti es which cover educati on, health, recreati on, entertainment and more.
And, with the Hunua Ranges nearby there is every reason to enjoy its walking and tramping tracks and to embrace a natural environment city counterparts envy. What’s more residents in these areas don’t have to travel far to reach the sea either to the east or the west or to enjoy the green
spaces, fl owerbeds, trees and walkways within the Auckland Botanic Gardens at Manurewa.
With an emphasis on new aff ordable, quality housing, but where plenty of opportuniti es exist to buy within keen budgets, then renovate and add
value, the up and coming south is a Mecca for fi rst home buyers, young families seeking a sense of community and professional couples who require comfortable living with not too much outdoor maintenance.
South to the border
![Page 8: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/8.jpg)
8 — Design and Build South East — 2015-2016
The development of the country’s newest town in Auckland’s south-east shares an uncanny similarity with its Scottish namesake.
Thousands of miles away in East Lothian, Scotland, the village of Ormiston can trace its history back to 1735.
The village was the first planned village in Scotland and was founded by John Cockburn, one of the initiators of the Agricultural Revolution.
Fast forward to 2015 and the new Ormiston is preparing to emerge as one of the most carefully planned developments in the region.
It is at the heart of Flat Bush, the country’s largest and most comprehensively planned new town currenty taking shape on 1700ha of undeveloped land in south-east Auckland.
By 2025 it is expected that the area will be home to at least 40,000 people.
In Ormiston Town there will be a mix of about 500-700 households ranging from terraced housing to contemporary apartments and innovative work/life spaces.
Homes will be clustered around green and shared spaces to create a sense of community, safety and belonging.
It is not yet known how much each property will cost but they are expected to be attractively priced in an area that is rapidly growing with strong demand for new housing.
Evan Davies, CEO of Todd Property Group, which is creating the township in partnership with Auckland Council, says the plan for Ormiston Town Centre has been developed for everyone who makes up a community.
“It will not simply be a place for people to work or shop, it will be a place to go for a walk, relax, cycle and meet people from your community,” he explains. “It will have high quality urban design, easy accessibility to the surrounding park, and safe public spaces.”
The town centre will cover 19 hectares and will cost an estimated $500 million.It will be integrated with the 94-hectare Barry Curtis Park and straddle Ormiston Road to the east of the gateway Ormiston Bridge near Chapel Road.
There will be a huge range of options for people looking for somewhere to eat and socialise.
A planned Food Arcade will be the first of its kind in New Zealand, encapsulating the romance of European arcades and Australian metropolitan markets with stalls and covered kiosks offering fruit, vegetables, wines and delicacies.
There will also be a 500-seat food court and a number of stand-alone cafes, restaurants and bars.
Strip-style shopping and pedestrian street-life is also envisaged for the main road travelling north to south across Ormiston Road and Arbour Lane running parallel with Ormiston Road.
Civic amenities planned for the town centre include a library, cultural, community and aquatic centres, likely to be worth about $30m.
Work has started on the first stage of 64 terraced houses and on a 6000sq m Pak’n Save supermarket which is expected to open late 2015 or early 2016.
Residential component resource consent has been lodged for more housing, while negotiations are continuing with a department store,
Town centre takes shape
![Page 9: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/9.jpg)
Design and Build South East — 2015-2016 — 9
Town centre takes shapecommercial building and cinema operators.
The total commercial property component is expected to be 20,000 sq m, although it will be subject to market demand, Mr Davies says.
Total retail is expected to be about 30,000 sq m, but this component of the project had not yet received resource consent when Design and Build went to print. However, a marketing campaign to secure tenants for stage one retail blocks starts later this year.
Still subject to consent is more than 3000 car parks, including 1800 to support the retail outlets. “It’s a unique opportunity to set a new benchmark,” says Mr Davies. “It won’t be like any other place. It’s not often you get a big piece of land like this – there are a lot more options.
“The Ormiston development is an exciting and unique opportunity to work in partnership with the Auckland Council to build an entire new town centre from scratch.
“It’s a blank canvas that enables a fresh look rather than working from a redevelopment of what is already there.”
New Zealand’s first cable-stayed bridge ■■
was opened in October 2008 in Flat Bush. It runs through the middle of Barry Curtis Park, which is to be the green centrepiece of the new Ormiston Town.
The new Ormiston Town development was ■■
due to start in 2008 but was stalled for five years because of the Global Financial Crisis.
The heart of Ormiston Town Centre will ■■
be a 2925sqm, $20.8 million library and multi-use community facility. Planning for this is well underway. The concept design features two levels with a central community hub, a café facing Barry Curtis Park, an arts-
themed courtyard and a central gallery and studio. It also incorporates shared facilities for staff, performance and rehearsal areas and additional spaces for community and arts activities.
As part of the development of Flat Bush ■■
an aquatic centre is to be built on Ormiston Road. The site was chosen for its visibility, easy walking distance for nearby school students, proposed bus services and its town centre location. Initial plans feature lap, leisure, learners and toddler pools, a spa, sauna and steam room, a fitness centre and café.
Did you know...?
![Page 10: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/10.jpg)
10 — Design and Build South East — 2015-2016
With well over 13,000 businesses within its boundary, Howick ward is one of Auckland’s most productive districts. Manufacturing is the largest
sector followed by construction, engineering, food and beverage, health technologies and niche manufacturing.
Pivotal to the area’s commercial success is Highbrook Business Park and the illustrious founders of one of NZ’s most iconic companies.
From the 1960s, Highbrook was the estate of Sir Woolf Fisher, founder of Fisher & Paykel. The area was known as the Ra Ora Stud and was used as a breeding and training facility for racehorses.
The Fisher family opted to use the land for commercial development and developed plans in 1998.
In 2001, business zoning was allowed and commercial property was developed under the company name Highbrook Development Ltd.
Now the Highbrook and East Tamaki industrial areas are the major economic and employment drivers for the Howick ward.
Highbrook incorporates a business town, retail hub and commercial services. The vision for Highbrook is of a worldclass business park that combines people and industry in an exceptional natural landscape. The next stage in its development was announced by the Goodman Property Trust in March, 2015.
Goodman (NZ) chief executive officer, John Dakin, said a positive business environment was supporting the rapid expansion of Highbrook Business Park.
“With the award-winning estate 100 per cent occupied, sustained customer demand is the catalyst for these new development initiatives,” he said.
The $28 million development will include two new industrial facilities and an office building helping to eventually offer employment opportunities to more than 10,000 people.
The industrial developments include a design and build facility for tool specialist, Machinery House, an existing customer at Highbrook whose business growth has necessitated a doubling of its floor space to 4600m².
The second industrial facility is being developed on an uncommitted basis to meet demand. The new 3,400m² warehouse provides another option for mid-sized customers seeking high quality business premises.
The success of the initial development stages of The Crossing precinct and a shortage of available office space at Highbrook spurred the commencement of a new 3140m2 office building.
Located on a high profile site fronting Highbrook Drive, the three-storey office block is already attracting strong customer interest more than 18 months ahead of its expected completion.
Doing businessEast Tamaki has long been a hub of business in the
south-east but, with the opening of Highbrook Drive in 2007, the area has further expanded with Highbrook
Business Park developing into a commercial showcase.
Highbrook Business Park, owned by Goodman Property Trust, consists of 109 ha of developable land and is 60% complete. Photo supplied
RAil PARt oF thE South’S FutuREManukau is no longer a city in its own right, having been amalgamated into the new Auckland SuperCity in 2010 but it remains the gateway to south Auckland and an important retail and commercial hub.
Furthermore with the opening of the new $100 million Manukau Institute of Technology tertiary campus in June 2015, with a new rail station and bus interchange under construction, this central area is expected to become even busier.
In a far-seeing move, the new seven-storey campus building will be integrated with the new Manukau Rail Station, located at basement level of the building, which sits between Hayman Park and Westfield Manukau City.
Commuters who take the stairs or escalators from the station will emerge on a corner of the ground floor, which is designed to be a public space, with retail spaces and cafes.
Importantly, when the train station and a new bus interchange are complete, they will ease congestion on the nearby Southern Motorway, taking pressure off the heavily used Manukau on-ramps to the motorway.
As the southern rail line is gradually upgraded to Papakura, this route is expected to increasingly accommodate commuters.
Whether travelling north or south, the rail line from Britomart, Auckland to Papakura, which also passes through other retail centres such as Sylvia Park and Newmarket, will become an important part of the greater city’s infrastructure, going a long way to easing pressure on south-bound roads.
![Page 11: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/11.jpg)
Design and Build South East — 2015-2016 — 11
The Flat Bush area has a history that dates back to before 850AD when it was known as Pukekiwiriki, so-named after the grandchild of Ruaumoko, the Maori God
of Volcanoes.The name Flat Bush came about in the 1850s,
reflecting how the forest landscape looked from the surrounding hills. It has natural and heritage features important to both Maori and European people which include Te Puke o Tara volcanic cone from where Ngai Tai ancestor, Otara te Irirangi is said to have stood to view the surrounding area.
The cone was quarried through the 20th century and is now in the Greenmount landfill.
Around Otara creek and catchment there are Waahi tapu (sacred sites) and urupa (burial grounds).
The graveyard in St Paul’s Anglican Church (built in 1886) in Chapel Road, includes many early settlers of the area. Flat Bush also has a Methodist cemetery and the original Flat Bush School was built in 1877.
BARRy CuRtiS PARkAt 94 hectares, Barry Curtis Park in Flat Bush is one of New Zealand’s largest public parks, greater than Auckland Domain. The park is being created from
a large parcel of dairy farming land the former Manukau City Council bought from the Anglican Church Trust Board.
The first stage of its development was opened in 2009 and its amenities include an education centre, events venue and large playgrounds.
A multi-sports complex, its premier sports fields and training facilities are used by a wide variety of clubs and teams.
Protecting and conserving wildlife and its habitats has been integral to the park’s development. Barry Curtis Park is the central piece of a ‘green fingers’ network of parks that is being established around 45km of streams and creeks draining the Flat Bush catchment. The ecological system involved consultation with groups such as Forest & Bird and the Auckland Regional Council.
The water systems also work as stormwater ponds, and have been fitted with fish ladders to ensure connected water habitats. The park’s sympathetic development has earned it the ‘outstanding award’ of the New Zealand Recreation Association Awards as well as three awards from the New Zealand Institute of Landscape Architects.
Named after Sir Barry Curtis who served as Mayor of Manukau from 1983 until 2007, the park is expected to be completed in 2022 while the new suburb grows around it.
Sensitive redevelopment of the Flat Bush area sees new housing complemented by a ‘green fingers’ network of
parks built around streams with award-winning Barry Curtis Park central to the community nature of the area.
Rich history
Significant infrastructure including ■■
Barry Curtis Park with skate park facilities, playgrounds, sports fields, the cultural lawn, pathways and riparian planting.
Number of major road upgrades ■■
including Stancombe Road, Flat Bush School Road, Ormiston Road including the gateway Ormiston Bridge.
Four out of eight new schools built.■■
Numerous storm water ponds, flood ■■
land and public open space areas acquired.Approximately 4500 new dwellings ■■
built.Completed planning for stage two ■■
which is under development.Ormiston Town Centre – commenced ■■
development of phase one including supermarket and residential development.
WhAt hAS BEEn DonE in FlAt BuSh
![Page 12: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/12.jpg)
12 — Design and Build South East — 2015-2016
Beachlands was first developed in the 1920s when it was subdivided into 870 sections for mainly weekend baches. It has been growing steadily ever since with
increasing numbers of Aucklanders choosing to live there.
Earmarked as a dormitory town for Auckland’s burgeoning population, the area is in the midst of a 125ha development set to more than double its existing 3800 residents to 10,000.
It’s easy to see why the ‘marine garden suburb’ is so popular. Located on the beautiful Pohutukawa Coast, Beachland’s many coastal resources include Sunkist Bay beach, complete with boat ramp, just two minutes from the town centre.
Five minutes away, at Maraetai, are the district’s best all-tide sandy beaches and two wharves. Between Beachlands and Maraetai is Omana Regional Park with playground, barbecue facilities and incredible views of the Hauraki Gulf and islands.
Five minutes in the other direction is the world class Formosa Auckland Country Club and restaurant with an 18-hole golf course designed by Bob Charles. A separate sports complex has a heated swimming pool, gymnasium, indoor tennis and squash courts.
Adjoining Beachlands is Pine Harbour Marina with full berthing facilities and support services enabling convenient access to the Hauraki Gulf.
Regular passenger ferries go to Auckland and Waiheke Island.
Not surprisingly it’s an increasingly desirable area for people commuting to Auckland City who want to live and raise a family in a rural/coastal environment and extensive new housing is well underway there.
Other attractions include boat clubs in both
Beachlands and Maraetai and a wealth of other sporting clubs and facilities including summer touch rugby, winter rugby, soccer, netball, tennis, horse riding and the award-winning Whitford Forest mountain bike trail.
The Te Puru Sports Complex features floodlit tennis courts, baseball and rugby grounds and skateboarding.
This seaside region, south-east of Auckland City, encompassing Beachlands, Maraetai and beyond has experienced a surge in residential growth. The lifestyle this area
affords is attracting young families and retirees alike.
Pohutukawa Coast
![Page 13: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/13.jpg)
Design and Build South East — 2015-2016 — 13
nAtion gRiPPED By BEAChlAnDS lAnD gRABSuch is the demand for land, with the prospect of quality housing, in the seaside suburbs of Beachlands and Maraetai, that dozens of vehicles queued outside a newly-released Beachlands subdivision in May 2015.
The would-be buyers were hoping to secure one of the 12 Ti Toki Lanes land sections which were made available on a first come, first served basis.
With prices starting at $425,000, the sale captured national media interest as evidence of Auckland’s hot property market.
Beachlands’ Wakelin Bakery owner, Pam Ly was lucky number 12 and the last to secure a plot.
Ms Ly said she had known about the sale for a while as the real estate agent often came to her bakery.
“I didn’t expect to go the day before [the sale] but the agent rang up and told me there was a queue.”
The mother of one took turns queuing with her husband from 3pm so one person could look after their four-year-old son at home.
“I came back at 5.30am in the morning. It was a great experience. It was just nothing like I’ve ever experienced before and it was amazing to be a part of it.”
For five years Ms Ly commuted to Beachlands from her home in Flat Bush and had been intending to move for some time.
Newly engaged Whitford couple Fraser Penning and Mai Castillo, who were number four on the list, had also known about the sale in advance.
“My fiancée’s boss lives in the area and he told us to get down there and get ready for it,” said Mr Penning (27), a software test analyst.
“It was cold but it was nice to talk to all of the other people in the queue. We spent a lot of the time getting to know each other and trying to find out which property they would be in.”
The couple had been looking to buy their first home for more than a year.
“The housing market was moving so quickly, it was outpacing our ability to save,” said Mr Penning.
“This purchase was basically the best way we could see ourselves getting on the property ladder so we jumped at the chance. The stars aligned in terms of making it happen.”
Although more than a quarter of Beachlands’ residents work in the city, the locality also provides opportunities to interact with urban communities in Howick, Botany and Flat Bush, as well as the rural communities of Whitford and Clevedon.
Subdivision of farmland is eventually expected to yield 500 new homes at Pine Harbour with a business zone for a Countdown supermarket due to start construction October 2015 and shopping area at the Beachlands roundabout.
Houses in old Beachlands traditionally range from clifftop mansions to rundown baches on quarter acre sections while the newer areas of Pine Harbour, Spinnaker Bay and Pony Park contain homes on 700sqm with smaller gardens.
The Environment Court is presently considering an application for resource consent for a 160-lot village of 186 household units and apartments, a country pub with 10 guest rooms, a community building, and retail and commercial lots on the site of a 92.8ha cattle farm at Whitford-Maraetai Road.
A surrounding jointly-owned lot contains service facilities, access, an 80-space parking area and native vegetation planting. It directly adjoins the Formosa Country Club and golf course, three kilometres south of Beachlands.
There are plenty of sections for sale in the area including some newly-released 800sqm plots at Marina Heights on Karaka Road which should be ready to build on by the end of the year.
The up-market subdivision at Spinnaker Bay has just released Stages 7 and 8 of this waterview development which is attracting plenty of interest.
Construction has started on eagerly-awaited
apartments at Pine Harbour which offer a choice of two and three bedrooms plus contemporary, open-plan living areas. Pinebrook Estate in Maraetai is a private development, one ridge behind Maraetai Beach.
Sections range from the challenging to more gentle slopes. Several land packages of the 50-lot subdivision are available.
There are still some sections available in the Whitford Village Green development.
And between Whitford and Clevedon lies the 160ha gated estate of Solway at Whitford. A blend of native bush and farmland, all blocks enjoy the seclusion and shelter of native trees, as well as a forest area, walking track and riding trails, all exclusively for the use of residents.
