Contribution of Residue B5 to the Folding and Function of Insulin and IGF-I. CONSTRAINTS AND FINE TUNING IN THE EVOLUTION OF A PROTEIN FAMILY

Youhei Sohma1>, Qing-xin Hua2>, Ming Liu3>, Nelson B. Phillips2, Shi-Quan Hu2, Jonathan Whittaker2, Linda J. Whittaker2, Aubree Ng4>, Charles T. Roberts, Jr.4,

Peter Arvan3, Stephen B. H. Kent1*, & Michael A. Weiss2* Running title: Folding and Function of IGF-I

1Departments of Biochemistry & Molecular Biology and Chemistry, University of Chicago, Chicago, IL 60637

2Department of Biochemistry, Case Western Reserve University, 10900 Euclid Ave, Cleveland, OH 44106 3Department of Medicine, University of Michigan, Ann Arbor, MI 48109

4Oregon National Primate Research Center, Beaverton, OR 97006, and Department of Medicine, Oregon Health & Science University, Portland, OR 97239

>These authors contributed equally. *Address Correspondence to: M.A. Weiss (maw21@case.edu). Proinsulin exhibits a single structure whereas insulin-like growth factors refold as two disulfide isomers in equilibrium. Native IGF-I has canonical cystines (A6-A11, A7-B7, and A20-B19) maintained by IGF-binding proteins (IGFBPs); IGF-swap has alternative pairing (A7-A11, A6-B7, and A20-B19) and impaired activity. Studies of mini-domain models suggest that residue B5 (His in insulin and Thr in IGFs) governs the ambiguity or uniqueness of disulfide pairing. Residue B5 – a site of mutation in proinsulin causing neonatal diabetes – is thus of broad biophysical interest. Here, we characterize reciprocal B5 substitutions in the two proteins. In insulin HisB5→Thr markedly destabilizes the hormone (ΔΔGu 2.0 ± 0.2 kcal/mole), impairs chain combination, and blocks cellular secretion of proinsulin. The reciprocal IGF-I substitution ThrB5→His (residue 4) specifies a unique structure with native 1H-NMR signature. Chemical shifts and nuclear Overhauser effects are similar to those of native IGF-I. Whereas wild-type IGF-I undergoes thiol-catalyzed disulfide exchange to yield IGF-swap, HisB5-IGF-I retains canonical pairing. Chemical denaturation studies indicate that HisB5 does not significantly enhance thermodynamic stability (ΔΔGu 0.2 ± 0.2 kcal/mole), implying that the substitution favors canonical pairing by destabilizing competing folds. Whereas the activity of ThrB5-insulin is decreased fivefold, HisB5-IGF-I exhibits twofold-increased affinity for the IGF receptor and augmented post-receptor signaling. We propose that conservation of ThrB5 in IGF-I – rescued from structural ambiguity by IGFBPs – reflects fine tuning of signal transduction. In contrast, the conservation of HisB5 in insulin by contrast highlights its critical role in insulin biosynthesis.

Introduction

The vertebrate insulin-related superfamily consists of insulin, insulin-related growth factors (IGF-I and IGF-II (1,2), relaxin (3,4,5,), and relaxin-related factors (6-9)).1 Insulin and IGFs function as ligands for receptor tyrosine kinases (the insulin receptor and Type 1 IGF receptor; IR and IGF-1R) (10), whereas relaxin and related factors bind to G-protein coupled receptors (GPCRs) (11). Interest in the evolution and folding properties of insulin-related polypeptides has recently been invigorated by the discovery of mutations in the human insulin gene associated with permanent neonatal-onset diabetes mellitus (12). These dominant mutations impair the foldability of variant and (in trans) wild-type proinsulin, leading to β-cell dysfunction, endoplasmic-reticular (ER) stress and impaired β-cell viability (13). One such mutation occurs at position B5 (12,14). Insulin contains a conserved His at B5 whereas IGF-I contains a conserved Thr (Table 1). In this article we investigate reciprocal substitutions in these proteins – ThrB5 in insulin and HisB5 in IGF-I – as probes of competing evolutionary constraints among otherwise homologous sequences.2 IGFs are single-chain polypeptides containing A- and B domains, an intervening connecting (C) domain, and C-terminal D domain (Fig. 1A) (1,2); insulin (like relaxin and related factors) contains two chains (designated A and B; Fig. 1B) as a consequence of proteolytic processing in the trans-Golgi network (3-5,15). Crystal structures of IGF-I and insulin exhibit similar α-helical domains (Fig. 1A, B) (1-9). Protein folding is linked to specific disulfide pairing. The canonical cystines in insulin are A6-A11, A7-B7, and A20-B19, and the

http://www.jbc.org/cgi/doi/10.1074/jbc.M109.062992The latest version is at JBC Papers in Press. Published on December 3, 2009 as Manuscript M109.062992

Copyright 2009 by The American Society for Biochemistry and Molecular Biology, Inc.

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

corresponding cystines in IGF-I are at polypeptide positions 47-52, 6-48 and 18-61. Whereas the six cysteines and selected core residues are broadly conserved throughout the vertebrate insulin-related superfamily (Table 1; see also Supplemental Table S1 online), other residues are restricted to particular proteins. An example is residue B5: its restricted conservation suggests distinct IGF- and insulin-specific contributions to structure or function. B5 side chains occupy similar but not identical structural environments in IGF-I and insulin. The side chains project in each case into an inter-domain crevice adjoining cystine A6-A11 and buttressing the solvent-exposed A7-B7 disulfide bridge (Fig. 1C, D) (15-17). The respective N-terminal arms of IGF-I and insulin (residues 1-3 and B1-B4, respectively) exhibit different orientations (arrows in Fig. 1A, B). An imidazolic NH of HisB5 in insulin (green ball in Fig. 1D) donates one or bifurcating hydrogen bonds to A-chain carbonyl oxygens (red balls; see also Supplemental Table S2), proposed to facilitate the folding of proinsulin (18,19). An AlaB5 substitution in insulin impairs chain combination whereas binding to the insulin receptor (IR) is decreased by less than twofold (18). Although the side chain of ThrB5 in IGF-I is not well ordered in solution (20,21) and variably positioned in crystal structures (16,17), its β-OH group (green ball in Fig. 1C) can be oriented to donate an analogous hydrogen bond to an A-domain carbonyl oxygen (red) (see Supplemental Table S2 online). HisB5-IGF-I exhibits native interactions with IGF-binding proteins (IGFBP) with twofold enhanced binding to the IGF receptor (IGF-1R) (22). IGF sequences anomalously encode two alternative structures in equilibrium (Fig. 2A) (23-27). Native IGF-I retains canonical disulfide pairing whereas IGF-swap exhibits the alternative pairing A7-A11, A6-B7, and A20-B19 (IGF-I positions 46-52, 6-47 and 18-61). The non-native isomer is at least twenty-fold less active (26). 1H-NMR studies have demonstrated that IGF-swap possesses a well-organized three-dimensional structure with salient differences from that of native IGF-I (26,28). The alternative structure is as stable (or more stable) than native IGF-I as probed by thiol-catalyzed disulfide exchange (26) and chemical denaturation (29). Proinsulin in contrast refolds to form a unique ground state (30); disulfide isomers exist only as metastable kinetic traps (29,31,32). Striking similarities are nonetheless observed between the solution

