Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a...
Transcript of Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a...
![Page 1: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/1.jpg)
Department of Plant Biology
![Page 2: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/2.jpg)
Putting the PMN (and TAIR) to work for you:
Tips and Techniques
for Accessing Data
for Plant Biology Research
Kate Dreher
TAIR, AraCyc, PMN
Carnegie Institution for Science
![Page 3: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/3.jpg)
n Introduction to the PMN
n Accessing data in the PMN
n Case study: Putting the PMN and TAIR to work for you
Overview
![Page 4: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/4.jpg)
p The Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc, etc.)
p www.plantcyc.org
p Curators and programmers at the PMN:
n Collect and store metabolic pathway information
n Provide tools to analyze data
n Work to generate new metabolic pathway databases for crops and other important plants
Welcome to the PMN
![Page 5: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/5.jpg)
PMN databases
p Current PMN databases: PlantCyc, AraCyc, PoplarCycn Coming soon: databases for wine grape, maize, cassava, Selaginella, and more . . .
p Other plant databases accessible from the PMN:
** Significant numbers of genes from these databases have been integrated into PlantCyc
PGDB Plant Source Status
RiceCyc ** Rice Gramene some curation
SorghumCyc Sorghum Gramene no curation
MedicCyc ** Medicago Noble Foundation some curation
LycoCyc ** Tomato Sol Genomics Network some curation
PotatoCyc Potato Sol Genomics Network no curation
CapCyc Pepper Sol Genomics Network no curation
NicotianaCyc Tobacco Sol Genomics Network no curation
PetuniaCyc Petunia Sol Genomics Network no curation
CoffeaCyc Coffee Sol Genomics Network no curation
![Page 6: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/6.jpg)
PMN database content statistics
PlantCyc 4.0 AraCyc 7.0 PoplarCyc 2.0Pathways 685 369 288Enzymes 11058 5506 3420Reactions 2929 2418 1707Compounds 2966 2719 1397Organisms 343 1 1*
![Page 7: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/7.jpg)
Getting information from PMN pathway pages
p Look empty???n Click on “More Detail”
p Better . . . but what about compound structures?n Keep clicking on “More Detail” – sometimes several times
![Page 8: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/8.jpg)
PathwayEnzyme Gene
Reaction
Compound
Evidence Codes
Getting information from PMN pathway pages
Regulation
Upstreampathway
![Page 9: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/9.jpg)
Getting information from PMN pathway pages
![Page 10: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/10.jpg)
Getting information from PMN pathway pages
Compound
![Page 11: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/11.jpg)
PMN compound pages
Compound:CDP-choline Synonyms
Appears as Product
Classification(s)
Molecular Weight / Formula
Appears as Reactant
![Page 12: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/12.jpg)
Getting information from PMN pathway pages
Enzyme
![Page 13: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/13.jpg)
PMN enzyme pagesArabidopsis Enzyme: phosphatidyltransferase
![Page 14: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/14.jpg)
PMN enzyme pages
Pathway(s)
Summary
References
Inhibitors, Kinetic Parameters, etc.
Arabidopsis Enzyme: phosphatidyltransferase
![Page 15: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/15.jpg)
Getting information from PMN pathway pages
Gene To TAIR, Gramene, SGN, etc. . .
![Page 16: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/16.jpg)
p PMN quick search bar
Searching in the PMN databases
choline
![Page 17: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/17.jpg)
Searching in PMN databases
![Page 18: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/18.jpg)
Specific search pages
![Page 19: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/19.jpg)
Additional search options
![Page 20: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/20.jpg)
p PlantCyc, AraCyc, PoplarCyc Enzymes:n include enzymes with
available sequence information from each database
p Reference Enzymes:n includes enzymes with
experimental support from both plant and non-plant species
MLSSKVIGDSHGQDSSYFLGWQEYEKNPFHESFNPSGIVQMGLAENQLSFDLIETWLEEHPEVLGLKKNEESVFRQLALFQDYHGLPAFKDAMAKFMGKIRENKVKFDTNKMVLTAGSTSANETLMFCLANPGDAFLIPAPYYPGFDRDLKWRTGVEIVPI
![Page 21: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/21.jpg)
Finding enzymes through BLAST
![Page 22: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/22.jpg)
Comparing across species
n Use general Comparative Analysis tools
![Page 23: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/23.jpg)
Visualizing OMICs datan Overlay “pre-cleaned” quantitative data sets on a metabolic map
p Gene transcription datap Proteomic datap Metabolomic data
n Only available for single-species databases, not PlantCyc
n Demonstrations available from 3:30 – 5:30 PM!
![Page 24: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/24.jpg)
Visualizing OMICs data
![Page 25: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/25.jpg)
Visualizing OMICs data
n Animation feature is available!
![Page 26: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/26.jpg)
Case study: Jasmonic acid biosynthesis
n You are studying jasmonic acid biosynthesis in your favorite plant
n You want to identify potential orthologs for all of the Arabidopsis enzymes associated with the pathway
![Page 27: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/27.jpg)
jasmonic acid
Case study: Jasmonic acid biosynthesis
![Page 28: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/28.jpg)
Take this gene list to TAIR to get sequences
jasmonic acid
Case study: Jasmonic acid biosynthesis
![Page 29: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/29.jpg)
Case study: Jasmonic acid biosynthesisn Obtain protein sequences for all of the enzymes
![Page 30: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/30.jpg)
Case study: Jasmonic acid biosynthesisn Obtain protein sequences for all of the enzymes
![Page 31: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/31.jpg)
Case study: Jasmonic acid biosynthesisn Blast enzymes against all Genbank Plant proteins in TAIR
n Or use UniProt, Genbank, your species-specific database, etc.
![Page 32: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/32.jpg)
Putting the PMN and TAIR to work for you
p Use the PMN to learn more about metabolic pathways
p Use TAIR to find detailed information for specific genes / proteins
p Use TAIR and the PMN to enhance your plant biology research
p If you’re having trouble getting any information you want . . .
![Page 34: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/34.jpg)
We appreciate YOUR help!
![Page 35: Department of Plant Biology - Amazon Web Services...pThe Plant Metabolic Network (PMN) maintains a set of metabolic pathway databases for Arabidopsis and other plants (AraCyc, PlantCyc,](https://reader033.fdocuments.us/reader033/viewer/2022050400/5f7e76fe34993d23ef1e7166/html5/thumbnails/35.jpg)
PMN and TAIR Acknowledgements
Current Curators:-Tanya Berardini (lead curator)- Philippe Lamesch (lead curator)- Donghui Li (curator)- Dave Swarbreck (former lead curator)
- Debbie Alexander (curator)- A. S. Karthikeyan (curator)- Marga Garcia (curator)- Leonore Reiser
PMN Collaborators:- Peter Karp (SRI)- Ron Caspi (SRI)- Suzanne Paley (SRI)- SRI Tech Team- Lukas Mueller (SGN)- Anuradha Pujar (SGN)- Gramene and MedicCyc
Sue Rhee (PI - PMN)Eva Huala (PI-TAIR)
Peifen Zhang (Director-PMN) Current Tech Team Members:- Bob Muller (Manager)- Larry Ploetz (Sys. Administrator)- Anjo Chi- Raymond Chetty - Cynthia Lee- Shanker Singh- Chris Wilks
PMN project post-doc- Lee Chae