Just 35 lifestyle blocks are being created in the park-like setting. This exclusivity doesn’t come cheap and lots are priced from $650,000. Titles due mid-2015.
These are just some of the new housing developments in the wider area.
Housing in Beachlands and Maraetai is forging ahead; Marina Heights in Beachlands, left, Maraetai Views,
above, and Spinnaker Bay, right – just some of the new subdivisions emerging all over this coastal area.
![Page 14: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/14.jpg)
14 — Design and Build South East — 2015-2016
![Page 15: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/15.jpg)
Design and Build South East — 2015-2016 — 15
A new primary school costing $20 million is to be built to accommodate Takanini’s burgeoning population.
The school will be built on land in Walters Rd and will open for years 1-8 in the first term of 2017.
Education Minister, Hekia Parata says Takanini is a sought-after area because of its special housing areas and private land development and there is a need to cater to the booming school-aged population.
“The new school will be a fantastic addition to Takanini and will ease the pressure that current schools in the area would otherwise face,” she says.
“Nominations are being sought for the school’s establishment board from local colleges, schools, preschools, community boards and education sector representatives.
“The board will play a large role in designing the school and will be responsible for appointing a
foundation principal, determining school policy and governance practices. Most importantly, the board will be responsible for making sure the school reflects the needs and aspirations of the emerging local community and getting the school off to the best start possible,” says Ms Parata.
The Ministry has been driven to build the school by demographic projections that show the school-aged population in Takanini is expected to grow by 4000 by 2020.
Existing schools in the area are close to bursting point. Takanini School’s roll has nearly doubled in the last 14 years from 250 students to 450 today.
Demand for places has meant the school has introduced an enrolment zone to prevent overcrowding. In 2014 a new eight classroom block was completed to meet the demand.
Enrolments for the new school will open in the second half of 2016. There are no immediate plans to build a new secondary school.
One could be forgiven for thinking that the frantic development of southern and eastern parts of Auckland is all about work and not play. But you would be wrong.
The Auckland Plan is committed to creating more sports fields and recreational space for the burgeoning population. Not only do planned new developments incorporate extensive recreation areas in their designs including walking tracks, cycle and bridleways and nature reserves, but existing facilities are being improved and extended.
One such scheme is the 40ha Opaheke Sports Park south of Papakura where eight new sports fields and changing rooms are being built in time for the opening of the 2015/2016 summer’s cricket season (weather permitting). It is also expected to become the home of Papakura Pony Club and will include a large area of reserve set aside for informal recreation.
Its other function will be as ‘transfer fields’ enabling other parks in the Papakura/Drury area to be temporarily closed while they undergo upgrading. Eventually it will become a multisport facility complementing Bruce Pulman Park near Takanini. Some 10ha of land has also been earmarked for a multifunction sports facility in nearby Hingaia.
nEW SPoRtS PARk FoR oPAhEkENew school to
ease squeezeAs community-focused housing developments, such
as Addison (pictured), romp ahead in Takanini more families are embracing the area. To meet subsequent
education needs, a new primary school is in the pipeline.
![Page 16: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/16.jpg)
16 — Design and Build South East — 2015-2016
As Master Builders of Auckland homes we pride ourselves on providing the full service package.We don’t just design and build — we provide advice on sites, architecture, construction
choices and lifestyle, while still accommodating your budget. Located and specialising in South Auckland — we’ll visit your site and start making your dream a reality.
We’re hands on — from the drawing board to completion we work closely with our clients and our sub-contractors.
Call us today 09 524 0779Showhome 169 Porchester Rd, Takanini
Saturday and Sunday 1-4pm or by appointment
CAR0709
Master planned by architectural giants, Jasmax, The Grove has sold out Stage 1 (36 houses) and recently launched Stage 2 (55 houses).
According to Elliot Knight of developers Equinox Group, nearly a third of the Stage 2 homes were sold prior to release. “That was just from people calling up and enquiring,” he says.
The Grove is designed with families and community in mind. House types are a mixture of four and five bedroom homes where a growing family can live comfortably. “The whole development is designed to keep vehicle speed down, an important factor in facilitating community interaction, pedestrian safety and allowing families to get out-and-about safely,” said Elliot.
The Grove will have walking and cycling tracks among each cluster of homes planted throughout with established fruit trees and garden beds.
“Altogether we are planting more than 1000 trees in this 12-acre subdivision, and incorporating soft hedging, flower beds and off-road cycle tracks.”
Bordering Takanini and just two kilometres from Papakura (an easy, flat cycle), the development is semi-rural yet close to Papakura station, bus routes, Southgate shopping centre, Bruce Pullman Recreational Centre and Park and the main arterial routes to Auckland CBD and Hamilton.
“As the second fastest growing region in Auckland, Papakura is a vibrant town,” Elliot says. “With its unique mix of retail and business it offers a diverse environment in which to work, shop and play.”
The Grove’s mix of different dwelling types will provide ample street parking for visitors. Streets are narrow and planted with trees to create a safe and pleasant environment for people to walk and help reduce vehicle speed.
Well-lit and attractively landscaped combined cycle and pedestrian footpaths will reinforce walking and cycling opportunities.
A pocket park at the centre of The Grove will act as a community-focused environment. The park will include a grassed area for recreation, seating areas and feature biodiverse planting.
The plant selection will help to strengthen local ecologies and connections between the coast and lowlands of the Manukau ecological district and the hilly land of the Hunua ecological district.
Elliot says he is especially proud of community ‘pods’ which will be shared by groups of houses. Each house will back onto one of these green pockets ripe with fruit trees, a vege garden and worm farm.
“These pods offer a great balance, bringing a sense of community where people can meet their neighbours and hang out in an evolving space – it’s theirs to grow and explore,” he explains.
“We hope our vision will spread out and lift the entire south Auckland region, creating a neat suburb with decent housing that is used as a platform and base for an aspirational community.”
New housing development, The Grove, on the border of Papakura and Takanini, will see a total of 132 homes built over three stages.
Community key
Papakura district has been welcoming settlers for 150 years and 2015 sees another resurgence of ‘settlers’, people who are finding real housing value both in established and new subdivisions.
With its proud heritage, Papakura is now looking forward to a vibrant future boosted by a growing population and new neighbourhoods including those in Takanini, Karaka Lakes and Drury.
It is at the centre of major population growth and urban expansion in South Auckland, its great location on the Manukau Harbour spurring many people to make it their home. Importantly, there are many pockets of affordable housing which make it attractive to families who now find central Auckland beyond their pocket.
There are plenty of schools to choose from at all levels and the area’s excellent rail and bus links enable students to attend education centres in adjoining areas.
Cultural heritage is celebrated at Papakura Museum, home to a growing collection of photographs, objects and documents which tell the story of Papakura and surrounding districts.
Its art gallery in the refurbished fire station in Averill Street hosts a diverse programme of quality contemporary art exhibitions while The Hawkins Theatre community cinema and performing arts venue has been an essential
part of district for the past 25 years. The centre features everything from local
theatre to touring shows and also hosts a season of films, with a particular focus on New Zealand, overseas festival and arthouse films.
The Market on Broadway takes place every Saturday from 8.30am to 1pm, offering a selection of food, health, beauty, clothing, arts and gifts, and entertainment for the whole family.
On-going revitalisation of the town centre is aimed at creating an ‘avenue of culture’ in the heart of Papakura, linking the museum, library and arts centre.
Whichever way you look, Papakura and its surrounding area is THE place to live, work and play.
Vibrant futureBruce Pullman Park – a unique international sports recreation and function facility – just minutes from The Grove.
![Page 17: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/17.jpg)
Design and Build South East — 2015-2016 — 17
As Master Builders of Auckland homes we pride ourselves on providing the full service package.We don’t just design and build — we provide advice on sites, architecture, construction
choices and lifestyle, while still accommodating your budget. Located and specialising in South Auckland — we’ll visit your site and start making your dream a reality.
We’re hands on — from the drawing board to completion we work closely with our clients and our sub-contractors.
Call us today 09 524 0779Showhome 169 Porchester Rd, Takanini
Saturday and Sunday 1-4pm or by appointment
CAR0709
![Page 18: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/18.jpg)
18 — Design and Build South East — 2015-2016
CAR0728
![Page 19: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/19.jpg)
Design and Build South East — 2015-2016 — 19
Building a new home is an intensely personal journey, so when you deal with Frame Homes, you deal directly with the man responsible for building your home.
Mark Frame is an award-winning master builder renowned for his personal approach to the building process. With more than 17 years experience you have his assurance of quality and expertise from the day you decide to build, to the day your dream home becomes a reality.
Experts in all aspects of the building process, Frame Homes will ensure your new home is built to exacting standards. By using only the best materials and utilising modern methods your home will be eco-friendly and energy efficient. Repeat recipients of multiple Master Builders Home of the Year Awards, Frame Homes are on centre stage in professional design and build.
Considered design, timeless lines, lifestyle-friendly layouts and cutting edge, modern finishes are characteristics of a Frame Home. Homes that are not only functional and easy to live in, but also exude a real presence and are complemented by beautiful design and immaculate finishing.
Frame Homes can build your new home to your plans. Or, you may choose to build from one of their existing plans – to which you can add your own personal touch. With a talented team of designers, Frame Homes can design and build your dream home.
With a brand new show home open to view, together with available house and land packages, there is no better time than now to give Frame Homes a call to discuss your new home requirements.Contact Frame Homes, phone 09 524 0779.Show Home: 169 Porchester Rd, Takanini – Saturday & Sunday 1-4pm or by [email protected]
Design and build excellence
If you are embarking on the building process and have felt overwhelmed by the massive number of building companies to choose from, or had a burning question you wanted
to ask a reputable builder, you are probably not alone.
Horncastle Homes Auckland manager, Murray Stiven shares valuable information on how to choose a builder and what to look out for.
Researching the shortlist of building companies is the best approach.
Talk to recent customers that have built and don’t be afraid to ask the builder for names of recent customers for you to talk to.
Before you sign with a builder, confirm that the agreement includes a full specification of what is included and make sure that it is a true fixed priced agreement. Check for hidden costs.
A reputable building company will also be transparent on costs so the customer has a clear understanding of what they will get for their building budget.
Ask for a clear outline of build times, who and how your build will be managed and check the experience of your project manager.
Ask for evidence of their build warranty and what is included and how any maintenance issues will be managed and for what period.
Take independent advice before signing.If you are after some sound advice on building
a new home, don’t hesitate to give the Horncastle Homes team a call.
With more than 20 years experience, Horncastle Homes is a privately owned, residential building company that has been active in the
Auckland market for the past four years with a number of projects underway on the North Shore, in Pukekohe and Pokeno.Horncastle Homes, phone 09 959 0152. www.horncastle.co.nz
Horncastle Homes wise advice
![Page 20: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/20.jpg)
20 — Design and Build South East — 2015-2016
NEW SHOW HOME OPEN212 Great South Road Takanini
Like us onFacebookLike us onFacebook
2014
The team at Ultrawood Homes invite you toexperience our Lockwood Skagen show homeat 212 Great South Road, Takanini.
As your local Lockwood Authorised Builder, Ultrawood Homes is committed to the key values that have helped to build Lockwood’s unparalleled reputation over the past 60 years – consistency, quality, innovation, sustainability and reliability.
Bob and Richard at Ultrawood Homes have built more than 300 Lockwood homes, and they are on hand to talk to you about your dreams and ideas, and the best way to build a new home for you, ready for a lifetime of memories.
Like us onFacebookLike us onFacebook
Be one of the fi rst to experiencethe brand new Skagen design!
Open 10am-4pm Weekdays1pm-4pm Weekends
Ultrawood Homes
09 299 [email protected] lockwood.co.nz
r100092
While some people can’t see the wood for the trees that can’t be said of Lockwood homeowners.
They know that wood is good – as do most people of the land – so much so that Lockwood was voted the 2014 most trusted home builder in New Zealand by Reader’s Digest.
Every year, Reader’s Digest conducts a ‘New Zealand’s Most Trusted’ survey, with the aim of uncovering Kiwi attitudes on the most trustworthy professions, people and brands.
Lockwood took the accolade for the second year running, putting it alongside other ‘Most Trusted’ category winners Whittakers, Kiwibank, Kenwood and Sony.
The category was created in 2013 as a response to the many issues that the building industry had faced in recent years and to acknowledge the importance of trust to the consumer when making purchase decisions.
Son of the founder and current CEO Joe La Grouw Jnr said of the win that it was a huge accolade for the company and gave great pride to the Lockwood team and its network of builders and homeowners nationwide.
The award continued the many accolades for Lockwood, including a gold award at the Registered Master Builder House of the Year Awards 2013 and becoming the first company to achieve the new CodeMark for its patented complete wall system.
“The CodeMark was not only a recognition of the company’s devotion to excellence, it was a challenge to us to keep improving our systems, our design and our relationship with our franchised builders throughout the country,” Mr La Grouw said.
“Lockwood is a precision engineered system that has been proven in all kinds of situations over 62 years, standing up exceptionally well
to cyclones, earthquakes and all kinds of environmental challenges.”
Mr La Grouw said that other important features such as the Sustainable Forests certification showed that Lockwood had its eye firmly on the future.
To learn more about Lockwood Homes visit Ultrawood Homes new showhome at 212 Great South Road, Takanini.
Lockwood earns public’s trust
![Page 21: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/21.jpg)
Design and Build South East — 2015-2016 — 21
Changing land use, population growth and planned housing developments are adding pressure on transport infrastructure in south Auckland.
Traffic delays have become an accepted norm of the daily commute but there is a (green) light on the horizon to ease congestion.
Planning is well underway to turn Mill Road (and the accompanying corridor north and south of it) into a virtual four-lane highway to act as a south-east alternative and bypass to the Southern Motorway.
The project will help ease bottlenecks on the motorway at Manukau, Hill Road and Takanini and discourage rat-running along Mill Road.
Auckland Transport has applied to designate a route for the northern section, where traffic is predicted to double. Planning is continuing on the southern section to Papakura and Drury.
Predictions are that traffic volumes will increase to such an extent that the current Redoubt and Mill Roads will be unable to cope.
This is based on the planned 10,000 new houses to be built in the southern parts of Auckland, including 4,470 houses in Flat Bush, and 1,770 houses in Takanini.
A further 12,000-14,000 houses are expected to be constructed in the Takanini, Opaheke, Drury
and Karaka future urban zone under the proposed Auckland Unitary Plan not to mention other new housing developments further south in the Franklin district, from where many new resdients will also need to commute using the Southern Motorway.
New industrial areas in Takanini and Drury south will create 6000 new jobs and add to congestion.
Auckland Transport Project Director Theunis van Schalkwyk says that the project is driven both by significant growth planned for the area and a need to improve poor road safety records.
“Congestion is already affecting Redoubt Road and Mill Road. The large number of new houses will lead to traffic doubling in 10 to 15 years, meaning the road won’t cope without a major upgrade,” Mr van Schalkwyk says.
“Between 2009 and 2013 there were 283 crashes, including four deaths, with a number of accident hotspots on curves and junctions. The upgrade will improve the alignment to the safety standard required on an arterial route.
“With growth happening quickly in the area we need to give certainty to both existing and future property owners as to what land is needed for the upgrade. New housing areas can then be built knowing where the transport infrastructure to support it will be.”
Auckland Transport will upgrade the corridor in two phases with the northern Redoubt Road-Mill Road corridor section now going through the notice of requirement/designation process.
This part of the Mill Road project covers the 8.9km section of the Redoubt Road-Mill Road corridor starting at SH1 on and off ramps on Redoubt Road running east, then south along Redoubt Road to the Redoubt Road/Mill Road intersection.
From here, the corridor continues south along Mill Road, ending south of Alfriston Road near the intersection of Mill Road and Popes Road.
It also includes a short section along Hollyford Drive to the north of Redoubt Road – heavily used by motorists accessing the Manukau onramp to the Southern Motorway – and a portion of Murphys Road from a new intersection on Redoubt Road to Flat Bush School Road.
However, the southern section of the project is still in the planning stage and the finalisation of the route will depend on the timing of release of land for housing in the Opaheke area, which could be more than 10 years away.
Accordingly there is no intention to finalise or designate a route in the Papakura/Drury area until more certainty exists regarding potential land release for development.
Easing congestionOnce a quiet country road, Mill Road, running from Redoubt Rd through Alfriston to the back of Takanini is set to become a four-lane highway which will hopefully divert
some south-bound traffic away from the heavily used Southern Motorway.
![Page 22: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/22.jpg)
22 — Design and Build South East — 2015-2016
In a world of ever changing values, there are still some things to be relied on. One of these is that Resene Construction Systems will continue striving to produce
the most innovative, performance-based coatings and facade systems whilst maintaining environmental awareness, benchmarked against the New Zealand building code and international standards.
This article aims to provide some clarity as to where external plaster facade systems and external facades/claddings are today compared with 10 years ago.
Much has been said about historical
construction practices which should not be compared to construction practices of the past 10 years.