structures of IGF-swap and insulin-swap (Fig. 2B) (28). Such structural similarity suggests that one or a few sites of sequence difference might account for the contrasting refolding properties of proinsulin and IGF-I. The defective folding properties of IGF-I are circumvented in vivo by selective binding of native IGF-I to IGFBPs (33,34). Studies of inactive mini-IGF-I models (lacking C and D domains) and corresponding mini-proinsulin analogues suggest that this distinction is mediated by differences between B domains (35-37). Construction of chimeric models has highlighted the proposed role of residue B5: substitution of Thr4 in mini-IGF-I by His led to unique canonical pairing (19). Interpretation of these studies has remained uncertain, however, as the crystal structure of mini-IGF-I-swap (38) (Fig. 2C) was found to exhibit marked and unexpected differences from the structures of either IGF-swap (28) or insulin-swap (Fig. 2B) (32).3 These structural differences imply that the conformational equilibrium between mini-IGF-I and mini-IGF-I-swap may be unrepresentative of the intact proteins.4 It is therefore of interest to investigate effects of HisB5 in native IGF-I and effects of ThrB5 in insulin. To this end, we have introduced reciprocal B5 substitutions into insulin and IGF-I. Our studies yield asymmetrical outcomes. In insulin ThrB5 profoundly destabilizes the native state but does not promote isomer formation. In IGF-I HisB5 enables unique disulfide pairing (native IGF-I) by selectively destabilizing the competing fold (IGF-swap). Why is a folding-defective residue excluded in insulin but conserved in IGF-I? On the one hand, we demonstrate that ThrB5 blocks the secretion of proinsulin in a human cell line and so presumably would cause β-cell dysfunction in vivo (39). On the other hand, IGF-IGFBP co-evolution has circumvented the role of residue B5 in folding, allowing sequence variation associated with fine tuning of IGF-1R signaling in growth, development, and cellular homeostasis. Taken together, our results suggest that the absence or presence of folding partners can profoundly alter the fitness landscape of a protein sequence.

MATERIALS AND METHODS

Synthesis of ThrB5-insulin—The protocol for

solid-phase synthesis is as described (40). The wild-type A-chain was obtained by oxidative sulfitolysis of human insulin as described (18,41).

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

ThrB5 B-chain was prepared by automated 9-fluorenylmethoxycarbonyl (Fmoc)-based synthesis and derivatized by S-sulfonation. Insulin chain combination was achieved as described (41). Purification of ThrB5-insulin was accomplished by cation-exchange chromatography (CM-52, 24 x 1.2 cm, Whatman, Clifton, NJ) using acetate buffer pH 3.3 and a NaCl gradient. Final purification was by reverse-phase high-performance liquid chromatography (rp-HPLC) using a C18 column with a 0.1% trifluoroacetic acid (TFA)/acetoniltrile solvent system. Combination of 40 mg of A-chain and 20 mg of the variant B-chain resulted in a final yield of 1.1 mg. The corresponding yield of wild-type chain combination under these conditions is ca. 4.0 mg. The purified analogue was observed to be a single component on analytical rp-HPLC (C18 column, 25 x 0.46 cm) using two independent elution gradients, acetonitrile in 0.1% TFA and methanol in 0.1% TFA. Since insulin isomers exhibit very low affinity for IR, native disulfide pairing was implied by the higher residual receptor-binding affinity of the analogue (Fig. 3C; see Results). The yield of chain combination was reduced by fourfold relative to wild-type chain combination; no non-native isomers were encountered in the course of chain combination. The matrix-assisted laser desorption-ionization (MALDI) mass spectrum of the product was in accord with its predicted value (5770.4 Da).

Synthesis of HisB5-IGF-I—Total chemical synthesis of HisB5-IGF-Iwas based on native chemical ligation of three unprotected peptide segments as described for native IGF-I(42) (see Supplemental Fig. S1 online). HisB5-IGF-1[1-17]αthioester-(Arg)4-Ala-OH was prepared by in situ neutralization Boc chemistry stepwise solid phase peptide synthesis (43) on HSCH2CH2CO-(Arg)4-Ala-OCH2-Pam-resin (44) (ESI-MS: observed, 2581.2 ± 0.3 Da; calculated, 2581.9 Da). Ligation of IGF-I[Thz18-47]αthioester and IGF-I[Cys48-70] was complete in 14 h. IGF-I[Thz18-70] was quantitatively converted to IGF-I[Cys18-70] in 3 h by the addition of 0.2 M methoxylamine·HCl to the crude ligation mixture, at pH 4. After solid-phase extraction and lyophilization, ligation of the HisB5-IGF-I[1-17]αthioester and crude IGF-1[Cys18-70] was performed. This ligation made use of high concentration (200 mM) of (4-carboxylmethyl)thiophenol (MPAA), an improved aryl thiol catalyst for high yield ligation at a hindered Val-Cys site (45). The HisB5-IGF-I[1-17]αthioester-(Arg)4-Ala-OH contained a solublizing “Arg-tag” in the C-terminal region (44). Reaction of IGF-I[1-17]αthioester and IGF-I[Cys18-70] (2 mM each) was ca. 70–80% complete in 18 hr, yielding the final full-length reduced product. HPLC purification provided

pure, reduced full-length IGF-I(SH)6 (see Supplemental Fig. S2 online). Cellular Expression and Folding of Proinsulin—Plasmids encoding human proinsulin or B5 variants in mammalian cell culture to enable analysis of protein folding and secretion as described (18,46). A control for an uncleaved preproinsulin was provided by a cleavage-site mutation associated with neonatal DM (AspS24 in the signal sequence (12)). In brief, HEK293T cells (human) were cultured in high-glucose Dulbecco’s modified Eagle’s medium containing 10% fetal bovine serum and 0.1% penicillin/streptomycin at 37° C with 5% CO2. For metabolic labeling, cells were plated into 6-well plates 1 day before transfection. Plasmid DNA (2 μg) was transfected into each well using Lipofectamine (Invitrogen). At 40 h post-transfection cells were pre-incubated in methionine/cysteine-deficient medium with or without 10 μg/ml tunicamycin (TM) as indicated for 30 min, metabolically labeled in the same medium containing 35S-labeled Met and Cys for 30 or 60 min, washed once with complete medium, and chased in complete medium with or without 10 μg/ml TM at different time points as indicated (35). After chase media were collected, and cells were lysed in 100 mM NaCl, 1% Triton X-100, 0.2% sodium deoyxcholate, 0.1% SDS, 10 mM EDTA, and 25 mM Tris-HCI (pH 7.4) with protease inhibitors. Lysates were immunoprecipitated with guinea pig anti-insulin antiserum (LINCO Diagnostics) and analyzed by Tris-tricine-urea-SDS-PAGE under non-reducing conditions or reducing conditions as indicated (18,47). For treatment with peptide N-glycosidase F (PNGase F), the anti-insulin immunoprecipitates were incubated with PNGase F at 37° C for 1 h prior to gel analysis. Refolding of IGF-I and HisB5-IGF-I—Redox-coupled folding was effected in the following conditions: ~0.5 mg per ml IGF-I(SH)6 or HisB5-IGF-I, 20 mM Tris-HCl (pH = 7.7), 8 mM cysteine, 1 mM cystine·HCl, and 0.5 M guanidine hydrochloride (GnHCl). Folding, as monitored by liquid chromatography-mass spectrometry (LCMS), was almost complete in at < 1 min (to yield native IGF-I and IGF-swap) for wild-type sequence whereas folding of the variant sequence (to yield a single product) was ~half complete at < 1 min; folding was thus extended for 5 hours. Whereas refolding of the native polypeptide yielded two predominant products, refolding of the variant yielded a single dominant product (see Results). Following oxidation, the mass of the

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

protein decreased by 6.6 ± 0.7 Da in each case, indicating the formation of three disulfide bonds. Principal components of the folding reaction were purified by preparative C18 rp-HPLC, enabling native IGF-I, IGF-swap, and HisB5-IGF-I to be obtained. Respective overall yields of native IGF-I and HisB5-IGF-I were 6.7 and 8.3% from peptide segment IGF-I[Cys48-70]. Disulfide pairing in the variant protein was established by NMR fingerprinting (Results). Synthesis of HisB5 Two-Chain Hybrid—The wild-type insulin A-chain S-sulfonate was combined with a 29-residue B-chain derived from the B-domain of IGF-I in which Thr4 was substituted by His (canonical position B5). The IGF-I-derivated peptide was synthesized and purified as in the synthesis of human insulin analogues (41). Combination of 30 mg of A-chain and 15 mg of the variant B-chain resulted in a final yield of 0.9 mg. The corresponding yield of wild-type chain combination under these conditions is ca. 3.0 mg. The matrix-assisted laser desorption-ionization (MALDI) mass spectrum of the product was in accord with its predicted value (5562.8 Da). Receptor-Binding Assays—Dissociation constants for binding of insulin, IGF-I, and respective B5 analogues to IR were determined in competitive radio-ligand binding assays with 125I-TyrA14 human insulin. The assay employed the B isoform of IR (IR-B). Experimental details are provided as Supplemental Material online. In brief, assays were performed with the isolated IR-B with a C-terminal FLAG tag were determined using a microtiter plate antibody capture technique as described (48). Microtiter strip plates (Nunc Maxisorb) were incubated overnight at 4° C with FLAG M2 IgG (100 µl/well of 40 μg/ml in phosphate-buffered saline). In all assays, the percentage of tracer bound in the absence of competing ligand was less than 15% to avoid ligand-depletion artifacts. Dissociation constants of analogues were obtained by non-linear regression analysis of binding data by the method of Wang (49); this employs an exact mathematical expression to describe the competitive binding of two different ligands to a receptor. A corresponding microtiter plate antibody assay using IGF-1R was employed to assess binding of insulin, IGF-I, and respective B5 analogues to this homologous receptor using 125I-Tyr31 IGF-I as tracer (50). Results are summarized in Table 2. Control studies of cellular extracts in the absence of prior transfection of the epitope-tagged receptor constructs (either IR or IGF-1R) demonstrated that