Over the years, development and technology for external facade or cladding systems has changed. This change was driven by issues related across the construction industry including design and architecture, construction practices, product performance, trade co-ordination and workmanship.
No one issue was to blame, rather a culmination of events and practices that essentially revolutionised how we detail and construct residential buildings in New Zealand today. The
Top performing BRANZ-appraised and weather-tight tested, the Resene
Construction Systems range of plaster facades, and finishing systems adds stunning style and durability to
new and existing homes. Here Mike Olds talks about the impact of modern technology and plaster facades.
INTEGRA Lightweight Concrete Facade
![Page 23: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/23.jpg)
Design and Build South East — 2015-2016 — 23
issues culminated in the generic term ‘weather-tightness’.
Post 2005 it became the norm for most external claddings to have a cavity. Plaster facade systems were no exception.
A cavity, for all intents and purposes, is an air gap between the back face of the cladding and the structure. Generally, a minimum 20mm space is provided between the framing and the back of the facade/cladding system. This allows for any incidental moisture to drain away, in turn providing a redundancy mechanism should moisture entry occur.
Without digressing too deeply into pressure equalisation, and the like, many facades like ours are tested to prove compliance with the performance requirements of the New Zealand Building Code.
This testing of residential external facades is completed in a weather-tightness chamber and one of the tests involves drilling holes through the finished cladding during the wet testing to ensure not ‘one’ drop of moisture crosses to the structure.
As I am confident not everyone goes around drilling holes through critical connections in the cladding, this may sound like an odd test.
But, this testing provides confidence that if small holes occur for whatever reason then the system can cope and perform as intended.
Resene is renowned for its professional paint and colour systems and now the Resene Construction Systems division offers premium ROCKCOTE & PSL (Plaster Systems) light and medium weight plaster facade systems, such as INTEGRA lightweight concrete façade and GRAPHEX insulated façade systems.
All of these are fully BRANZ-appraised and weather-tight tested.
Alongside this, Resene provides its own documented and comprehensive “On Site Assistance” programme, which is mandatory to each and every project nationally.
This OnSite Assistance programme was introduced 10 years ago to provide surety of system installation. It was, and is, a dynamic and innovative approach for the construction sector.
No other business in the plaster facade industry stands beside the installation with dedicated support as we do.
We take the OnSite Assistance programme one step further by undertaking a further complimentary project review two years after our guarantees have been issued to ensure our products and systems are performing as intended. This also gives us the opportunity to discuss the system with our clients and how best to look after it.
This sets the benchmark for the industry, giving protection to both the reputation of their products and most importantly to their clients’ most important investment – their home.
premium plaster facades
Call Resene Construction’s friendly team on 0800 50 70 40 to discover how they can assist you with your next project. www.reseneconstruction.co.nz
INTEGRA Lightweight Concrete Facade ROCKCOTE Marrakesh Tadelakt Plaster Masonry Plaster System
GRAPHEX Insulated Facade – RenovationMILANO Polished Interior Plaster
![Page 24: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/24.jpg)
24 — Design and Build South East — 2015-2016
Synonymous with exterior rendered facades, Sto is a company with worldwide experience in exterior renders and facades, that has built a reputation for delivering
rendered facade systems. Detailed and reinforced with cement-free organic renders; optimised over 50 years with seven different coloured finishes that, when integrated with StoArmat, provide a 4mm flexible, crack resistant, breathable, yet totally weathertight render system which surpasses the durability requirements.
With an increasing emphasis on the implementation of servicing exterior building elements, Sto has now launched the StoArmat 20+ year Warranty and StoService Assurance documentation. The system, administered by Sto and carried out by Sto Contractors, ensures all specified Sto rendered systems are registered, serviced and certified every 2½ years to provide assurance that all the building elements, pertaining to the rendered facade, are performing.
Building on the Sto partnership, this new
system ensures that the specifier, client, property owner and Sto Contractor are assured long-term that the facade’s performance criteria is maintained and regularly certified.
Sto, your partner for a secure future – www.sto.co.nz or call 04 801 7794
Rendered facadescreate exterior excellence
Architecture comprises multiple elements that define a building’s functionality and sustainability. Therefore, today’s architect is confronted with assembling an array of building components to deliver an exterior that is compliant, watertight and durable.
Above: StoArmat Render System. Left: Residential home, Architect; Stonewood Homes. Below: Thomas St Building, UTS, Architect; Durbach Block Jaggers.
SC3434
![Page 25: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/25.jpg)
Design and Build South East — 2015-2016 — 25
R20180
![Page 26: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/26.jpg)
26 — Design and Build South East — 2015-2016
Defi ned as the AMETI area and encompassing the suburbs of Panmure, Mt Wellington, Sylvia Park, Pakuranga, Howick and Botany, it has some of
the highest traffi c fl ows and greatest levels of congesti on anywhere in the country.
The two bridges across the Tamaki River carry more than 120,000 vehicles a day, more than State Hwy 1 through Victoria Park. They also have more freight traffi c than any other corridor in the country.
If that doesn’t stop you in your tracks catching a bus won’t help with ti me management. Public transport is a poor opti on because buses also get caught in traffi c jams.
And if you fancy using shank’s pony or mounti ng your bike to make your way around the district, think again. It also has some of the worst conditi ons for walking and cycling in Auckland. But not for much longer.
With the local populati on expected to grow by 20,000-25,000 over the next 20 years, pressure on improving the transport system is acute.
Auckland Council’s response has been to create the Auckland Manukau Eastern Transport Initi ati ve (AMETI), a group of projects which will improve transport choices and connecti ons in the area.
This is to be achieved by improving public transport, walking and cycling faciliti es and reducing traffi c congesti on.
Other major aims are to create jobs by unlocking the economic potenti al of the area
through improved transport for freight and business traffi c.
The main AMETI projects are:An urban busway on congesti on-free lanes ■■
between Panmure, Pakuranga and Botany town centres
New stati ons at Panmure (train/bus opened ■■
November 2014) and Pakuranga town centre (bus)Roading improvements at traffi c bott lenecks, ■■
including a new north-south Panmure road, a proposed Reeves Road fl yover in Pakuranga (now postponed) and replacing the Panmure roundabout with traffi c lights.
The fi rst project in Panmure is complete and features safer walking and cycling routes, with cycle parking at the upgraded Panmure train and bus stati on. Commuters can now enjoy easy transfer between buses and trains with shelter along the majority of Panmure Stati on platf orms.
The next project, Stage 2 from Panmure to Pakuranga is due to begin constructi on in 2017. It will include the constructi on of New Zealand’s fi rst urban busway with buses travelling on their own congesti on-free lanes, separate from general traffi c, between Panmure and Pakuranga town centre.
Benefi ts to travellers will be faster, frequent and more reliable bus journeys on congesti on-free lanes. Buses will run every fi ve to 10 minutes with connecti ons to Panmure Rail Stati on and to the wider network. A new safer cycle and pedestrian link will be completed between Panmure and Pakuranga.
Plans move into top gear
City oF SAilS toPS Big APPlE in CAR SuRvEyTo hapless drivers trying to get to work each day, it will come as no surprise that Auckland is one of the world’s most traffi c-clogged citi es.
And the south eastern suburbs encompassing Botany, Howick, Pakuranga, Sylvia Park, Mt Wellington and Panmure have some of the highest traffi c fl ows and greatest levels of congesti on anywhere in Auckland.
In a survey from 138 citi es in six conti nents, vehicle navigati on fi rm, TomTom found Auckland to be the world’s 22nd most congested city.
Amazingly, that’s far worse than New York City (populati on just short of nine million) which ranked at 39th.
The survey found Auckland drivers took an average of 29 per cent longer to complete trips than if the roads were free-fl owing.
During morning rush hour that translates to 38 minutes sitti ng in a traffi c jam for every hour spent in a car.
TomTom said that amounted to 89 hours of delays a year for drivers who take 30 minutes to get to or from work. Only Sydney is more congested among Australasian citi es.
The worst ti mes to travel in Auckland are Tuesday mornings, with congesti on rising to more than 85 per cent when compared to non-peak ti mes.
Commuters travelling in peak hour traffi c have the best run on either a Friday morning or a Monday evening where congesti on levels are lower at 60%.
Heavy traffi c, tailbacks and long travel times are undoubtedly one of the downsides of living in Auckland’s
south eastern districts.
![Page 27: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/27.jpg)
Design and Build South East — 2015-2016 — 27
Major new public transport improvements will arrive earlier for people in Auckland’s south east.
Auckland Transport is aiming to open the full South-Eastern Busway to Botany sooner than the 2028 completion date earlier proposed and is looking into extending bus lanes to Highland Park.
When completed catching the bus and train between Botany and Britomart will be 17 minutes quicker and take just 38 minutes.
That’s great news to the burgeoning numbers of commuters from the area to the CBD who are predicted to make more than 7 million trips a year on completion. This is because transport chiefs say the busway can operate through Pakuranga town centre without the need to build Reeves Road flyover first. This will allow funding to be used to deliver more public transport improvements sooner by deferring the $170 million flyover until next decade.
Targeted traffic improvements will also be made to relieve congestion at the intersections of Ti Rakau Drive/Pakuranga Road and Ti Rakau Drive/Reeves Road.
Auckland Transport AMETI Programme Director, Peter King, says the change means better transport choices for people in the area sooner and supports the roll out of the new public transport network in 2016.
“The recent decision on the Basin Reserve flyover in Wellington shows the challenges of consenting a flyover that has impact on an urban area and the potential for long delays.
“This decision allows us to extend the AMETI transport improvements made in Panmure to Pakuranga and Botany as soon as possible while continuing to build the case for the flyover.
“Large numbers of passengers are expected to be attracted by quicker, frequent and more reliable bus journeys on lanes separate to traffic. About 7.4 million trips a year are expected on the busway.
“There are time savings from opening the busway between Panmure and Pakuranga, however they are much greater when the full busway to Botany is open. For example catching the bus and train between Botany and Britomart will take 38 minutes, 17 minutes quicker [than the present journey].
“The change to timing reflects Auckland Transport’s prioritisation of rapid, high frequency public transport and will not require extra funding.”
Work to develop the flyover showed its congestion benefits would be limited until further significant investment along the South-Eastern Highway. It also indicated a likely increase in costs with the need to create a quality urban environment beneath it.
The Panmure to Pakuranga projects include:Replacing Panmure roundabout with an ■■
intersection with traffic lights and more direct pedestrian crossings
Panmure to Pakuranga busway on lanes ■■
separate to traffic congestionPanmure to Pakuranga shared cycle/footpath ■■
separate to trafficSecond Panmure Bridge for busway and shared ■■
path.
RoADWoRkS to MAkE RoADS WoRkKeeping traffic flowing in one of the country’s busiest areas is no mean feat.
Whilst a traffic jam-free world is probably too big an ask, the council has several projects up its sleeve to improve movement around the south eastern suburbs.
These include:Improved South-Eastern Highway and ■■
East-West connections to State Highway 1New Sylvia Park bus interchange and ■■
route improvementsExtension of new AMETI road to Merton ■■
RoadNew Quarry Link Road (linking Stonefields ■■
and Pilkington Road)Roading improvements will focus on key
congestion points such as Panmure town centre and the Ti Rakau Drive/Reeves Road/South-Eastern Highway (SEART) intersection while Waipuna Bridge and the South-Eastern Highway are earmarked to become the primary route for through traffic to Auckland central and freight and business traffic.
Ultimately an urban busway will transport passengers on congestion-free lanes between Panmure, Pakuranga and Botany town centres. Cycle lanes will be built on Ellerslie-Panmure Highway (Mt Wellington Highway to Queens Road) and a new shared path for cyclists and pedestrians runs alongside the new Te Horeta Road.
Ticket to ride promise for commuters
Construction of a busway from the Pakuranga town centre to Botany has been brought forward. Image supplied
![Page 28: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/28.jpg)
With multiple gold awards, category wins and national wins at the Registered Master Builders’ House of the Year Awards, it’s obvious
that Ascension Homes, with more than 30 years of experience, is at the top of its game in the home building industry.
This is further endorsed by the company’s use of top-quality materials, its unequalled workmanship, impressive designs and personal service to create homes that are built to endure.
Every detail of your new home is carefully considered – materials, finish, space, light, position, comfort and warmth.
“We build each home to the same high level no matter what the budget,” says Allan Austen who runs Ascension Homes with his wife Lee.
Lee says the Ascension Homes team works well together, with each person bringing different strengths to every job.
It all starts with Michael Blackwood and Star Potgieter the Ascension team’s new home consultants who are at the coal face, helping clients at the initial stage of the journey.
Allan, the company director, oversees all Ascension projects including design, pricing, ordering of materials and structure of build time frames.
Lee, the business manager, is in her element sitting down with clients, choosing colours and finalising kitchen designs.
Ray Broad, the project manager, visits sites daily to ensure the expected standard and timelines are met.
Amy Hollis, Ascension Homes office administrator, is the friendly face behind the reception at the office and liaises with clients regarding their build project.
Together, the Ascension Homes team ensures the building of your new home is a stress-free experience.
“We at Ascension Homes realise that choosing a new house means more than a roof and four walls,” says Lee. “Your house is your home, and a home
is about family. A house becomes a home when memories are created and families grow.
“The Ascension Homes team’s dedication ensures the building of your new home is a stress free experience.
“Whether it is a house and land package, your land/our house plan or a design and build, our consultants will share your ideas, needs and tastes to make your home a place where you love where you live.”
Ascension Homes– a winning choice
koWhAi DoWnS PokEnoWe’ve all heard the media hype re Pokeno and the value for money it offers over and above Auckland and, yes, it’s true. Well, Ascension Homes have gone one step further and secured sites in a brand new Pokeno subdivision known as ‘Kowhai Downs’.
Looking for that ‘bigger’ section, a bigger home, and enough garaging to house the hobbies? Kowhai Downs offers all this and so much more.
The first step in establishing your piece of paradise is to visit our gorgeous show home situated at 1 Pyne Cres, Pokeno and let’s discuss how we can help you realise the dream – a dream which is outstanding value based on what’s happening in neighbouring Auckland.
Bigger home, bigger section, room for kids to be kids (or grandkids, as the case may be) and last, but not least, the lifestyle you deserve. The waiting is over – let’s chat. Happy to answer questions at anytime, in person, by phone, text or email.
Call Ascension Homes on 0800-111-696 or 09-222-0096 to discuss your new home ideas; or visit the showhome at 1 Pyne Crescent, Pokeno, open 7 days 11am-4pm.
Timeless timberThe warmth of wood has long made it a flooring favourite but perhaps more so than ever, New Zealand homes are featuring timber underfoot.
In renovating older homes, many owners are stripping away carpets to reveal beautiful rimu or kauri floorboards and are opting to restore these for a new polished effect. By adding a rug or two the look is complete.
Equally, those building new are examining various timber-look options and are keen to explore the possibilities for texture, colour and detail without sacrificing durability, style, quality and ease of care.
However, there are a multitude of choices so, do your homework. Firstly, consider whether you want all wood, engineered timber or a laminate; then consider ceramic tiles, slate, or natural stone, sheet vinyl, vinyl planking, carpet, rugs, cork, parquet, bamboo….rule out what least appeals.
Also, remember that choosing your flooring materials doesn’t have to be a chore; the whole exercise can be an exciting adventure.
If at the end of the day it’s the richness of wood you really want think in terms of solid timber, engineered timber (real wood veneer over a sustainable backing and locking system), bamboo and laminates.
New technology means both solid and engineered timbers have become easier and less time-consuming to lay with many options pre-finished.
Inter-locking plank systems are another advantage across the range of timbers and laminates.
Some timber-look options are particularly family-friendly being impact-absorbing and warm with resistance to scratching and fading – great when the floor has to contend with children and pets.
Whether re-polishing existing floorboards or installing a new floor be sure to speak to the experts first.
Contact a company that deals in your preferred option.
Ask about suitability for different rooms of the house (wet areas in particular; remember wood and water don’t mix)) and seek advice regarding on-going care and cleaning.
Think about colour – there are so many choices – and consider the width of planks. New, wider planks are extremely popular at present. Importantly, think about your lifestyle and the local climate too.
Once you have all the facts and all the options in front of you, then choosing your timber or wood-look floor will be easy.
28 — Design and Build South East — 2015-2016
![Page 29: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/29.jpg)
Design and Build South East — 2015-2016 — 29
KAT3924
![Page 30: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/30.jpg)
30 — Design and Build South East — 2015-2016
With a population of 130,000, Howick Ward is the fifth largest urban area in New Zealand. Its population (which includes the surrounding
districts of Pakuranga, Botany, Flat Bush and East Tamaki) increased by 13,600 or 12 per cent in the 2013 census. More and more people from a wide range of cultures are coming to live within its boundaries to raise their families.
The last census identified that in the local board area more than 50 per cent of residents are European and 38 per cent are Asian, with Chinese the largest sub group.