background binding to endogenous cellular proteins was negligible. Cellular Studies of IGF-I Signaling—Mouse anti-Akt antibody was from Cell Signaling Technologies (Beverly, MA); rabbit anti-phospho-Akt (pSer493) was from Invitrogen/BioSource (Carlsbad, CA); mouse Cy5-labeled IgG and rabbit Cy3-labeled immunoglobulin G (IgG) secondary antibodies were from GE Healthcare/Amersham. An IGF-1R-deficient mouse embryo fibroblast cell line expressing the human IGF-1R was provided by Prof. R. Baserga (51). Akt phosphorylation as a parameter for activation of the IGF-IR signaling pathway was assayed essentially as previously described (52). In brief, cells were treated with 0.1-10 nM ligand for 5 min and lysed in sodium dodecyl sulphate (SDS) sample buffer without DTT or bromophenol blue and boiled immediately to inhibit protease and phosphatase action. Protein concentration was determined with a detergent-compatible protein assay kit (Bio-Rad, Hercules, CA). Dithiothreitol (100 mM) and bromophenol blue (0.1%) were then added. Whole-cell lysates (20 mg) were subjected to reducing SDS-PAGE on 10% Criterion gels (Bio-Rad), and resolved proteins were transferred to Immobilon FL PVDF membranes (Millipore Corp., Billerica, MA). Blots were probed simultaneously with the Akt and phospho-Akt antibodies (1:2500 and 1:1000 dilutions, respectively), washed thrice with Tris-buffered saline Tween-20 (TBS-T), and then probed with a combination of the Cy-3 and Cy-5 labeled secondary antisera (1:5000 dilution each). Membranes were washed again 3 times with TBS-T buffer, dried, and fluorescent images were captured and quantified using a Fluorchem Q imaging system (Alpha Innotech, San Leandro, CA). Paired Student’s t tests were used for all statistical analyses. Significance was accepted at P < 0.05. Disulfide Reassortment—β-Mercaptoethanol-catalyzed disulfide exchange was assessed by the the method as described (26). In brief, purified IGF-I or HisB5-IGF-I was dissolved in 50 mM sodium phosphate (pH 7.5 at 20° C) containing 1 mM ethylene-diamine-tetraacetic acid (EDTA) at a protein concentration of 100 µg/mL (13 µM). The solutions were incubated at 20° C after initiating the disulfide-exchange reaction. To catalyze exchange, a freshly made stock solution of 0.02% (v/v) β-mercaptoethanol was added to a final concentration of 0.001% (v/v) (0.17 mM). Aliquots were removed after overnight incubation,

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

quenched with tenfold excess 0.1% TFA and analyzed by rp-HPLC. Sample were applied through an autosampler onto a Vydac RP-C4 column (214TP54, 250 x 0.46 cm; Grace Vydac, Hesperia, CA), at a flow rate of 1 ml/min. The proteins were eluted with an acetonitrile gradient using a solvent system consisting of 0.1% aqueous TFA (solvent A) and acetonitrile containing 0.1% TFA (solvent B). Proteins were also eluted with an alternate gradient system consisting of 0.1% TFA and methanol. Protein elution was monitored at 215 nm using a dual-lambda 2487 absorbance detector. Data acquisition and processing utilized the Waters Breeze HPLC software. A parallel sample set was also analyzed at 37° C. Circular Dichroism—Far ultra-violet CD spectra were acquired using an Aviv spectropolarimeter equipped with thermister control. Samples were made 30-50 μM in 140 mM NaCl and 10 mM sodium phosphate at pH 7.4 (phosphate-buffered saline; PBS) and observed at 4 or 25o C in quartz cuvettes with a pathlength of 1 mm. Samples were diluted to 5 μM for protein denaturation studies. Guanidine-induced denaturation data at 4° or 25° C were fitted by non-linear least squares to a two-state model as described (53). NMR Studies of IGF-I and HisB5-IGF-I—1D and 2D 1H-NMR spectra of IGF-1, IGF-swap, and HisB5-IGF-I were obtained at 700 MHz in 10% deuterated acetic acid (dAA) at 40° C as described (21,28,54). These conditions have previously been employed in NMR studies of IGF-I and its analogues (55). 2D NOESY (mixing time 200 ms) total correlation spectroscopy (TOCSY; mixing time 55 ms) spectra were obtained in 10% dAA and 90% D2O. Resonance assignment of the 1H-NMR spectrum of native IGF-I was independently obtained based on 15N-based heteronuclear NMR studies (56); results were consistent prior studies (21,54). Presumptive assignment of the spectrum of HisB5-IGF-I was obtained by analogy.

RESULTS

Our results are presented in two parts. We first describe the synthesis of ThrB5-insulin and effects of the substitution on structure, stability, activity, and cellular biosynthesis. Investigation of the reciprocal IGF-I analogue is then described in relation to native IGF-I and IGF-swap. HisB5-IGF-I exclusively exhibits native disulfide pairing. I. Studies of an Insulin Analogue

Characterization of ThrB5-insulin. Insulin chain combination recapitulates the native folding of proinsulin (57); combination of IGF-I-derived A- and B-domain peptides likewise yields disulfide isomers corresponding to native IGF-I and IGF-swap (58). Combination of the ThrB5 insulin B-chain with the wild-type A-chain yields a single predominant product with an efficiency fourfold lower than that of wild-type chain combination. Analysis of the crude chain-combination mixture by rp-HPLC revealed several side products (cyclic A- and B chains and B-chain dimer) but none with the mass of the insulin analog. This purified product exhibited the predicted mass (5770.4 Da) and was found to be a single component following rp-HPLC using two independent elution co-solvents in either 0.1% TFA/acetonitrile or 0.1% TFA/methanol. These HPLC systems readily resolve insulin disulfide isomers (29). The ThrB5 substitution perturbs the structure of insulin as probed by CD spectroscopy (Fig. 3A) and causes a marked reduction in thermodynamic stability as probed by guanidine denaturation at 4° C (Fig. 3B). Application of a two-state model provided estimates of respective free energies of unfolding (ΔGu) of 4.4 ± 0.1 kca/mole (wild-type insulin) and 2.4 ± 0.1 kcal/mole (ThrB5-insulin). The extent of destabilization (ΔΔGu 2.0 ± 0.2 kcal/mole) is more severe than ordinarily observed in studies of mutant insulins but similar to that previously observed in studies of an AlaB5 analogue (18). Relative to AlaB5, therefore, introduction of a longer side chain and potential hydrogen bond donor and acceptor (the β-OH group of Thr) into the B5-related inter-chain crevice does not augment stability. These analogues each exhibit attenuated helix-associated CD features, presumably representing transmitted perturbations in structure or dynamics. The affinity of ThrB5-insulin for IR (isoform B) is reduced by ca. fivefold relative to human insulin (Fig. 3C). Wild-type and variant hormone-receptor dissociation constants in vitro are 0.06 ± 0.01 and 0.33 ± 0.04 nM, respectively (Table 2). The cross-binding of ThrB5-insulin to IGF-1R is reduced by ca. Sixfold relative to that of wild-type insulin (respective dissociation constants were 53.8 ± 5 and 8.7 ± 1.3 nM; Fig. 3D). Within statistical uncertainties the extent of reduction in affinities to IR and IGF-1R is congruent. The activity of ThrB5-insulin is at least twofold lower than that of an AlaB5 analogue (18) but fourfold higher than that

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

of non-native disulfide isomers of wild-type sequence (18). Effects on Proinsulin Biosynthesis. Insulin undergoes a complex pathway of biosynthesis in pancreatic β-cells (Fig. 4A). Folding and trafficking of variant proinsulins were evaluated in live HEK293T cells transfected with human preproinsulin cDNA bearing or lacking mutations. Following transfection, cells were pulse-labeled with 35S-amino acids for 1 hour and then chased for 1 hour in order to examine expression, disulfide isomer formation, and secretion of newly-synthesized proinsulin (Fig. 4B, C). Denaturing polyacrylamide gel electrophoresis (Tris-tricine-urea-SDS-PAGE) in the absence of reducing agent permitted examination of distinct proinsulin disulfide isomers as formed in the ER. The wild-type construct (lanes 3 and 4 in Fig. 4B) gave rise to robust expression, primarily of a fast-migrating band; previous studies have established that this is the native species (46,59). This is efficiently secreted from transfected cells ("C" in Fig. 4) to medium ("M"). Two minor species are also present as slower-migrating isomers with mispaired disulfide bonds; these exhibit lower secretion efficiency (brackets, Fig. 4B). Substitution of HisB5 by Met or Glu markedly impairs expression (lanes 5 and 7 in Fig. 4B) and increases the fraction that forms mispaired disulfide isomers in the ER (lanes 5 and 7 in Fig. 4B); moreover, secretion is blocked (lanes 6 and 8). ArgB5-proinsulin exhibits efficiencies of folding and secretion similar to those of wild-type proinsulin (lanes 11 and 12 in Fig. 4). Strikingly, folding of ThrB5-proinsulin leads to a product of higher molecular mass (lane 9, asterisk in Fig. 4) that is not secreted (lane 10). The marked shift in electrophoretic mobility might be the result of three possible molecular perturbations: (i) aberrant aggregation of the mutant proinsulin leading to inter-molecular disulfide bridges; (ii) failure of cleavage of the signal peptide leading to expression of a mutant preproinsulin; or (iii) anomalous post-translational modification giving rise to increased molecular mass and decreased mobility. The latter mechanism was suggested by the fortuitous creation of a potential N-linked glycosylation site (AsnB3-GlnA4-ThrB5) (60) following substitution of HisB5. To distinguish between these possibilities, SDS-PAGE analysis was performed under non-reducing or reducing conditions (left-hand and right-hand panels of Fig. 5A, respectively). On reduction, proinsulin and proinsulin analogues

behave as random-coil polypeptides, and so their electrophoretic mobilities on denaturing SDS-PAGE reflect molecular mass. DTT reduction of wild-type insulin led to collapse of discrete disulfide isomers (lane 2 in Fig 5A) to a single band of reduced mobility (lane 7). DTT reduction of the ThrB5-associated set of bands (lane 3 in Fig. 5A) likewise led to a single band (lane 8) whose mobility is proportionately reduced relative to the reduced wild-type polypeptide (lane 7). The relative mobility of ThrB5-proinsulin-associated polypeptide (lane 8 in Fig. 5A) is slower than either that of wild-type proinsulin (lane 7) or that of AspS24-preproinsulin (lane 12); the latter is a clinical variant, recently discovered in a patient with neonatal-onset diabetes mellitus (12) that we and others predicted to be defective in signal-peptide processing. Failure to match the mobility of either proinsulin or preproinsulin indicates that anomalous mobility of biosynthetic ThrB5-proinsulin is not due to either aberrant inter-molecular disulfide bridges or failure of signal-peptide cleavage. The expressed intracellular proteins were further characterized for possible N-linked glycosylation in the ER either by digestion of the extracted proteins with PNGase F (which removes N-linked carbohydrates), or by synthesis in cells treated with tunicamycin (TM, which inhibits the addition of N-linked glycans (61)). Following digestion with PNGase F, the gel mobility of ThrB5-proinsulin (lanes 4 and 9 in Fig. 5A) reverted to that seen for wild-type proinsulin (lanes 2 and 7). This finding indicates that the anomalous mobility of ThrB5-proinsulin is due to a novel N-linked glyosylation. Further support for this conclusion was obtained in cells treated with TM in which an additional set of ThrB5-associated bands (lanes 6 and 11 in Fig. 5A) was observed similar to those of wild-type proinsulin (lanes 2 and 7). To address whether the impaired secretion of ThrB5-proinsulin was strictly a result of aberrant glycosylation, we performed pulse-chase experiments in the absence and presence of TM. Intracellular (C) and secreted fractions of proinsulin (M) were analyzed by SDS-PAGE under reducing conditions (Fig. 5B). The key result was obtained on comparison of secreted proteins after a chase period of 2 hours. Whereas wild-type proinsulin is efficiently secreted regardless of the presence of TM (lanes 4 and 10 in Fig. 5B), the secretion of ThrB5-proinsulin is blocked even when produced as an unglycosylated