Nearly 10 per cent of residents identified as
Indian, followed by people from the Philippines. There was a small increase in the number of Maori and Pacific people coming to live in Howick.
In common with the national trend, its residents are also getting older. The number of older people (aged 65 and over) rose by 37.8 per cent at the last census.
living in hoWiCk iS A nAtuRAl ChoiCEHowick has a wide variety of natural features including beaches, volcanic cones, reserves, parks and open spaces and waterways.
A heritage plan is being drawn up to guide the identity, preservation and protection of geological and archaeological sites. It will include important local landmarks such as the Maori Pa at Musick Point (Te Naupata) and Pigeon Mountain (Ohuiarangi).
The Mangemangeroa Valley, Point View and Murphy’s Bush Reserves provide habitats for birds, invertebrates and potentially lizards in an urban landscape.
An environmental education centre at Mangemangeroa Reserve is underway. The vision for the centre is a place to foster environmental learning and research.
Howick – star of the east
Ferry services from Half Moon Bay to downtown Auckland and also to Waiheke Island are well used by eastern commuters and now, a new Half Moon Bay ferry wharf, will provide passengers with more shelter and improved access to buses.
The $4.3 million project includes a proposed covered pontoon and wharf at the end of Ara-Tai Drive, south of the existing passenger ferry pontoon. Also proposed, subject to funding, is improved and safer access to buses, with sheltered stops in the same location.
The new facility, a joint project between Howick Local Board and Auckland Transport, will be similar in design to the Hobsonville Point Wharf.
About 1500 passengers a day use the current facility with ferry services expected to begin from the upgraded facility in late 2016.
Howick Local Board chair, David Collings says ferry users have waited a long time for improvements.
“This will deliver a facility that will protect them from the weather and will also be of a very high quality.
“A quality Half Moon Bay ferry facility is one of the board’s top priorities. We’ve been very prudent with our allocation of Auckland Transport’s Capital Fund so we can now direct up to $2.5 million to help make the project happen.”
Auckland Transport project director, Nick Seymour says the new wharf will have much better shelter for passengers with the walkway and pontoon boarding area both covered.
“It will also be more accessible for people who are mobility-impaired and will provide
improved safety for people getting on and off ferries.
“The new facility will be purpose-built for passengers, providing a transport hub with bus and ferry services located together.”
Construction is expected to begin in early 2016, subject to consents. A fixed walkway will be built before a pre-manufactured pontoon and gangway are floated in.
nEW FERRy WhARF FoR hAlF Moon BAy
![Page 31: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/31.jpg)
Design and Build South East — 2015-2016 — 31
Stone is always a durable and stylish option when selecting cladding for a home, carrying out landscaping or tackling a commercial project, indoors or out.
Craftstone is made from only genuine quarried stone, not fake-looking coloured concrete, and is, by its very nature, far more durable than imitation products.
Additionally, in most cases Craftstone is around half the price of traditional whole schist applications and is faster to lay with far less wastage which saves both time and money.
Craftstone is also considered an environmentally-friendly alternative to traditional, full thickness stone applications. Due to its thickness, every ton of full thickness stone will cover only 3-4m2 of walling, whereas the same weight of Craftstone will cover 16-20m2.
This means the resource is managed in a much more sustainable manner. Furthermore, freight to site is correspondingly far cheaper with Craftstone due to the reduced weight being transported.
Use of stone is also proven to add value to any project. When renovating, it has been shown that adding a stone feature such as an entry wall, column or, perhaps, cladding a boundary wall in stone will increase the value of the property far in excess of the cost of doing so.
It may be as little as one of Craftstone’s modular real stone letter boxes that will add the street appeal needed for a property to stand out from the crowd.
If you are considering recladding why not take the chance to upgrade to a real stone finish? In Auckland, the Craftstone system is mandatory for stone reclads according to Auckland Council. They do not accept any other stone system for reclads and will knock back applications that do not specify Craftstone. From this you can see the regard Auckland Council has for Craftstone.
This is because of the standard and extent of rigorous testing that has been applied to the system, and the fact that the company has the history to back it up. We have developed and tested our system and products to ensure public safety and so the integrity of the system will stand the test of time.
Craftstone meets the weather-tightness requirements of E2/VM1 testing and during installation Craftstone is finished with Craftseal sealer for long term waterproofing protection.
And because any job is only as good as the installation, Craftstone should be applied by Craftstone’s network of fully licensed, trained and approved contractors.
Producer statements and workmanship guarantees are provided.
Unfortunately, there are a number of fly-by-night companies that will try to sell stone that has not been tested and which has no installation system or non-compliant systems.
Be warned, too, tile adhesive or site-mixed
sand and cement is not suitable for stone veneer applications. Council is committed to shutting down cowboy installers but inevitably some will slip through the cracks.
So, be sure to deal with a reputable company that has done the hard yards, has completed a recognised NZ testing programme such as BRANZ, and can show full building code compliance.
Don’t be tempted by fast talkers and deals that are too good to be true. It never ends well.
Craftstone is available nationwide and comes in a variety of options, colours and textures to suit any requirement including Schist Clad, Schist Clad Panels, Feature Schist Panels, Crazy Pave Mats, modular Column Blox, Letter Blox and capstones.
Craftstone rocks!Real Stone. Not Fake. Craftstone is New Zealand’s only BRANZ-appraised real stone
veneer – beautiful and cost-effective real stone cladding. Why settle for less?
Craftstone products are available through selected building supplies merchants nationwide or from your local Craftstone agent. For information on your nearest agent, or to request a free quote or estimate phone 0800 63 8899 or visit www.craftstone.co.nz
![Page 32: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/32.jpg)
32 — Design and Build South East — 2015-2016
KW0396
KW0396.indd 1 19/06/2015 10:15:41 a.m.
![Page 33: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/33.jpg)
Design and Build South East — 2015-2016 — 33
Thanks to the craftsmanship of ProBuilt Village Stone, creating a one of a kind landscape or feature with top quality, New Zealand-made products, is entirely
possible.Stone remains a popular choice for its aesthetic
appeal, ability to blend in with the natural environment as well as hard-wearing, durable qualities.
It can add value to properties, strengthen structures, and in the case of paving, offer a safer, more practical surface.
Delivering outstanding results in areas such as entrance and retaining walls, pillars, cladding, paving, as well as letterboxes, ProBuilt offers a full, professional installation service and conducts on-site consultations.
Here are some points to consider when planning a project:
EntRAnCE WAllSWhat is the height, length and width?■■
Will it be single or double sided, curved or ■■
straight? Will there be entry gates and will they require ■■
automation?What is the foundation structure?■■
PillARS It is best to plan before construction ■■
commences Pillars can hang on entry pillars with or without ■■
support entry wallingGeneral sizes are between 450mm and 600mm■■
ClADDing Can be used on new or existing structures ■■
– wrapping entire buildings, pillars, water features, fireplaces and feature walls Some surfaces may need to be altered to meet ■■
weather tightness rules Choose from four different cladding options to ■■
meet style preferences
PAving Rough texture is safer than conventional ■■
smooth pavingSizes from 600x600 to 300x300■■
Smooth or rolled edges■■
Great alternative for creative finishes■■
REtAining WAllSEasy to lay■■
Good foundations essential■■
Capped and grouted to finish■■
lEttERBoxES Choose from easy to assemble package for ■■
DIYers or full installation service450mm x 450mm■■
Various mail inserts provided■■
ProBuilt Village Stone only uses expert, qualified builders and has carried out a range of projects from small residential jobs to large commercial applications.
Approachable and keeping clients informed every step of the way, the ProBuilt team is committed to excellence.
Set in stoneWhen it comes to creating strength, beauty, and versatility for the outdoors,
homeowners can rest on the solid foundations of stone.
Q: What is the weight of each walling block?A: 16 kgs. Village Stone is one of the strongest blocks available on the market.Q: How many walling blocks per sqm?A: 13.Q: What is the difference between Village Stone and Stone Cladding?A: Village Stone is a construction block as opposed to the stone cladding that is a veneer adhered onto an existing surface. It is installed as a brick would be, the difference being the
foundation requirements differ, and no backing board is required.Q: Will the colour fade?A: The colouring system will ensure that the colour is permanent. Natural aging will occur over time.Q: When is the best time to contact ProBuilt Village Stone about your options?A: Call at the outset of your project; the team can often work with you to save time and money by planning well from the start.
For lasting landscaping solutions, call Shane on 027 242 9740, phone 0800 ProBuilt or visit www.probuilt.co.nz today! Showroom: 462 union Rd, Patumahoe
FREquEntly ASkED quEStionS
![Page 34: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/34.jpg)
34 — Design and Build South East — 2015-2016
Close neighboursMany housing developments are trending towards terraced living or apartments with shared green spaces. When well planned and built from quality materials the
result is supportive and often secure communities.
34 — Design and Build South East — 2015-2016
As demand for housing increases and the size of secti ons grow smaller, as well as dearer, more townhouses, apartments and terraced houses are being built.
They are popular not only because they are oft en aff ordable but because today’s busy families have less ti me and less inclinati on to spend precious leisure hours caring for lawns and gardens.
However, if opti ng for an apartment or adjoined terraced house there are some special concerns to consider. Firstly – do they receive sunlight, do they have an outlook, are there building plans that could block outlook or sunshine? Importantly, is there an elevator (where applicable) especially if you need to transport furniture up several storeys?
If the apartment has its own laundry check whether there are rules about drying clothes on the balcony (if there is one) and what other faciliti es, such as a gym or swimming pool, are in the complex?
If the physical faciliti es suit, there are other matt ers to take into account. For example, who is responsible for maintenance of any common areas and is there an acti ve body corporate and/or maintenance fund. Does the complex have a permanent building manager on-site or on-call?
Check out annual body corporate fees and ask about body corporate rules. It’s important to establish whether you pay for maintenance of your own unit or for other major maintenance work such as painti ng or whether this is all covered by the body corporate.
Most new apartment blocks or terraced houses are fairly noise-proof but living in close proximity
to a lot of other people can sti ll pose problems. Ask about anti -noise conditi ons.
As many such dwellings are rented also be sure you are comfortable with a changing parade of neighbours and take into considerati on that some neighbours could lower the value of your place.
Check whether there is car parking and security measures such as CTC cameras. Walk the neighbourhood to see how close it is to shops, cafes and nightlife. Any or all of these will impact on your lifestyle.
Do your research – these are just a few
items to consider; there are many more such as constructi on materials and mortgage restricti ons.
Don’t rely only on advice from the manager, developer or their specifi c agent; talk to an independent valuer and real estate agent. Consult a property inspector and a lawyer familiar with the apartment market.
An apartment has many advantages but can have drawbacks too. Fortunately, most of the new developments have covered the bases in order to provide a style of living that is growing in all parts of the country including Auckland’s south-east.
![Page 35: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/35.jpg)
Design and Build South East — 2015-2016 — 35
Stone Creati ons has been providing stone masonry services since 1996. Based in the Franklin area, the company has completed projects both locally and New Zealand-
wide with high quality workmanship.Stone is a traditi onal building material that
is used to add features, presti ge and ti meless character to properti es. The look of stone conveys a sense of substance, permanence, and a reference to nature.
Stone is a material that matures with ti me. It has disti ncti ve qualiti es and there are a large variety of products, cuts and laying styles which can be customised to suit.
The Stone Creati ons team of experienced stone masons is also capable of doing block work, plastering and all aspects of masonry. They
manage projects from concept to completi on. Stone Creati ons specialises in projects ranging
from entranceways, boundary walls, indoor and outdoor fi re places, house cladding, to landscaping features including paving, bridges, sea walls and gabion work. Stone Creati ons can create interior and exterior stone work for commercial, private and council owned properti es to the highest standard.
We have a keen eye for detail and design and work with owners, architects, builders and landscape designers to complete projects to fi t both with overall design and setti ng.
Stone Creati ons are the preferred stone masons for a number of prominent building companies including Van De Putt en Constructi on, many council agencies, and is responsible for large projects such
as the stone work at Lochinvah, Five Stags Tavern Cambridge, and an upcoming project for Otahuhu Recreati on Centre and Library.
Please give us a call to discuss adding value, character and ti meless elegance to your property.
Rock solid elegance
Ph 09 294 7448 • Mob 021 786 632www.stonecreati ons.co.nz
With more than 15 years masonry experience, Stone Creations offers expertise and design creativity specialising in all aspects of stonework.
![Page 36: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/36.jpg)
36 — Design and Build South East — 2015-2016
R20183
![Page 37: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/37.jpg)
Design and Build South East — 2015-2016 — 37
A t Metrotile, we are committed to providing home owners around the world with high performance roofing systems using the very best New
Zealand materials and doing business as family.Family Business■■ – Metrotile is manufactured by
Ross Roof Group who has been involved in roofing over four generations since 1942. Its stone-coated and satin-finish roof systems incorporate cutting-edge Zincalume protective steel, which gives the tiles a significantly longer service life than typical galvanised tiles.
Global Brand, New Zealand-Made■■ – Metrotile’s superior products are based on the principle of utilising only the best raw materials in the manufacture of its lightweight roofing systems. Natural New Zealand stone granules are the foundation for long term durability and stability for colour retention on all its textured roofs. Metrotile roofs are installed in more than 80 countries and withstand the harsh marine environments and high wind zones.
50 Years Warranty■■ – Peace of mind for business partners, home owners, and design professionals providing a comprehensive Metrotile 50-year pro-rata weatherproof warranty.
Easy and Quick to Install ■■ – With an interlocking roofing system and smaller panel size (about 1.5m x 0.4m) we are able to work in strong winds as our tiles are much easier to handle than long
sheets of iron. Quick installation means the job can be finished a lot faster (with no weather delay or return visits) resulting in removing scaffolding earlier and saving money.
Extra High Wind ■■ – Because each metal tile is fixed with horizontal fastenings into battens, each individual tile is very secure. This gives integrity to the entire roof and prevents wind uplift issues. In high winds, some vertically fastened roofs have literally been “lifted off” the frame by wind uplift pressure. A Metrotile roof is engineered for Very High Wind Zones (VHWZ), in coastal regions of New Zealand, and is proven around the world to withstand extreme wind conditions in excess of 190kph.
Architecturally-Designed and Engineered ■■
– Extensive research and development in the
design process ensures every Metrotile product is manufactured in New Zealand to the highest quality with exceptional durability and strength. The authentic design profiles and various colours provide options to match traditional and modern architectural styles. A Metrotile roof lets you improve the look and value of your home in a matter of days.
Cost Competitive■■ – A Metrotile roof is much lighter than traditional concrete or clay tiles and does not need the structural support that traditional roofs require. Therefore, the framing can be lighter resulting in easier handling and savings in framing costs.
All our products (tiles and flashings) arrive to site at the same time. Therefore, you save on transport costs.
Top roofing option
IT’S HUMAN NATURE TO CONTINUALLY SEEK BETTER AND MORE EFFICIENT WAYS OF DOING THINGS...
Axxis Advert.indd 1 23/09/2014 12:10:52 p.m.
R1101173
![Page 38: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/38.jpg)
38 — Design and Build South East — 2015-2016
There’s no place like home but making, or rather, building a home can be easier said than done. While most housing companies offer a myriad of well-designed
plans from which clients can choose, sometimes the choices are overwhelming.
What’s more, while some people can easily see how a plan will fit their site and what the house will eventually look like, others have difficulty translating measurements into actual room sizes or visualising the end product.
In many cases, depending on budget, the site and personal aspirations, it may pay to employ an architect. But where to begin?
Choosing a suitable architect may require visiting several firms and while personal recommendations should be considered, remember not one architectural shoe fits all.
A registered architect, who is a member of the NZ Institute of Architects, may be a good place to start and the Institute can also advise on members in your area.
Importantly, working with an architect is a collaboration and one you need to be comfortable with from the start.
On that first exploratory visit, chat informally, present questions, ask to see photos of recent work and generally get a feel for the person to whom you are entrusting your dream.
Take a list of questions to the meeting and be sure to understand all charges, fees and processes before making a decision to go ahead.
A good architect listens to the client’s initial ideas and dreams and talks through the basics so there is a clear understanding of what is involved,
before progressing further. Naturally, you will be seeking creativity, advice,
professional skills and, perhaps, something out of the ordinary, from your chosen architect but before a concept and plans can be drawn up to suit lifestyle, personality, property, budget and family requirements, there will be many elements to discuss.
The outcome will rely on good communication, co-operation, listening, trust and the rapport between client and architect. Once an architect has been chosen the real process will begin.
Many prospective homeowners have strong ideas about a new house but it’s important to be open-minded.
Give your architect the freedom to explore and present new or different ideas – undoubtedly you
will discover options never even considered. Also, clients are often surprised at how much
they prefer the architect’s proposals. Embrace those suggestions that inspire and excite but be firm on areas where you do not wish to compromise.