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

species (lane 13 in Fig. 5B). Because ThrB5 markedly impairs the stability of insulin in vitro (above), we further compared the intracellular expression of ThrB5-proinsulin to that of two partially folded mutant proinsulins: a two-disulfide analogue containing pairwise substitution of CysA6 and CysA11 by Ser (and so lacking cystine A6-A11; lanes 17 and 18 in Fig. 4C), and an analogue containing core substitution IleA2 →Gly (lanes 19 and 20). Biophysical studies of these analogues have previously been described in the context of an engineered monomer (DKP-insulin) (62). The two-disulfide analogue is a molten globule of marginal stability lacking the A1-A8 α-helix; GlyA2-insulin also exhibits segmental unfolding of this α-helix (63-66). Denaturation studies indicate that the stabilities of these analogues are reduced to an extent similar to or greater than that of ThrB5-insulin5, and yet the corresponding mutant proinsulins are efficiently folded and secreted by HEK293T cells. These results suggest that, even in the absence of aberrant glycosylation, ThrB5-proinsulin exhibits an altered conformation that fails a quality-control checkpoint in the biosynthetic pathway and so undergoes proteosomal degradation (67). Possible molecular mechanisms include increased exposure of non-polar surfaces (ordinarily hidden in the B5-related crevice) and/or non-native aggregation mediated by such surfaces. These quality-control criteria may not be reflected in the in vitro thermodynamic impairment of the monomer in guanidine solutions. II. Studies of an IGF-I Analogue Characterization of HisB5-IGF-I. The two competing ground states of wild-type IGF-I are shown in schematic form in Figure 6A-a. Redox-coupled refolding was conveniently monitored by rp-HPLC. In accord with prior studies (24,26) IGF-swap elutes just before native IGF-I whereas intermediates containing one- or two disulfide bridges elute after native IGF-I (Fig. 6A-b,c). The early-eluting isomer was not observed on refolding of HisB5-IGF-I (Fig. 6B, chromatograms d-f). In addition, folding of the variant was slower than that of native IGF-Ias probed by appearance of the native elution peak and disappearance of later-eluting intermediates. The predominant product was purified and verified as mono-component by analytical rp-HPLC (see Supplemental Fig. S2 online). The molecular mass of this fraction indicated formation of three disulfide bridges.

Physical evidence that the eluted HisB5-IGF-I fraction contains a single pairing scheme (i.e., is not a co-eluted mixture of isomers) and that this pairing is canonical (i.e., is like native IGF-I) was provided by NMR fingerprinting (below). Although we cannot exclude that HisB5-IGF-I-swap was formed at a low level but with an anomalously delayed elution time, the instability or inaccessibility of the putative HisB5 isomer was demonstrated by studies of disulfide exchange. Starting with either purified wild-type IGF-I or IGF-swap, an equilibrium distribution of the two forms can readily be catalyzed within 60 min at room temperature by a sub-stoichiometric concentration of β-mercaptoethanol (26). This protocol by contrast leads to no change in rp-HPLC elution profile (using 0.1% TFA/acetonitrile co-solvent) of folded HisB5-IGF-I, which elutes as a single peak (data not shown). After a 24 hour incubation the equilibrium elution of IGF-I was at 22.7 min whereas IGF-swap eluted at 20.9 min. Under the same conditions HisB5-IGF-I eluted as a single peak at 21.2 min. To address the possibility that kinetic barriers preclude disulfide exchange at room temperature, the protocol was repeated for 12 h at 37° C with the same outcome. In addition, the single-peak status of HisB5-IGF-I was maintained in the presence of β-mercaptoethanol as monitored by another co-solvent elution gradient (methanol/TFA), making unlikely the fortuitous co-elution of disulfide isomers. In this co-solvent system the HisB5-IGF-I also eluted as a single peak at 28.5 min. 1H-NMR studies of HisB5-IGF-I were conducted under conditions previously well-characterized in studies of wild-type IGF-I and IGF-swap (10% dAA and pH 2.0 at 40° C). Under these conditions the proteins are monomeric, exhibit well-resolved 1H-NMR resonances, and retain insulin-like folds (28). The spectrum of HisB5-IGF-I closely resembles that of native IGF-I (Fig. 7A, B) and is unrelated to the spectrum of IGF-swap (Supplemental Fig. S3 and S4 online). Aliphatic spin systems (Fig. 7C, D) and aromatic spin systems (Fig. 7E, F) exhibit similar patterns of chemical shifts. Published assignments of the wild-type spectrum immediately suggested corresponding assignments in the spectrum of the variant. Small shifts are observed in the chemical shifts of aliphatic side chains in the hydrophobic core (IGF-I residues L14 and I43 in Fig. 7D; canonical positions B15 and A2, respectively); these may be due to either adjustments in core structure or the

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

introduced aromatic ring current of HisB5. Evidence for structural similarity between the core structures of wild-type IGF-I and HisB5-IGF-I was provided by comparison of NOESY spectra (Fig. 8). These include contacts between α-helices 1 and 3 (Y60-L14; canonical positions A19 and B15), between α-helices 1 and 2 (Y60-I43; positions A19 and A2), and the α/β B-domain super-secondary structure (F23-L14; positions B24 and B15). These framework residues are conserved among both vertebrate insulin and IGF sequences (Supplemental Table S1 online). No NOEs are observed between the ring of His4 (HisB5) and methyl resonances (dashed line in Fig. 8B) in accord with the structure of IGF-I.6 The crowded nature of this spectra region precludes definitive assignment. The far-ultraviolet CD spectrum of HisB5-IGF-I (filled circles in Fig. 9A) is also similar to that of native IGF-I (solid line) and distinct from that of IGF-swap (dotted line). The latter exhibits attenuated α-helical features consistent with the absence of α-helix 2 (IGF residues 42-49; canonical positions A1-A8) in the solution structure of IGF-swap (28). CD-detected guanidine denaturation studies indicate that native IGF-I and HisB5-IGF-I exhibit similar stabilities at 25° C (solid line and circles in Fig. 9B). Application of a two-state model implies respective free energies 2.9 ± 0.1 kcal/mole (wild type) and 3.1 ± 0.1 kcal/mole (variant). Stabilization by the B5 substitution is at the limit of significance (ΔΔGu 0.2 ± 0.2 kcal/mole). The corresponding denaturation transition of IGF-swap is more sharply sigmoidal (dashed line in Fig. 9B), leading to a higher estimate of ΔGu (3.7 ± 0.1 kcal/mole). Direct comparison to native IGF-I to estimate ΔΔGu (which would differ in sign from that obtained by studies of disulfide exchange) may be confounded by the difference in respective denatured states in the two guanidine titrations. Biological Activity of IGF-I Analogue. Functional studies of native IGF-I and HisB5-IGF-I demonstrated that the substitution augments IGF-IR binding (Fig. 9C) in accord with past studies (22). Respective ligand-receptor dissociation constants are 0.040 ± 0.005 nM (wild-type) and 0.022 ± 0.002 nM (variant). Studies of IR demonstrated that the B5 substitution also enhances cross-binding of the IGF-I analogue by twofold (Fig. 9D). Respective ligand-IR dissociation constants are 13.9 ± 2.2 nM (wild-type) and 5.7 ± 1 nM (variant). Thus, as in

reciprocal case in insulin, the B5 substitution does not alter receptor-binding specificity. The biological activity of His4-IGF-I was evaluated in a mammalian cell line expressing IGF-1R (52). Activation of Akt kinase by Ser- and Thr- phosphorylation is a critical step in the phosphoinositol-3' kinase pathway downstream of the receptor. We therefore employed measurements of the relative extent of Akt phosphorylation in response to stimulation by wild-type IGF-I or His4-IGF-I as a surrogate for assessment of IGF-1R signaling. Relative to the basal level of Akt phosphorylation (normalized to 1.00 ± 0.33 in arbitrary units), addition of 1 nM IGF-I triggered a 2.26(±0.27)-fold increase in phosphorylation whereas addition of 1 nM His4-IGF-I increased Akt phosphorylation by 3.45(±0.31)-fold. Similarly, addition of the ligands at a concentration of 10 nM led to respective fold-increases of 7.69(±0.46) (wild-type) and 8.46(±0.38) (analogue). The increased affinity of His4-IGF-I is thus associated with augmented post-receptor signaling. Informational Content of B-Chain Sequences. Di Marchi and colleagues demonstrated that isolated A- and B-chain peptides derived from IGF-I undergo chain combination to yield native and isomeric two-chain products analogous to those observed on refolding of IGF-I (58). These observations first demonstrated that information is missing in the IGF A- or B domains. Combination of the IGF-I-derived B-chain (29 residues) and insulin A-chain likewise yield two isomeric products as in single-chain chimeric models (68). To test whether residue B5 is sufficient in this model to restore the fidelity of chain combination, we synthesized the HisB5-IGF-I B-chain and attempted chain combination with the insulin A-chain. Yield was reduced threefold relative to wild-type insulin chain combination. Unlike reciprocal chain combination of ThrB5-insulin, which exhibited low yield but no isomers (above), the hybrid reaction gave rise to a major product with three minor isomeric contaminants (each resolved on rp-HPLC with longer elution times than that of the major product and relative peak intensity <10%). These studies suggest that the differences in folding information between the isolated B-chains of IGF-I and insulin are not confined to residue B5 alone.

DISCUSSION

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

The insulin-related superfamily provides a model for the evolution and divergence of a structural motif (15,69-71). The A- and B-domains encode an α-helical fold that is shared by vertebrate insulins, growth factors, and relaxin-related factors. These polypeptide sequences contain five classes of residues: (a) conserved in the superfamily, (b) conserved among insulin, IGF-I, and IGF-II but not only relaxin-related factors, (c) conserved among IGF-I and IGF-II but not more broadly, (d) restricted to one protein type, and (e) not conserved. Invariant in the superfamily is a pattern of six cysteines (Supplemental Table S1 online). GlyA1-IleA2-ValA3 provide a conserved element within vertebrate insulins and IGFs required to bind a cognate family of receptor tyrosine kinases (IR and IGF-1R); this element is not characteristic of relaxin-related factors, which bind to an unrelated class of receptors (GPCRs) (72). The evolutionary history of the insulin superfamily extends to invertebrate insulin-like proteins exhibiting further sequence variation, including in the pattern of disulfide bridges (71,73). In this article we have investigated reciprocal substitutions in human insulin and IGF-I at position B5. This residue is conserved as His in insulin and as Thr in the IGFs; relaxin-related factors contain a basic residue (Lys or Arg). We discuss our results in relation to general principles of protein folding and biological constraints governing the evolution of the insulin-IGF family. The importance of residue B5 is underscored by the recent discovery of a mutation at this site in human proinsulin causing permanent neonatal-onset diabetes mellitus (12). Principles of Protein Folding Protein folding represents a major unsolved problem. Anfinsen and colleagues demonstrated that the native state of a globular protein is encoded by its sequence (74). Although this view has undergone recent modification (embracing, for example, the cellular roles of chaperones and of "folding enzymes" such as peptide-prolyl isomerase and protein disulfide isomerase (75)), it is nevertheless believed that the protein structures are thermodynamically (rather than kinetically) determined as the ground state of a multidimensional energy landscape (76). Fundamental to protein biophysics, these ideas have broad biological implication as folding defects underlie diverse human diseases (77,78).

IGF-I with its two alternative ground states provides an example of a polypeptide sequence that is missing information. Oxidative protein folding pertains to a major class of secreted and membrane proteins whose folding is coupled to disulfide pairing in the endoplasmic reticulum (79,80). In vitro the relative reactivities of thiol groups have long provided site-specific kinetic probes, enabling reaction intermediates to be trapped (81). As demonstrated by Creighton and coworkers (82,83), the time-course of formation and disappearance of free cysteines and specific pairing arrangements provides a chemical map of the oxidative folding pathway. An experimental paradigm has been provided by bovine pancreatic trypsin inhibitor (BPTI; (84-86)). The folding of BPTI is remarkable for intermediates that are well populated at neutral pH, exhibit native structures, and face large kinetic barriers to reach the ground state (84-86). The preferred final step is formation of an external disulfide bridge between solvent-exposed loops. Like BPTI, IGF-I and proinsulin are small globular proteins containing three disulfide bridges. Profound differences from BPTI are observed. IGF-I and proinsulin are significantly less stable than BPTI (87,88); kinetic barriers among populated two-disulfide species are also lower (63,88). Further, the conformational search is intertwined with formation of disulfide bridges: analogues of IGF-I and insulin exhibit stepwise stabilization of native structural elements with successive disulfide pairing (24,29,89). Oxidative folding of IGF-I and proinsulin thus occurs on successive energy landscapes whose topography is constrained by disulfide pairing (13,88). Evidence for non-random initial folding trajectories has been provided in studies of IGF-I, mini-IGF-I, and mini-proinsulin by the trapping of a unique one-disulfide intermediate containing cystine A20-B19 (55,90). Although several two-disulfide species have been characterized, a slow subsequent step is formation of the solvent-exposed A7-B7 bridge. Diabetes-associated mutations in proinsulin cluster in residues neighboring either cystine A20-B19 or A7-B7 (12,14). IGF-I refolding bifurcates to yield two products (24,26). Designated native IGF-I and IGF-swap (26), the two products share the A20-B19 disulfide bridge. The isomers exhibit near-equal thermodynamic stabilities. Proinsulin and single-chain insulin analogues by contrast refold to form a unique ground state; alternative pairing schemes