A good working relationship between client and architect is vital to the success of any building project. Your architect’s design approach and philosophy should fit your requirements. From there the design for your new home will unfold and eventually come to completion under your builder.
Finally, while an experienced, professional builder can be expected to interpret and execute your architect’s plans to a tee, it may pay for them to meet first so everyone is on the same wavelength.
Finding the architect of your dreams
![Page 39: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/39.jpg)
Design and Build South East — 2015-2016 — 39
“The environmental and sustainable choice for people wishingto provide warm and healthy homes for their families to live in.”
Eco Friendly Design & Build CompanyNew HomesMajor Alterations & AdditionsAll Homes are Homestar Rated
Call now to arrange your FREE initial consultation onor09 9477341 021 1264174
www.ecohabitats.co.nz I [email protected]/ecohabitatsNZ
eco
ecohabitatseco
R20160-v2
“The environmental and sustainable choice for people wishingto provide warm and healthy homes for their families to live in.”
Eco Friendly Design & Build CompanyNew HomesMajor Alterations & AdditionsAll Homes are Homestar Rated
Call now to arrange your FREE initial consultation onor09 9477341 021 1264174
www.ecohabitats.co.nz I [email protected]/ecohabitatsNZ
eco
ecohabitatseco
“The environmental and sustainable choice for people wishingto provide warm and healthy homes for their families to live in.”
Eco Friendly Design & Build CompanyNew HomesMajor Alterations & AdditionsAll Homes are Homestar Rated
Call now to arrange your FREE initial consultation onor09 9477341 021 1264174
www.ecohabitats.co.nz I [email protected]/ecohabitatsNZ
eco
ecohabitatseco
Seeing green over modern designAnyone with an eye for fine architecture,
and a leaning toward sustainable or eco-friendly living will love the buldings featured in Green Modern by Claire
McCall. This beautiful book showcases design-conscious New Zealand houses that embrace a more sustainable way of living.
Ranging from inner-city homes to remote retreats, each of the 15 houses demonstrate how thoughtful design and environmentally-responsive building techniques can work together to produce ecologically-sound living spaces with a sense of calm and simplicity.
Part design inspiration, part practical guide, Green Modern offers examples of homes that adopt a wide variety of responses to enhance energy efficiency, environmental impact, health and comfort. These are ‘smart’, eco-conscious homes that champion style and sustainability in equal measure.
Filled with beautiful colour photographs and helpful floor plans, Green Modern is the ideal reference for anyone considering how to build or renovate a home in a more ecologically responsive way.
But more than that, the designs provide
inspiration for contemporary living options which don’t necessarily have to be palatial.
Some of the houses, holiday homes and apartments, clearly demonstrate that with clever design and skilful use of materials, a compact building can still provide ample living spaces and be aesthetically pleasing inside and out.
The selection of ‘green, modern’ homes range from a holiday property on Great Barrier island to ‘Tent City’ in the Marlborough Sounds and a container house at Muriwai.
Many of the homes use solar panels to harness energy, rainwater tanks to capture water and recycled timbers (and buildings) to form the basis of construction.
Landscaping and site location for sun and views is also taken into account.
This beautiful book is more than just a coffee-table addition. It is stimulating and constructive, offering many beautiful and practical ways to turn green at home.
Green Modern – eco-conscious contemporary ■■
New Zealand homes by Claire McCall. Published by Penguin Group (NZ). RRP $65. Available at all good bookstores. Photo Emma-Jane Hetherington
Healthy homesOn arriving in New Zealand in 2007, I was surprised at how cold and damp New Zealand homes were. I was also surprised that so many home owners just accepted that this was how it was and nothing could be done.
This is not always the case today as some existing homes can be made into healthier homes in a few straight forward steps.
As a director of Eco Habitats, an eco-friendly design and build company and a Homestar assessor, I am committed to improving the standard of NZ homes and use Homestar as an auditing tool.
What is Homestar? Homestar is an independent rating tool created by BRANZ and the NZ Green Building Council. It is based on a number of successful rating tools, but has been tailored to suit New Zealand.
Homestar evaluates the attributes of residential homes in terms of energy, health, comfort and water and its initial aim was to improve the standard of the many under-performing houses.
However, when building a new home everyone should consider advising one’s designer or architect
that they would like a home with minimum 6 Homestar rating to ensure it is warm and healthy.
With the current housing shortage in Auckland, the concern is that the pressure to build homes quickly will be prioritised over ensuring these homes are warm and healthy.
Home owners should be made aware that at present, building to the minimum requirements of the New Zealand Building Code will likely mean that home is under-performing.
I recommend installing at least 50% more insulation than the building code requires. Not only does adequate insulation make a home warmer in winter, it makes it cooler in summer and minimises the risk of year-round condensation.
Over the past few years I’ve come to realise, warmer, healthier homes and environmentally-friendly homes are mutually inclusive; it is not possible to achieve one without the other. An eco-friendly home should provide lower running costs and have a sales advantage.
Check out the Homestar website (www.homestar.org.nz) for helpful tips and advice. By Lesley England
![Page 40: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/40.jpg)
40 — Design and Build South East — 2015-2016
CAR0739
Renovating?Think Smith & Sons.
Phone 0800 764 846www.smithandsonshowick.co.nz
quality builders - renovation specialists
* A Team who will listen to and understand your needs,* Fully Qualified Builders,* Local Tradespeople,* From Concept to Completion.
E513056-v4
SC3425
CUSTOMWARDROBES+ SLIDING DOORS
NE W ZE A L A NDDESIGNED+PRODUCED
VISIT OUR SHOWROOM AT24s Allright Place,Mt Wellington
Mon-Fri 9am-4pm + Sat 9.30am-12.30pmClosed long weekends and public holidays P 0800 80 30 50
WARDROBES +REACH IN
FREESTANDINGWALK IN
STORAGE SOLUTIONS +OFFICELINEN
GARAGE
www.innovativeinteriors.co.nz
![Page 41: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/41.jpg)
Design and Build South East — 2015-2016 — 41
Whether an idea or concept is sketched on the back of a paper napkin, or you’ve compiled a scrapbook full of photos and
magazine cut outs, planning a renovation needs to start somewhere.
Choosing an architect or draughtsperson to transform your ideas is something that should not be done in haste. A good design will absorb your character and personality.
Choosing someone local, who knows the area and listens to your vision, is a great start. That person or company needs to know your budget as much as you need to know they can be trusted and that you can put your faith in them to come up with the goods.
Understanding the building process will give a better appreciation of the importance of proper planning. Getting a cost estimate, based on concept plans, will often help you decide if the brief given to the designer will require modifying to bring costs back into line.
The next step is choosing the builder. Monumental changes to the Building Act over the past few years have seen many of the so-called, ‘cowboy’ builders exiled from the industry.
Make sure your builder is trustworthy, carries good credentials, is a Certified or Master Builder, is licensed and that you have confidence in him.
During the planning stages, and right throughout the build, you will have many decisions to make. This can be exciting and rewarding, but also very stressful. Researching materials is important in assuring you achieve the desired result.
More and more emphasis is being placed on sustainable building practices and creating homes that are efficient to run while being environmentally-friendly.
Whilst concrete is frowned upon because of the emissions during manufacture, it offers a fantastic
form of passive heating due to its ability to retain heat.
Consider other sustainable materials and building techniques such as wide soffits (to keep heat out in summer), efficient lighting, solar heating, building to suit the sun, using recycled materials and choosing good insulation.
These can all play a great part in renovating your home to make it warm and healthy for you and your family.
By doing things properly you will achieve the result you want and avoid unnecessary pitfalls.
When reviewing quotes make sure you understand exactly what is included and excluded.
Compare quotes and ask for clarification if you are not sure. It is against the law to engage in any building work over $20,000 without a proper contract with your builder – a hand-written scribble on the back of a notepad is not acceptable.
A well-presented quote with detail, along with a contract outlining everything from terms of payment to what happens in case of a dispute, is required.
There are many things to consider when renovating, but if you are prepared to do your research and use professionals, you will get the desired results and hopefully have an enjoyable and rewarding experience.
Planning imperativeSuccessful house renovations rely on a number of components ranging
from engaging a draughtsman or architect to create the design to a tradesman builder who will deliver the end product. But before starting,
the most important element is research and planning.
![Page 42: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/42.jpg)
42 — Design and Build South East — 2015-2016
Offering a huge array of building materials and home renovation products, from fencing timber to flooring, hardware to power tools, PlaceMakers Pakuranga
also provides everything to ensure those all-important rooms – kitchen, bathroom, laundry – are style setters.
Under new management for the past year, the showroom has not long undergone its own makeover and now includes five fully set up bathrooms and three kitchens, all designed to give customers a better idea of colours, layout and versatility.
Bathroom advisor, Tina Davies says the bathroom area is awash with
gorgeous colours from Laminex New Zealand, such as Pop Tart, Sneaky Mist and Seratone Escape and brims with inspiration.
“Our complete bathrooms help customers to visualise their own build or renovation plan and also show how the end result will look. Not only do displays enhance the shopping experience but they assist customers to make decisions quicker and more easily.”
With a seemingly limitless wall of tapware and shower head options from reputable brands, PlaceMakers Pakuranga is intent on giving shoppers the chance to compare various styles and to mix and match items.
Of course, all the latest quality bathroom
fittings, accessories and furniture are also on display – frameless showers, tiles in varying colours and sizes and contemporary bath and basin designs.
The showroom also carries leading brands of New Zealand-made showers and vanities in a variety of finishes such as gloss and woodgrain.
“PlaceMakers isn’t just the place where people come to find the fundamentals; we have a whole range from basic to high end products,” says Tina.
And, when it comes to kitchens, the same applies. Shoppers will be impressed by stunning PlaceMakers Kitchens by Peter Hay and can examine these up close, confident that this long-standing name in the kitchen industry, will deliver.
Put your place on the map with PlaceMakersIs building, renovating or extending a home on the agenda? Do you need expert
advice, quality products, and budget-friendly ideas? Then talk to the team at PlaceMakers Pakuranga.
![Page 43: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/43.jpg)
Design and Build South East — 2015-2016 — 43
Put your place on the map with PlaceMakersIn-house kitchen designer, Yvonne Pope says
customers are encouraged to bring in their plans and to inspect the kitchens.
“We’ll come up with a 3D design and quote for their own kitchen and help them choose colours and materials,” she says. “There really is a wealth of materials to choose from – something for every style and colour taste.
“Our Concept Centre is the real highlight of the kitchen showroom. Here, people can have a play around with different materials and colours; they can even move around slabs of stone to see how a certain type of bench top looks when matched with different cabinetry, profiles or hardware.
“Regardless of whether they are seeking a simple laminate benchtop or want to step up to engineered stone or granite, we can oblige.”
Importantly, PlaceMakers’ kitchens are backed by a lifetime warranty on internal hardware and a 15 year warranty on its New Zealand-made cabinetry.
“From features such as moisture resistant components – designed to stop warping – soft close drawers and cupboards as standard, to general style, PlaceMakers has it all,” Yvonne adds.
What’s more, further guidance is always at hand from branch manager Rowan Toms, operations manager, Donna Durrant and other highly experienced team members. Their aim is to make the customer service experience pleasant and fuss-free.
So why not call in and meet Rowan and his team at the Pakuranga showroom and see complete bathrooms and kitchens or to discuss your personal renovation/building requirements. No one will be easier to deal with than PlaceMakers Pakuranga.PlaceMakers Pakuranga, 481 Pakuranga Rd, Pakuranga. Ph 538 0200. www.placemakers.co.nzHours Mon-Fri 7am-5.30pm, Saturday 8am-5pm, Sunday 9am-5pm
![Page 44: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/44.jpg)
44 — Design and Build South East — 2015-2016
38b Highbrook Drive, East Tamaki. Phone 274 9406Monday-Thursday 8.30am-5pm, Friday 8.30am-3pmwww.silestone.co.nz www.dekton.com
SETTING THE BENCHMARKCosentino welcomes the public to its Highbrook design centre where the best in engineered stone benchtop surfaces can be viewed – an eclectic range for every taste.
SHOWCASING Silestone – the first and
only quartz benchtop with Bacteriostatic Protection, giving it unique features.
Dekton – a sophisticated blend of the raw materials resulting in an Ultra Compact Surface.
NZ owned and operatedCAR0740
WANTING A NEW KITCHEN?
Come & talk to us at our showroom today about your new kitchen!
Crazy about kitchens
Showroom open Mon to Fri 9am - 5pm, Sat 9am - 3pm 20 Sylvia Park Rd, Mt Wellington
ph 09 588 4045 or 0800 4 A KITCHEN Book a consultation online at www.kitchenmania.co.nz
KIT57 184x135.indd 1 16/06/15 3:08 PM
RW1212
![Page 45: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/45.jpg)
Design and Build South East — 2015-2016 — 45
Nestled in the heart of Highbrook’s business district is the Cosentino Surfaces design centre showcasing the latest in kitchen benchtop surfaces.
Focusing on the latest trends and technologies for engineered stone and ultra compact surfaces, Cosentino is a destination for the likes of home owners and interior designers to come and view the latest in stone patterns and colours.
Cosentino New Zealand is proudly family-owned and operated and sources its brands, Silestone and Dekton, directly from Spain.
Silestone■■ – the world’s largest engineered stone brand is 94% quartz 6% resin. Silestone offers a high resistance to scratching and staining and is also available in three different thicknesses being 12, 20 and 30mm. It also offers jumbo slab sizes of 3.2m x 1.59m.
Silestone comes in a variety of colours and textures including the unique suede finish giving a matt look to the stone surface. Throughout the range there are many different pattern varieties ranging from pure white to the latest in marble and granite colourings.
Benchtops on showDesign centre displays the best of engineered stone from Spain
Kitchens are more than just the cooking zone; they’re the hub of the home and the way this hot spot fits with individual family lifestyles is all important.
And no one knows that better than the team at Kitchen Mania. Focused on listening to customers, owner, Carl Arnold and his staff, research client needs thoroughly before delivering a kitchen which really fits the brief.
The first step in a kitchen renovation by Kitchen Mania is a home visit by one of the six experienced consultants – they will go anywhere in Auckland.
“There the consultant will get a feel for the space and how it relates to the rest of the house,” Carl says. “We discuss how the kitchen will be used in its widest sense – will children do their homework there? Is a scullery required? Should dining be incorporated?
“If there are any sticky issues regarding layout or functionality, the whole design team puts their heads together to offer the best solution.”
Mt Wellington-based, Kitchen Mania has been in business since 2009 and Carl has been involved in the industry for some three decades.
“The showroom is bright and well set-up with model kitchens and many dashes of our trademark
colour of yellow,” he says. “There’s plenty here to see but if a kitchen is to be renovated successfully, consultants must visit the customer at home for a good understanding of what is required.
“There they get a feeling for the space and what is required of it – family meals, lots of entertaining, a kitchen just for two. They look at what already works and what doesn’t.”
After consultation and once a plan has been formulated using the latest in computer software, clients return to the Mt Wellington showroom to discuss the plan and ensure it is tailored to needs and budget.
While many customers go for the complete package, others might opt only for new cabinetry but within two months of that first consultation customers can usually be enjoying their newly renovated kitchen.
In addition to the showroom, the company has
a manufacturing plant where kitchen cabinetry is produced with all kitchens made from MR (moisture resistant board). All the cabinets have solid backs for easy fixing of electrical and plumbing fixtures and Carl says the company uses the best European hardware available.
And with many people “time poor”, Kitchen Mania can project manage the entire process including installation, electrical work, and plumbing fixtures.
Kitchen Mania’s premium and personalised service is competitively priced. The company renovates some 1000 kitchens across Auckland each year and has a file bulging with glowing testimonials – “we’re a Kiwi company you can rely on,” Carl says. “So, give us a call.”
Kitchen Mania, Unit 1, 20 Sylvia Park Road, Mt Wellington. Phone: (09) 588 4045 or freephone: 0800 4 A KITCHEN. www.kitchenmania.co.nz.
Crazy about kitchens
Dekton■■ – This ultra compact surface is new to the international market and features outstanding properties such as heat resistance to 300 degrees and UV resistance. It also offers the highest resistance to staining and scratching making it an ideal material for use indoors and outdoors, kitchen benchtops and exterior facades. It is limited only by your imagination!
Dekton is also available in a variety of textures and colours including wood grains and concrete. The latest white marble Dekton range has also been released into the New Zealand market and is available for viewing now in the Centre.
The friendly team at Cosentino is available Monday-Thursday 8.30am to 5pm, Fridays 8.30am to 3pm. Weekends by appointment only.
![Page 46: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/46.jpg)
46 — Design and Build South East — 2015-2016
Elite Kitchens and Cabinets has been building high quality, innovative, stylish kitchens, bathrooms and cabinetry since 1958 for the Auckland region, their work
appearing in proud first homes to sumptuous mansions.
Extensive industry experience has given customers the assurance that they are in the hands of one of the most experienced and dependable kitchen manufacturers in New Zealand.
Your kitchen is the heart of your home, and it will be the kitchen and its surrounding area where the family will spend most of their active time in your home.
Elite understands how your kitchen needs to be tailored to your needs and lifestyle. As the family’s food preparation area, a good quality, well made kitchen is vital to health and wellbeing.
To this end, Elite uses environmentally-certified board and hardware in its kitchens to protect your family.
Elite has several display kitchens in its fully equipped showroom, as well as a team of four in-house designers to help plan and design the kitchen of your dreams. Alternatively, Elite can build to your plans.
An Elite kitchen will add real value to your home. As Phil Spencer, UK property television presenter says, “If you are going to improve only one room, make it the kitchen. This has now become the showpiece area of the home.
“We don’t just cook in it, we do homework in it, we watch television in it and hold dinner parties there.
“Typically, a sound, well-designed and made custom kitchen will add value to a property.”
DESIGNERS AND MANuFACtuRERSElite provides both an in-house design and a full manufacturing service to help clients achieve
value for money without compromising quality or service.
This is one of the reasons why leading, quality home builders, architects, kitchen designers and professional renovators choose Elite as their supplier and manufacturer.
We design, manufacture and install kitchens, laundries, bathrooms, shelving, entertainment units, and office cabinetry. Elite uses local materials, as well as the best European-made hardware that has lifetime manufacturers’ warranties.
LocaL Elite’s kitchens are all custom-built in Elite’s Papakura factory by skilled, local, trained tradesmen, who use the best New Zealand-made materials.
What’s more, your kitchen will be installed in your home by Elite’s experienced installers to
Add value with Elite
![Page 47: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/47.jpg)
Design and Build South East — 2015-2016 — 47
ensure a perfect, professional fi nish. Elite is a local company employing local people living and contributi ng to your community.
Elite encourages its customers to visit its showroom and factory when planning their kitchen with an Elite designer, and to inspect their kitchen before it is delivered and installed.
WORkING tO YOuR BuDGEtThere are many exciti ng opti ons available for your new kitchen. Elite’s design team will help you work through those opti ons to select the ulti mate kitchen for you. Elite’s designers will also work
within any budget, helping you make choices to obtain the best value.
CONtACtFor more informati on and arti cles about planning your new kitchen, photographs of some of Elite’s kitchens and bathrooms, and testi monials from their customers, visit Elite’s website: www.elitekc.co.nz, or use your smart phone to scan the QR Code adjacent for immediate access to Elite’s website.
Call Elite Kitchens and Cabinets today about your dream kitchen.
Elite is a member of the Nati onal Kitchen and Bathroom Associati on (NKBA), committi ng Elite to delivering top-of-the-line professionally made kitchen furniture meeti ng the highest industry standards.
Elite kitchens and Cabinets ltd64 Hunua Road, Papakuratelephone 298 8388Email: [email protected]: www.elitekc.co.nz
Members of Suppliers of
![Page 48: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/48.jpg)
48 — Design and Build South East — 2015-2016
Homeowners seeking a fresh, modern kitchen really need to chat to the team at My Kitchen Makeover (MyKM), who can give your kitchen that new lease
of life. Alternati vely, if you plan to sell and want to att ract high paying buyers, then the professional design ideas of the MyKM team will add style and value at competi ti ve prices.
The company has a cost-eff ecti ve plan to update your kitchen for less than the price of a full replacement in the same high quality, designer fi nishes, and will project manage the enti re process.
Making a few cabinetry changes to enhance the functi onality of the kitchen without needing to change the overall layout can literally save you thousands on items such as fl ooring, plumbing and electrical costs.
The new and existi ng cabinetry is then fi nished using high quality, two-pot lacquer in any Resene colour which makes it easy to co-ordinate with your existi ng decor.
Add new Engineered Stone benchtops, handles, plus a stunning Feature Glass splashback and your kitchen will be the envy of family and friends.
If the makeover is to update your current design or is in preparati on to selling your home, MyKM’s professional colour consultant can help clients select a desirable colour scheme, and once started on site the enti re process only takes around two weeks.
And last, but defi nitely not least, MyKM’s operati on is environmentally friendly and your kitchen stays fully functi onal during the makeover process so you can sti ll enjoy preparing and cooking all of your meals at home!
So, when your kitchen layout works but the kitchen needs a colour change and upgraded, designer fi nishes, call My Kitchen Makeover for a FREE in-home design consultati on.
Makeover your kitchen!
Phone 0800 696 253Email [email protected]
Tired, dated kitchens are about as inspiring as fl opped baking but MyKM can cook up a makeover which will lift looks and make your hub of the home the talk of the town.
Aft er
Before
Aft er
Before
mykitchenmakeover.co.nz
![Page 49: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/49.jpg)
Design and Build South East — 2015-2016 — 49
Or visit us in our showroom: 138D Plunket Ave, Manukau, Auckland
Exclusive Deal!10% off when purchasing a splashback from Graphic Glass
Graphic Glass – the leader in coloured and printable graphic glass for use on kitchen and bathroom splashbacks. Graphic Glass – the leader in coloured and printable – the leader in coloured and printable graphic glass for use on kitchen and bathroom splashbacks. graphic glass for use on kitchen and bathroom splashbacks. graphic glass for use on kitchen and bathroom splashbacks. graphic glass for use on kitchen and bathroom splashbacks. graphic glass for use on kitchen and bathroom splashbacks.
Glass splashbacks look stunning and can produce that wow factor in an otherwise ordinary kitchen. With the number of options available like coloured glass, graphic glass and textured glass, they can truly become pieces of art in a kitchen. They have a contemporary look suited to modern homes and can be made to fit the wall perfectly around not only cabinetry but the rangehood and windows with minimal gaps. Glass splashbacks are supremely functional with being easy to clean and hygienic. The smooth surface means it can be wiped down easily, unlike tiles which has grouting to care for. Their shine means the light is reflected wonderfully to help light up a kitchen, especially in one where there are minimal windows.
Marble bathroom: Euroglass Showroom, Parnell
R20181-V2
![Page 50: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/50.jpg)
Splish- splash, some Kiwis were taking a bath when they realised how much quicker it was to shower. But in this modern age, the Kiwi family also expects the bathroom
to be relaxing, att racti ve and to feature the latest technology for making hygiene easy.
So it’s not surprising that in their quest to make this inti mate and oft -used room beauti ful, research shows that New Zealanders renovate their bathrooms, on average, every six years.
Whether planning a major overhaul or just updati ng a few fi xtures and fi tti ngs, choosing a shower is a signifi cant part of the process. One has to consider the overall style of shower and the shower head, which in many cases is determined by water fl ow, and with every-developing technology the choice can be mind-boggling.
For example, Methven Sati njet® technology uses twin water jets which collide to turn into thousands of ti ny droplets. Showers that incorporate this revoluti onary thinking deliver a best-of-both worlds experience – a soft -feeling, luxurious shower that also has the power to be bracingly cleansing.
Yes, there are showers that massage the body and showers that add a defi nite zing, hand-held, fi xed, top mounted and wall mounted – the opti ons are many and varied.
Ideas for shower design:Most shower handsets have ■■
universal fi tti ngs so it’s easy to upgrade a shower without spending money on a complete overhaul. Simply unscrew the handset from the fi xing and replace with a new one.
Deciding how high a showerhead ■■
should be placed can be tricky. Industry experts advise that between 2 and 2.1 metres from the fl oor is about standard. A showerhead poking above the line of the cubicle can look unbalanced so check those
dimensions fi rst. If the tall gene runs in the family, you may want to go higher.
To avoid being drenched with scalding hot or icy ■■
cold water, make sure the mixer can be accessed without having to stand under the shower.
If the bathroom is compact, consider a walk-in ■■
shower with no door to manoeuvre around.When choosing taps, fi xtures and fi tti ngs for the ■■
shower, a consistent profi le enhances the overall look. If the preference is for a square, fl at shape, use it in taps, the heated towel rail, and the toilet-roll holder. If a fi ne, round profi le is preferred, keep to that style throughout.
Each style of shower has advantages. Some ■■
people favour the simplicity of a shower rose that emerges directly from the wall; others like an overhead style. On the other hand, a rail shower off ers fl exibility because it allows the shower to be adjusted to any height and, a shower which combines an overhead and a rail system gives the opti on of an immersive, soft experience or a more vigorous bracing shower. What’s more, the handpiece can be removed from the rail – very useful when cleaning the shower.
Love those gorgeous European mosaic ti les ■■
but can’t aff ord an enti re wall of them? Consider an alcove in your shower box to hold soaps and shampoos and ti le it in mosaics to highlight it as a
feature.■■■If lime or calcium build-up from hard water starts to distort
the spray of your showerhead, soak it in equal parts vinegar and hot water which should
dissolve mineral deposits. Avoid causti c cleaners. ■■■■When buying tapware for
your shower look for the WELS (Water Effi ciency Labelling Scheme) rati ng. Under
the scheme, the more stars a product has, the more water-effi cient it will be.
Showered with ideas
Deciding how high a showerhead should be placed can be tricky. Industry experts advise that between 2 and 2.1 metres from the fl oor is about standard. A showerhead poking above the line of the cubicle can look unbalanced so check those
shampoos and ti le it in mosaics to highlight it as a feature.
■■■from hard water starts to distort
the spray of your showerhead,
dissolve mineral deposits. Avoid causti c cleaners. ■■■■
your shower look for the WELS (Water Effi ciency Labelling Scheme) rati ng. Under
the scheme, the more stars a product has, the more water-effi cient it will be.
Step on the gas!The old saying, “now you’re cooking...with gas!” couldn’t be truer of many Kiwi homes today.
More and more homeowners are opti ng for gas either solely for cooking or to operate the wider household – heati ng and hot water.
Some southern and eastern residents are already connected to natural gas but not everyone.
However, bott led LPG (liquefi ed petroleum gas) is being incorporated into many new homes with people appreciati ve that it is a clean, convenient energy source.
The great thing about gas is the endless hot water (no running out aft er three showers) and should the power (electricity) go down, gas sti ll provides opti ons for heati ng and cooking.
Of course, with gas barbecues and gas-fi red pati o heaters, outdoor living is also enhanced.
Importantly, gas is a clean, effi cient, healthy home soluti on ensuring houses are warm and damp is reduced. It provides instant and adjustable heat.
Furthermore, gas appliances are generally inexpensive to operate and maintain, oft en saving money on energy bills.
Gas is also safe with strict regulati ons governing its handling and storage.
Modern appliances also have built-in safety features.
Gas is plenti ful in New Zealand and whether one is lucky enough to be connected to natural gas, or is using bott led gas, which is available in various size bott les, generally stored outside, the household will be well catered for.
What’s more the southern and eastern areas are well served by an abundance of gas-fi tt ers who can advise on all the opti ons.
50 — Design and Build South East — 2015-2016
![Page 51: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/51.jpg)
Design and Build South East — 2015-2016 — 51
Penrose Rd
Since opening in 2013, Galaxy Homeware has proudly provided a contemporary range of products that make outf itti ng a new bathroom both easy and sati sfying.
The knowledgeable team has 10 years industry experience and a dedicated mission and vision for the business:
Our Mission: ■■ To bring quality, reliable and aff ordable products into your home building and renovati ng.
Our Vision:■■ To provide the best bathroom interior experience from selling products to providing professional bathroom insight.
Whether building a new home or renovati ng an existi ng bathroom, customers will fi nd a wide range of showers, vaniti es, mirrors and baths at Galaxy Homeware to suit a variety of budgets and style preferences.
Galaxy’s range delivers an att racti ve combinati on of long-lasti ng, quality designs at an aff ordable price.
And, in recognising that every customer has diff erent requirements, the team goes to great lengths to deliver just what their customers want.
Using their professional bathroom knowledge and passion for service, they will tailor bathroom packages for individual needs.
For style and taste that is inspirati onal, innovati ve and aff ordable, Galaxy Homeware has everything to make bathroom dreams come true.
So, look no further, visit Galaxy Homeware and check out the range of imported and New Zealand-brand products.
What’s more, ALL vaniti es, shower units and tapware have a fi ve-year replacement warranty – if
anything goes wrong within fi ve years Galaxy will provide replacement parts for you.
If you’re planning to build or renovate, check out the Galaxy Homeware website www.ghomeware.co.nz which is packed with informati on and advice.
Bathroomware out of this world
co.nz which is packed with informati on and advice.
350 Church Street, Penrose, Onehunga, AucklandPh 09-222 2789, E: [email protected] Hours: Monday to Saturday 9am-5pm.
Mount Smart Rd
Church Street
Motorway SH1
One
hung
a M
all
Great South Rd
![Page 52: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/52.jpg)
52 — Design and Build South East — 2015-2016
RW
1223
URBANOINTERIORS
COLLECTIONS: DINING FURNITURE | FABRIC COLLECTION
INTERIOR ACCESSORIES | LEATHER COLLECTIONS | STUDY FURNITURE | OCCASIONAL FURNITURE | BEDROOM FURNITURE
LOUNGE SUITES
Auckland21 Davis Crescent,
Newmarket Ph 524 7959
6 Polaris Place, East Tamaki Ph 272 9165
Christchurch145 Blenheim Road,
Riccarton Ph 03 348 8358
www.urbanointeriors.co.nzr100100
The Sealy Posturepedic® Hybrid combines two of the best sleep technologies into one great mattress. Providing cooling comfort of gel memory foam on top with the deep support of titanium-alloy springs underneath. The perfect combination of
comfort and support for an undisturbed sleep.
SRX TITANIUM COILS SMARTEXTM TEXTILE COMFORT HAND CRAFTED TO ORDER
™
E X C L U S I V E T O B E D P O S T
451 Ti Rakau Dr, The Hub,Botany Downs. Ph 273 8088.Email: [email protected]
BEDPOST BOTANY AT THE HUB
HOURS: Mon-Sat 9am-5.30pm, Sun 10am-5pm.
*Q card lending criteria, fees, terms and conditions apply. Bed differs slightly from model shown
CA
R06
9811 Neil Park Drive, East Tamaki. Ph 09 273 7068
Planning to renovate or create a new kitchen?
Huge Savings Wholesale price direct to public
E51
0462
Huge Savings “Look no further”
![Page 53: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/53.jpg)
Design and Build South East — 2015-2016 — 53
Many a homeowner planning to redecorate has stood in the middle of a room and thought, “where do I begin?”
Obviously, the idea is to have a plan and to have done some research such as leafing through magazines, scanning company websites, visiting showhomes and general accessing any source which can provide inspiration.
While interior design solutions are virtually endless, and there are a multitude of styles and moods to suit different décor tastes so, some simple tips may set the undecided on the right path.
Suggestions include:Steer clear of over-crowding a room – less is ■■
often best, too much clutter will make a room feel cramped. However, even if you prefer minimalist you won’t want the room to seem sterile either. It’s all about balance and maintaining a feeling of warmth whilst retaining a sense of space.
Don’t over-theme a room. Once decided on ‘the ■■
look’, choose a few pieces to endorse the theme but don’t go overboard. Keep it subtle.
If a room is small, paint or wallpaper with light ■■
colours to help create that spacious feel. Adding a large mirror will reflect light and also make the room seem larger.
If a room is very big, consider a patterned ■■
feature wall which won’t feel claustrophobic but will provide interest and contrast. Rugs can also add a sense of cosiness.
If the budget is limited there are many ways to ■■
decorate walls without investing in expensive art: – Create your own art work by grouping
different size china plates on a wall. Keep to a colour theme or perhaps opt for white or cream against a dark background.
– Frame children’s art, make up a portrait gallery of family photos or, if you have plenty of travel shots, consider having one or two printed on canvas and blocked. This is not usually expensive and can be a reminder
of happy times as well as a stunning wall decoration. You can even have photos printed on a new stick on/peel off wallpaper
– Frame textured and patterned fabrics then group on a wall and keep in mind that throws, runners and rugs can be wall-mounted for artistic effect too.
Finally, a change of cushions and throws can ■■
add a new colour scheme and provide a a room with renewed vigour. Remember, that one pair of cushions may look sparse whereas several cushions in different patterns and textures, but keeping to the same colourway, will look fabulous when piled together.
Decor directions
Treat windows wellWhere once a window was, well, a
square window, there’s no guarantee today as to what shape or size a window will be. It could be round,
curved at the top, wall to ceiling, wall to wall, small, big, and it could open in a variety of ways.
What’s more, there are many exciting window treatments to suit all those different window requirements.
With blinds, shutters, and drapes, used separately or combined, protection from the sun, reflection, heat, nosy neighbours and unwanted daylight are all possible.
Many years ago, venetian blinds proved a successful design for limiting light and ensuring privacy.
Today, blinds still offer those same essential characteristics, however styles have improved and materials are far superior. With sun, light and privacy protection features, looks range from the contemporary to traditional.
Today’s blinds also offer insulation and heat reflective qualities, which can make for reduced heating and cooling bills.
Of course, window treatments can make a decor statement or blend in with the surroundings with curtain fabrics available in a huge range of patterns and textures from filters and sheers through to gorgeous linens, cottons, easy polyesters, patterns
and plains, jacquards, opulent velvets and more.And, there’s something about drapes that add
a sense of luxury and interest. They can make a statement in themselves with colour, detail and various heading treatments, or they can act as a luxurious background to the rest of the room.
Remember, light or pastel colours can make a small room look larger; they create a subtle ambience and are easy on the eyes. Try to avoid dark colours in small rooms as they will close it down.
On the other hand if the room is large and a bit impersonal, darker colours will gather in the room, creating a rich, formal ambience. Quality linings will help filter sun, insulate and offer a longer life for drapes.
Finally, it’s all about location. Although window
placement can’t always be changed, proper positioning of window treatments can make a difference to over-all effect.
For example, in a room with a low ceiling, create an illusion of height by installing curtain track near the ceiling and allowing drapes to fall from full height.
Where windows are narrow, extend curtain tracks beyond both sides of the frame so curtains stack off the window. This will maximise light and make the most of views.
For those who want light and privacy, then a filter-style curtain with a retractable lining may achieve the desired effect and, for those whose property provides all the privacy needed, it may be possible to do away with curtains altogether. Roller blinds or shutters may be all that is required.
![Page 54: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/54.jpg)
54 — Design and Build South East — 2015-2016
We pride ourselves on supplying and installing Kahrs premium wooden fl oors, this means we do not
compromise on quality, durability and service in providing these genuine, unique and personal wooden fl oors.In total we have over 30 different fl ooring options,
so visit our fabulous new showroom with more than 200m2 on display.
HOME IDEAS CENTRE – STAND 63
THE WOODEN FLOOR COMPANY159 Stoddard Rd, Mt RoskillPh 09 621 0131www.woodenfl oors.co.nz
R20167
CA
R07
08
Come in store and talk to ourfriendly sales staff today
Services we offer:
Q-Card fi nance available on purchases $1000 and over. Terms & conditions apply.
4/21 Ronwood Ave, Manukau.
Phone 09 262 0048
153b Manukau Rd, Pukekohe.
Phone 09 238 2954
KA
T38
85
Hours: Monday-Friday 8.30am-5pm,Saturday 9am-1pm
www.fl ooringxtra.co.nzWe are happy to assist with your next fl ooring purchase.
We do it allR
2013
9
“No Job Too Small”If you’re ready to update the look of your home but are worried about your pocket, contact Tile Time NZ Ltd. We have the tools, craftsmanship and commitment
to get the job done, at a price you can afford.
Phone Neville 021 924 500 or Emma 021 413 662 09 264 0974 (After Hours)
[email protected] www.tiletimeltd.com
![Page 55: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/55.jpg)
Design and Build South East — 2015-2016 — 55
Design & Build Showroom Ad | 90W x 135H
www.jacobsens.co.nz
With many years experience in flooring and design,
Jacobsen’s friendly team of showroom consultants are
experts at finding the perfect product for your project. We
have solutions to suit all projects and budgets.
Visit our showroom 41 Morrin Rd, Mt Wellington.
Monday-Friday 8-5pm Saturday 9-4pm.
Wood & Laminate FlooringFloor & Wall Tiles
CAR0742
Tile talk
Whether building or renovating, today’s extensive range of tiles provides almost
endless ideas for wet areas such as laundries, kitchens and bathrooms and will also enhance foyers, and family rooms or add that finishing touch to the patio.
Decorative tiles have been used to adorn floors and walls for centuries.
Today ceramic and porcelain tiles from Italy, Spain, Portugal, India, South America and many other places are exported all over the world and used not only for practical purposes but for their beauty too.
Attractive, durable and easy to maintain, tiles are suitable for interior and exterior surfaces, floors and walls and with today’s variety of non-slip finishes, they can even be used around swimming pools.
Available in masses of colours, sizes and finishes to create everything from rustic ambience or Tuscan charm to modern simplicity or sophisticated, contemporary style, today’s tiles are a surety when decor impact is required.
Of course, successful décor often relies on an element of timelessness, which tiles certainly provide – they have been around for eons but thankfully, modern technology also means ceramic tiles can now be printed with a variety of finishes so
they look like marble, or stone. Shape, colour and designs
continue to move with the times. Today’s bathrooms, for example, are more likely to feature large tiles on both the floors and walls with horizontal listellos and bright colours being largely superseded by vertical or strip insets to add contrast and texture.
Neutral, earthy colourways are more in vogue than highly coloured mosaic patterns although these still have a place where one is seeking a stand out feature.
Whether one wants square tiles, or rectangular tiles, big or small, there is something for all tastes and many purposes but remember not all tiles are suitable for all uses.
Exterior tiles with their gritty, non-slip surface and frost-proof body to withstand temperature extremes, have come into their own for patios, terraces and courtyards. But they shouldn’t be mistaken for flagstone or pavers – exterior tiles need to be glued to a flat, stable surface.
The benefits of using tiles are their strength, durability and non-fade, mark-resistant qualities – you won’t see a stiletto heel indentation on a tile! They are easily cleaned and if cracked, one or more tiles can usually be replaced.
The trick is to buy a few extra tiles at the time of purchase.
In today’s design-savvy world there are plenty of ways to floor your home – and your friends! Tiles and timber, cork or carpet are but four options which offer
many design possibilities.
Kauri Warehouse Ltd is a leading supplier of New Zealand timbers,
specialising in recycled flooring. With stocks of rimu, matai, kauri and tawa we can help you match your existing
floor or help you create a superb look for your new build.
75 Huia Rd, Otahuhu. Ph 09 276 7633Monday to Thursday 8am-5pm, Friday 8am-4.30pm,
most Saturdays 9am-11am (please call ahead to confirm we’re open)
www.kauriwarehouse.co.nzR100061
![Page 56: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/56.jpg)
56 — Design and Build South East — 2015-2016 *Conditions apply.
extended life
time
structural w
arra
nty
Visit NZ’s largest pool display at 27 The Concourse, Henderson AUCKLANDOr contact us on 0800 432 100 or [email protected] aquatechnics.co.nz
Get smartGet smart, get cool, get an Aqua Technics pool
TURN YOUR DREAM INTO REALITY
Caprice Valentina Tasman
Regal
Get the pool you’ve always dreamt of from Aqua Technics. Our stunning range of fi breglass pools come with
revolutionary Pool ColourGuard® non-fading surface protection and a Lifetime Interior Surface Guarantee*.
Plus, they have a unique ceramic core for added heat retention and superior
strength. With over 20 pools and a selection of modern colours to choose from, we are
sure to have just the right one to complete the look of your outdoor area.
R20176
![Page 57: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/57.jpg)
Design and Build South East — 2015-2016 — 57
5B Nandina Ave, East Tamaki, Auckland. Phone (09) 272 8444
Thinking about decorative concrete?Permacolour can work with you on your new project and supply products for rejuvenating both external and internal concrete surfaces.
The range of options in concrete with Permacolour is wide, from colouring, resurfacing, sealing & staining.
These materials can change any surface to the look of brick, slate, stone and tile.
We are New Zealand’s largest and most experienced manufacturer and supplier of decorative concrete, covering the country and have the country’s largest display and shop in Auckland.
www.permacolour.co.nz R20116
Email [email protected] (09) 274 5496
www.pavingslab.co.nz
Suppliers of paving, pool surrounds, terrazzo concrete stair treads and special projects,
industrial precast and custom infrastructure.
R100066
The purchase of your very own swimming pool is an exciting time! A cool-off in summer, recreation for the kids and poolside barbecues have infinite appeal,
yet with so many swimming pool suppliers it can be difficult to know which one to choose.
If quality is important to you, then look no further than Aqua Technics. They have an award-winning range of technologically-advanced fibreglass pools which are stronger, look better and will last longer.
When you invest in a swimming pool from Aqua Technics, you can rest assured that your pool has been built to Australian/NZ Standard 1838/1994 under licence number BMP No. 520101, includes an Extended Lifetime Structural Warranty and comes with revolutionary Pool ColourGuard®
surface protection, for brilliant colour, guaranteed not to fade. In addition, a unique ceramic core construction increases heat retention and strength and provides the highest blister and osmosis resistance of any pool available.
There is no shortage of pool models and colours to choose from. Aqua Technics have 25 stylish pool models in a range of modern colours, so you are sure to find the perfect pool to complement your outdoor area.
And, you get more than a superior swimming pool, you also get professional service and advice. Aqua Technics Customer Consultants can help you choose just the right pool to suit your site and your family’s needs. Aqua Technics also take care of the plans, building consent and installation, so you don’t have to worry. Plus, they work closely with
some amazing partner companies, and can assist you in choosing fencing, paving, coping stones and landscapers.
When you purchase an Aqua Technics pool, you can have confidence that the installers are amongst the most experienced and knowledgeable in the business. This means installation is carried out with utmost precision and takes only one to two days (including excavation) in most cases.
Aqua Technics Pool Centre is located at 27 The Concourse, Henderson where there are eight inground pools, each landscaped to provide a vast range of designs and inspiration. Take the kids along for a swim, and you can try before you buy!
For more information about Aqua Technics Pools call 0800 432 100, email [email protected] or visit www.aquatechnics.co.nz
Take the plunge
![Page 58: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/58.jpg)
58 — Design and Build South East — 2015-2016
Wooden Gates Waiuku has been getting it right for more than 30 years. With a philosophy of ‘Crafted Without Compromise’ this family
business has grown to become one of New Zealand’s most trusted icons.
It’s their reputation for outstanding quality and service that is the reason their gates grace the entrance ways of thousands of homes all over New Zealand. Word of mouth can be the best advertising and Wooden Gates certainly have proved this is true.
They take a true ‘Artisan’ approach to every assignment with one craftsman working on each set of gates from the start to the finish. From carefully choosing the timber for that particular job, through measuring, marking out, cutting, laminating and joinery, until the gates are ready for the renowned Wooden Gates finish.
There’s no production line at Wooden Gates. It’s all the power of one and the pride a true master craftsman takes in his creation.
Wooden Gates Waiuku have over 50 designs or ■■
you can suggest your own. They are happy to help each client develop their own ideas.
Wooden Gates Waiuku is a close knit team who ■■
make only gates and related products. They don’t build houses or garages. They specialise in and are experts in the art of gate making and of course related items such as posts and fence panels.
Wooden Gates Waiuku also supplies all the ■■
essentials you will need for your entrance way. Hardware, automatic opening systems, remote controls, video intercom access and as you would expect from them, cutting edge GSM technology that enables you to control your gates and access systems from your phone.
Learn more about possibilities and pricing by having a chat with one of their team.
Gateway to styleWooden Gates Waiuku – A national icon for 30 years
HAPPY ClIENtS‘Excellent service at a competitive price. Highly recommended’ – Grant
‘An outstanding job by a very professional helpful company. Everyone we dealt with from office staff, designers, installers etc were extremely approachable and friendly. Would recommend this company fully!’ – Andrea
‘The end result is better than we thought. You matched our requirements exactly and gave good advice at the time of measure.’ – NatashaPhone 0800 966 336
Email [email protected] www.woodengates.co.nz
![Page 59: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/59.jpg)
Design and Build South East — 2015-2016 — 59
Mary’s garden may have looked a treat with silver bells and cockle shells – or maybe not – but when it comes to landscaping, gradient,
soil, section shape and size plus aspect as well as personal preference and individual creativity will all influence the outcome.
New builds will usually require the surrounding section to be totally beautified while existing homes may need only minimal changes although some gardeners may want to start over.
Before doing anything, homeowners need to do their research. Fortunately, free advice can be gleaned from many quarters such as garden centres, libraries, green-fingered neighbours, gardening clubs, books, magazines, and, of course, a multitude of websites.
While most advice will be sound, it often pays to talk to the professionals in order to avoid a garden mish-mash. If possible set aside a budget for landscaping so that a pleasing result is achieved.
Garden centres and nurseries will generally provide most of what is needed to furnish a garden but don’t be tempted into buying too much or too many plant varieties.
When it comes to trees think about their ultimate size and root structure and whether you require them for privacy, filtered light or fruit for the pantry.
Impulse buying can lead to gardening disasters. For example, some plants may not suit the soil or the location. Keep section size and plant size in mind; it is easy to overcrowd a garden when plants are young and haven’t reached full size. And it’s easy to be tempted by every flower and tree you have ever loved thus ending up with no particular style at all.
Most importantly, before you start buying or planting have a plan. Some gardeners are clever enough to formulate their own garden design but in many cases it is easier to consult a gardening professional or landscape designer.
Most can deliver as little or as much as the customer wants – plan only, do some of the work, do all of the work, do the work in stages, do it all at once... there are many options.
Such experts will listen to your ideas and also suggest ways to make the most of your section. Their eyes often see what yours don’t.
And if you have spotted a garden or two that
take your fancy, be bold, knock on the door and ask the homeowners to share their tips and advice.
If you are confident enough to tackle your own landscape design other issues will need consideration such as soil type, sun and shade, whether retaining or added drainage is needed, desired lawn type, paving, hedging, decks, pergolas, shelter, fencing, art works, pots and more.
Once you have prepared a plan, buy prudently, check out garden centre deals and, ensure plants are compatible to the location and with each other. Think about grouping plants and the work needed to maintain the style you want. Plan for seasonal planting such as establishing a veggie patch or additional flower beds in the future.
Consider the order of jobs to be done – hard landscaping, pathways, garden formation, edgings, lawns and more. Buy in bulk where you can – stones, bark, mulch, compost, paving and slabs.
Of course, you can ask for help from friends – have a paving party or a tree-planting day with a barbecue and drinks at the end. But, if the idea of achieving your dream garden is daunting, consult the experts – in no time at all you could be relaxing in your own Garden of Eden.
Checking out lie of the land
Modern Kiwi lifestyles rely as much on outdoor space as they do indoor retreats. Subsequently successful landscaping is key to enjoying an al fresco way of life.
![Page 60: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/60.jpg)
Storage Solutions
Order online www.bruns.co.nz
For blokes with sheds, families with laundries, farmers with tools, tradespeople with gear
and gardeners with shovelsR20164
BC0153 SC3426
STAND OUTfrom the crowd!
Make a STATEMENT with a metal fence!
Contact us today for a free quote.Metalcraft Roo�ng, 26 Trugood Drive, East Tamaki, AucklandT: 09 273 2820 E: sales.aucklandmanufacturing@metalcraftroo�ng.co.nz
www.metalcraftgroup.co.nz
Metalcraft Roo�ng is your local manufacturer and supplier for metal fencing;longrun roo�ng; metal tiles; gutters and downpipes. All manufactured from NZ Steel.
franklineasttamakifencingadvery135mmx90mm3mmbleed19052015version2.indd 1 22/05/2015 8:47:05 a.m.
MP3439
![Page 61: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/61.jpg)
Design and Build South East — 2015-2016 — 61
Beautify
your GARDEN
LONG LASTING COLOURDECORATIVE MULCH
R10
0101
Some people can’t see the wood for the trees but gardeners and landscapers who know the value of mulch will quickly recognise the value of Reharvest
Enviromulch, a 100 per cent wood chip mulch which not only enhances properties but has a significant impact on the health of plants.
There are six good reasons why Reharvest Enviromulch is different:
1. Plant growth is assisted: Reharvest Enviromulch is made from 100% recycled wood that’s air-dried. This process closes down the cells in the timber, which reduces its ability to hold water and thereby slows down the decomposition rate. It reduces the nitrogen demand from the soil, allowing the plants to absorb more of the fertiliser. Plants are better-fed, and able to grow healthily.
2. Weed growth is inhibited: You’d think that more nitrogen in the soil might mean more weeds? Wrong! For one thing, Reharvest Enviromulch is graded to an average length of 50mm, which makes it difficult for weeds to grow cutting down weeding and watering time. Unlike some bark chips, it is free from seeds and plant matter.
3. less watering required for plants in dry weather: Reharvest mulch shields the soil from the sun, so the soil’s surface is kept cool and allows water retention.
4. Stays in place: It’s so annoying when garden mulch starts moving and it can be a real problem on sloping sections. But Reharvest Enviromulch is a light product which mats together. This allows heavy rain to disperse through and under the
mulch later, helping the mulch to hold onto even the steepest of banks.
5. Outlasts other woodchips and bark chips: Tried and tested extensively, this garden mulch is still in great condition at least five years after its first installation. It is a low-maintenance, high-results option when it comes to garden mulches!
6. Available in different colours to suit your landscape: Reharvest Enviromulch comes in a range of decorative colours – red, brown and black – to suit different landscaping styles.
A non-toxic, safe product for all landscaping projects Reharvest Enviromulch offers many landscaping advantages – enquire now, phone 299 3999, visit us at 41a Hunua Road, Papakura or check out the website www.reharvest.co.nz
Chip off the block!
![Page 62: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/62.jpg)
62 — Design and Build South East — 2015-2016
drains.coresidential drainage specialist
Building or renovating?
YOU NEED US!Ph 0508 HOUSE DRAINS
We specialise in all aspects of drainage for new housing, plus on-site wastewater treatment plans and water tank installation.Quality workmanship is crucial to the success of any new housing project, and trouble-free drainage is a big part of the picture.And, because at drains.cowe share the same high standards as you, we know that we’re your perfect match.
Talk to drains.co, your drainage professionals, about ensuring the best options for your new home!
www.drains.co.nz
Residential Drainage SpecialistsWHEN QUALITY IS CRUCIAL
All pipes and fi ttings AS/NZ 1260 compliant
We’ll get the job done fast and effi ciently We show up when we say we will We stand behind our work Stormwater and sewer Wastewater design (TP58) Treatment plans and septics Water tanks Free consultancy
We’ll get the job done fast and effi ciently We show up when we say we will We stand behind our work Stormwater and sewer Wastewater design (TP58) Treatment plans and septics Water tanks Free consultancy
We specialise in all aspects of
treatment plans and water
crucial to the success of any
trouble-free drainage is a big
standards as you, we know
KAT3918
![Page 63: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/63.jpg)
Design and Build South East — 2015-2016 — 63
The award winning wastewater treatment and disposal system from Biolytix is the most energy ef�cient on-site secondary wastewater system on the market. The Biolytix uses a simple but ef�cient process in which Tiger Worms break down solids and contaminants in the waste. The highly treated wastewater is then reused to irrigate your lawns and gardens.
Approved installers Plumbcraft in Takanini can offer a complete turn-key solution to your wastewater problem including a wastewater report for Council, and the supply and installation of a Biolytix wastewater system all for a single competitive price.
WWW.BIOLYTIX.COM
Contact PlumbcraftTODAY on 09 296 7070for a free quote.
Do you need a Septic Tank or Wastewater Treatment System?
R100166-v2
PlANNING A NEW HOME – HOMEOWNERS CHECk lISt
Rain harvesting ■■
Water tanks■■
First flush diverters■■
Water tank fittings – soft inlets, ■■
floating inlets and vacuum outlets Water pumps – external or ■■
submersible water pumps Ultra violet disinfection and water ■■
filters Grey water recycling ■■
Water conservation devices ■■
Wastewater designs reducing ■■
wastewater volume Consider wastewater treatment ■■
options Simple septic systems■■
Secondary treated systems such as ■■
the Oasis Clearwater rangeEnsure adequate drainage■■
Install enough pit boxes and cesspits ■■
in the driveways and lawnsPlanned maintenance■■
Talk to drains.co your drainage professionals about ensuring the best options for your new home.
So you are planning to build a new home, how exciting is that! Your dreams take form in the idea of a place to live, a place to raise your family and the fun times to come.
Then reality sets in, building a home is hard work, it takes lots of planning and coordination, you need partners in this build that you can trust and who will help you with all those challenges.
That’s where the folks at Drains.co come in.We can help you or your builder with the less
glamorous but very necessary aspects of site requirements.
Where is your storm water going to? Are you going to harvest the water for a potable source or are you on town water supply and just need a detention tank or soak hole to recharge the aquifer?
How many tanks do you need, what size and what material – plastic or concrete? Where will you put them on site?
What waste water options are open to you?What is the soil like on your site as this
determines the disposal method. Will a simple septic
tank work or will you need a more complex solution?How large will your home be? How many people
will live there? Do you want to recycle or reuse water?
New home builders usually need some help with what’s required for these solutions and we are happy to help.
We have been helping people with their drainage for more than 30 years so we have plenty of experience and ideas on what works and some ideas on what doesn’t work so well.
We have a large team able to manage your requirements and work on multiple sites on any day. The size of our team enables us to be flexible around your schedule and we keep our gear in new condition so that it is ready to go when you need it.
So, don’t be put off by the challenges of planning and installing storm water drainage and waste water treatment. Drains.co are trusted by the building industry to get the job done.
Come and talk to us – Drains.co Ltd, corner of Great South and Quarry Road, Drury.
Water issues solved
KA
T39
26
We can provide your complete site preparation package.Contact us for your driveway metal and tidy-ups.
Trucks Trailers Excavators Bobcats Bulldozers Rollers Metal Sand Topsoil Pebbles Bark
We can provide your complete site preparation package.
Cartage & Earthmoving Contractors
www.pascoe.co.nz
Call us to discuss your requirementsPh 09 299 6213 or 0274 959 551
www.pascoe.co.nz
KA
T39
26www.pascoe.co.nz
![Page 64: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/64.jpg)
64 — Design and Build South East — 2015-2016
AUCKLAND SOUTHhome
SHOW
Get inspired at the 2015 Auckland South Home Show Ideas, innovations, samples, advice and prizes all in one place!
Vodafone Events CentreGreat South Rd, Manukau City
24th, 25th, 26th July10am to 5pm Adults $8 Kids under 15 FREE
facebook.com/AShomeshow
WINa New CarPrize package worth
$26,500!
CAR0711
Renovating, building, or browsing, Auckland South Home Show has everything you NEED and everything you WANT all under one HUGE roof.
On July 24-26 the Vodafone Events Centre will be transformed into a treasure trove dedicated to making your house a home.
Gadgets and kitchen aids, the latest products and the tricks of the trade, expert and experienced advice plus a whole range of great choices for every step of your project – all in one place for one BIG weekend.
Inspirational ideasat the 2015 Auckland South Home Show
The Vodafone Events Centre
Prizes such as the FL Bone top of the range Falcon Oven valued at $6,500 are up for grabs at the 2015
Auckland South Home Show.
There’s a building boom happening in Auckland South. Homeowners, renovators and DIYers are looking for inspiration, ideas and the latest innovations. Those boxes are ticked at the Auckland South Home Show. It’s the perfect place to find all that and more.
And the best bit is, there are prizes around every corner! It might be your lucky day and one of our big ticket prizes will be going home to your place including a brand new car and a top of the range Falcon oven valued at more
than $6,500 thanks to FL Bone!Whether your place is a doer-upper, a make-
doer, a mansion, a mouse-hole or a DIY dream at the Show there’s solutions that suit every plan.
You can see the whole range of options, ask questions, compare prices, get samples and all in one weekend.
Get your place sorted this winter by visiting the Auckland South Home Show from July 24-26 at the Vodafone Events Centre. Visit us online first at www.facebook.com/AShomeshow.
![Page 65: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/65.jpg)
Design and Build South East — 2015-2016 — 65
See the full range from Foreno Tapware at the Home Ideas Centre Stand 98.
Stainless Steel Sink Mixer FSSS1
R20174
Bishop’s Gate Business Centre2 Bishop Browne Pl, Flat BushAuckland 2013
phone 273 9114 email [email protected] www.ashbyarch.co.nz
CA
R07
37
visit our showroom located at29b Ben Lomond Cr, Pakurangae. [email protected]. www.amazinginteriors.co.nzp. 09 576 8190 m. 021 66 99 31
amazing interiors
concepts and furnishings for interior design inspiring spaces
creating stylish homes that sell quicker
We offer interior design and home staging services for both domestic
and commercial environments. Allow us to recreate an inviting and sophisticated atmosphere in your home, B&B or hotel. Give us a call or visit our showroom and let the
creative process begin.
visit our showroom located at29b Ben Lomond Cr, Pakurangae. [email protected]. www.amazinginteriors.co.nzp. 09 576 8190 m. 021 66 99 31
amazing interiors
concepts and furnishings for interior design inspiring spaces
creating stylish homes that sell quicker
We offer interior design and home staging services for both domestic
and commercial environments. Allow us to recreate an inviting and sophisticated atmosphere in your home, B&B or hotel. Give us a call or visit our showroom and let the
creative process begin.
RW
1254
We offer interior design andhomestaging services. Allow us to create an inviting and
sophisticated atmosphere in your home, B&B or hotel. Give us a call or visit our showroom and let the
creative process begin.
visit our showroom located at29b Ben Lomond Cr, Pakurangae. [email protected]. www.amazinginteriors.co.nzp. 09 576 8190 m. 021 66 99 31
L A N D D E V E L O P M E N TSpecialists in all aspects of
At Fraser Thomas, we have been working in the land developmentfield for over 40 years. We can provide your project with a full
range of professional services, for 2 lot subdivisions up tolarger scale residential or industrial developments.
Engineers Resource Managers Surveyors
Contact us today for your free copy of our Guide to Land Development and free initial consultation
www.fraserthomas.co.nzFree Phone: 0508 2 SURVEY (0508 2787839)
CA
R07
44
SHOWERDOME INSTALLERS
Contact Marty – ph 537 4252 mobile 021 653 770
Email: [email protected]
SC3424
Home and Commercial Renovations and Property Maintenance.
Painting Decks Fences
Door Locks to Full Renovations, no job too small!
directory� ������������������������������������������������������������������������
ACCREDITED BUILDING CONSENT AUTHORITY
Buildingor Buyingor Selling?
Residential, Commercial & Industrial Plan
Approvaland Compliance
Inspection Services
Pre-purchase Inspection Reports
Building Advice
Unauthorised Building Resolution
Ph 272 2269Fax 272 2270
Email: [email protected]
Unit 23/2 Bishop Dunn Place,Botany South, Auckland 2013
PO Box 217 012,Botany Junction 2164
www.compassbuilding.co.nzE512198
R20
115
Ph 09 298 567014 East Street, Papakura
Committed to exceptional service
5356
8
Kelly Flavell LawAssisting In Your Success
18 Uxbridge Road, Howick, PO Box 39056, Howick, Auckland 2145
For all your legal requirements
t: 09 535 2150 f: 09 535 2151 web: kelly� avell.co.nz
FIRES BY DESIGN47 Sir William Ave, East Tamaki, Auckland
Ph 273 9227 | www.warmington.co.nzOutdoor heating
can turn patio areas into a welcoming
and relaxing space.On a cool night,
nothing beats sitting around an outdoor fi replace, socialising
with friends or unwinding after a
long day.R100095
![Page 66: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/66.jpg)
66 — Design and Build South East — 2015-2016
WHY PAY RETAIL
WHEN YOU CAN
BUY WHOLESALE?OPEN Mon-Fri 7am-5pm; Sat 9am-1pm.
2-I Lady Ruby Dr, East Tamaki. Ph 253 9008 or 0274 939 003
BC0156
mullerlawLevel 1, Plaza Tower, Pakuranga PlazaPhone 576 7047 www.mullerlaw.co.nz
LAWYERSFOR ALL YOUR LEGAL NEEDS
Reliability, Integrity, Experience
CAR0719
We offer expert, impartial and confidential valuation advice for all buying, selling and bank purposes.
MANUKAU CITY 09 271 3820, PUKEKOHE 09 237 1144Warren Priest 021 284 9910, Richard Peters 027 483 9267,Patrick Beasley 027 233 1983, Charlene Smith 021 945 806K
AT
3911
R20
140
Financial Accounts Income Tax & GST Returns
Rental Property Returns Company Formations
Business and Personal Tax Advice
37 Papakura-Clevedon RoadClevedon VillagePhone 292 9470www.myersca.co.nz
Showroom open 5 daysMonday-Thursday 8am-5pm, Friday 8am-4pm
249 Moore Street, HowickP. 09 533 7183 E. [email protected]
W. www.labellakitchens.co.nz
5 Great Reasons to ChooseLaBella Kitchens...
1. No hidden costs2. Our copyright Installation Checklist©
3. Access to your own trained Interior Decorator and Kitchen Designer
4. An approachable friendly team5. Our after care service is second to
none
CAR0720
Building & Renovation Experts Since 1989 in NZ
BUILDING
RENOVATIONS
M: 021 050 1519 | Ph: 263 7090 | Unit 44, 18 Lambie Dr, Manukau
CAR0725
alfrescopizza ovens
the essence of a great new zealand lifestyle
ACCESSORIES
ALFRESCOPIZZA OVENS
PAVILIONOUTDOOR FIREPLACES
0800 298 [email protected]
AZTECFIRES.CO.NZ
AZTEC PAVILION OUTDOOR
FIREPLACES
KAT3923
Proudly manufactured here in New Zealand.Highest quality materials and methods.
Factory direct to your door. Professional installers for your area.No heavy lifting equipment or hi-ab truck needed.
�������������������������������������������������������������������������directory
A r c h i t e c t u r e
KV e l t m a n
i m
Ph: 527-6835 Email:
[email protected] Pakuranga Road,
Pakuranga
www.kimveltman.co.nz41 Jellicoe Road, Panmure
Phone (09) 570 2112 www.sanstone.co.nz
Specialists in outdoor living
![Page 67: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/67.jpg)
Design and Build South East — 2015-2016 — 67
Easy.From this point, till the day you move in, we are here to make things easy. Whether choosing from one of our plans, or creating something a little different, visit our website to discover the easiest way to get the home you want.
Select from over 60 plans or modify one to suit your needs. You can choose to manage the build yourself with an A1 Kit Home, or take it a step further and have us take care of it for you.
Call A1homes or visit our website to start building your home today.
Your big plans made easy.Contact: Tony Smith t: 09 238 1000 m: 021 880 380 e: [email protected]
Showhome: 8 Kilbryde Crescent, Pokeno
Open: Tues to Fri 10am - 3pm Sat 12pm - 3pm
Easy.From this point, till the day you move in, we are here to make things easy. Whether choosing from one of our plans, or creating something a little different, visit our website to discover the easiest way to get the home you want.
Select from over 60 plans or modify one to suit your needs. You can choose to manage the build yourself with an A1 Kit Home, or take it a step further and have us take care of it for you.
Call A1homes or visit our website to start building your home today.
Your big plans made easy.Contact: Tony Smith t: 09 238 1000 m: 021 880 380 e: [email protected]
Showhome: 8 Kilbryde Crescent, Pokeno
Open: Tues to Fri 10am - 3pm Sat 12pm - 3pm
Easy.From this point, till the day you move in, we are here to make things easy. Whether choosing from one of our plans, or creating something a little different, visit our website to discover the easiest way to get the home you want.
Select from over 60 plans or modify one to suit your needs. You can choose to manage the build yourself with an A1 Kit Home, or take it a step further and have us take care of it for you.
Call A1homes or visit our website to start building your home today.
Your big plans made easy.Contact: Tony Smith t: 09 238 1000 m: 021 880 380 e: [email protected]
Showhome: 8 Kilbryde Crescent, Pokeno
Open: Tues to Fri 10am - 3pm Sat 12pm - 3pm
Easy.From this point, till the day you move in, we are here to make things easy. Whether choosing from one of our plans, or creating something a little different, visit our website to discover the easiest way to get the home you want.
Select from over 60 plans or modify one to suit your needs. You can choose to manage the build yourself with an A1 Kit Home, or take it a step further and have us take care of it for you.
Call A1homes or visit our website to start building your home today.
Your big plans made easy.Contact: Tony Smith t: 09 238 1000 m: 021 880 380 e: [email protected]
Showhome: 8 Kilbryde Crescent, Pokeno
Open: Tues to Fri 10am - 3pm Sat 12pm - 3pm
53551-V4
Contact: Mareet Carleyt: 09 238 1000 m: 027 245 6857e: [email protected]
Showhome:8 Kilbryde Crescent, Pokeno
Open:Tues to Fri 10am - 3pm | Sat 12pm - 3pm
Easy.From this point, till the day you move in, we are here to make things easy. Whether choosing from one of our plans, or creating something a little different, visit our website to discover the easiest way to get the home you want.
Select from over 60 plans or modify one to suit your needs. You can choose to manage the build yourself with an A1 Kit Home, or take it a step further and have us take care of it for you.
Call A1homes or visit our website to start building your home today.
Your big plans made easy.Contact: Tony Smith t: 09 238 1000 m: 021 880 380 e: [email protected]
Showhome: 8 Kilbryde Crescent, Pokeno
Open: Tues to Fri 10am - 3pm Sat 12pm - 3pm
![Page 68: Design & Build South East 2015-2016](https://reader030.fdocuments.us/reader030/viewer/2022012406/579057601a28ab900c9d19b3/html5/thumbnails/68.jpg)
68 — Design and Build South East — 2015-2016
SHOWROOMS
AUCKLAND HAMILTON
TAUPO HASTINGS PALMERSTON NORTH LOWER HUTT
NATIONWIDE STOCKISTS www.danskemobler.nz
When you’re at home with Danske Møbler, quality, style, comfort and value are all part of the furniture.
PROUDLY NZ OWNED AND OPERATED SINCE 1958
At home with Danske MøblerDrapes and Blinds by Harvey Furnishings.
116600 Design-Build at home FP.indd 1 3/2/15 10:27:33 AM
R20172