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

are metastable, and if present, rearrange to the native state. That the number of products is precisely two demonstrates that a non-random folding pathway is encoded but must be "ambiguous" following formation of cystine A20-B19. In studies of mini-protein models Feng and coworkers obtained evidence that the respective B domains of proinsulin and IGF-I – and in particular HisB5 or ThrB5 – are responsible for determining the relative stability of the swapped isomer (37). The present studies of HisB5-IGF-I supports this conclusion. The B5 substitution in IGF-I selectively destabilizes the non-native isomer. The accumulation of a two-disulfide intermediate in the refolding of HisB5-IGF-I presumably represents a non-native species containing cystines A20-B19 and A7-A11 (IGF-I residues 18-61 and 48-52), ordinarily the precursor of IGF-swap but here an off-pathway intermediate. We speculate that the delayed overall time course of folding reflects the formation and rearrangement of this species. The yield of insulin chain combination is impaired by reciprocal substitution HisB5→Thr. Such impairment stands in contrast to the general robustness of chain combination to substitutions, especially in the C-terminal B-chain segment and N-terminal A-chain segment (65). Sites neighboring CysB7 define an Achilles’ heel: impaired chain combination has also been observed following substitution of LeuB6, IleB11 and ValB12 (41,91), which like B5 are sites of neonatal diabetes-associated mutations (12,14). It is possible that substitutions at these sites, like ThrB5, markedly perturb the stability of insulin. Synthetic and cell-biological studies nonetheless suggest that thermodynamic criteria are insufficient to account for differences in foldability. Pairwise substitution of CysA7 and CysB7 by Ser was observed to rescue chain combination otherwise blocked by substitution GlyB8→Ala (92). Since in the absence of cystine A7-B7 insulin exhibits a partial fold of lower stability than that of AlaB8-insulin (18), such rescue suggests that AlaB8 imposes a kinetic block to pairing of CysA7 and CysB7 (92). Pairwise substitution of CysA6 and CysA11 by Ala (or Ser) likewise leads to a partial fold of marginal stability. Not only is chain combination preserved, but also in transfected mammalian cells a corresponding variant proinsulin exhibits efficient folding and secretion (63). How might HisB5 contribute to chain combination and the biosynthesis of proinsulin? A

clue is provided by the presence of a basic side chain (Arg or Lys) at this site in relaxin-related factors and the occasional occurrence of Arg among non-mammalian insulins (93). Whereas chain combination fails in the case of MetB5, near wild-type efficiencies are obtained for ArgB5 (93). We imagine two possible molecular roles for HisB5 or ArgB5 in the mechanism of chain combination. First, since crystal structures of insulin and ArgB5-insulin exhibit analogous hydrogen bonds between a B5 side-chain NH donor (NδH in HisB5 and NεH in ArgB5) to A-chain carbonyl oxygens, native-like interactions might stabilize an on-pathway folding intermediate whose local structure facilitates pairing of CysA7 and CysB7. Alternatively, the positive charge of ArgB5 and potential positive charge of HisB5 may stabilize a thiolate anion at A7 or B7 in the course of disulfide bonding. The latter mechanism would be consistent with the pKa of HisB5, which is shifted from 6.0 to 7.0 in native insulin (93,94). The neonatal diabetes-associated mutation at B5 is Asp (12), whose negative charge would be expected to destabilize a thiolate reaction intermediate. Our studies of the cellular folding of proinsulin analogues on transfection in human fibroblast-derived HEK293T cells demonstrate that HisB5 or ArgB5 support folding and secretion to an equivalent extent. MetB5 and GluB5 (like AspB5, GlnB5, and PheB5 in a previous study (18)) impair folding in the ER, leading to increased formation of disulfide isomers and a block to secretion. Expression of ThrB5-proinsulin leads to fortuitous modification by an N-linked glycan whose secretion is blocked. Experiments employing TM to impair N-linked glycosylation nonetheless demonstrated that secretion of ThrB5-proinsulin, folded in the absence of such modification, is itself markedly impaired. Despite this block in the secretory pathway, disulfide pairing of ThrB5-proinsulin (in the presence of absence of glycosylation) is more efficient than that of AlaB5-, MetB5-, GluB5-, or AspB5-proinsulin (present study and ref. (18)) as indicated by native SDS-PAGE in the absence of reduction (i.e., the ratio of less-compact non-native disulfide isomers to the most rapidly migrating band). We speculate that the β-OH group of ThrB5 (unlike the above folding-defective side chains) can in principle donate a hydrogen bond to a putative thiolate intermediate and, once pairing is complete, to the A-domain within the B5-associated crevice – but that these interactions are weaker (or more transient) than those of

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

secretion-competent side chains HisB5 and ArgB5. This model is supported by the decreased thermodynamic stability of ThrB5-insulin. We imagine that conformational fluctuations in ThrB5-proinsulin expose nonpolar surfaces, leading to recognition of a folding defect by quality control checkpoints in the ER and Golgi apparatus. The blocked secretion of ThrB5-proinsulin highlights in the breach the puzzling conservation of Thr at this position in IGF-I and IGF-II. Co-Evolution of a Regulatory Network Why is a secretion-defective residue at B5 invariant among IGF-I and IGF-II? Such conversation poses a seeming paradox, especially in light of the genetic susceptibility of proinsulin to misfolding-associated mutations. Specification of native IGF-I disulfide pairing in vivo is attributed to specific IGF-I-binding proteins (IGFBPs), present in equimolar proportions. Such partner proteins bind native IGF-I but not IGF-swap, thus favoring formation of the native isomer by Le Chatelier’s Principle (95). We propose that the availability of IGFBPs as ubiquitous heterodimeric folding partners (33) has enabled IGF-I to diverge from insulin at B5. The extent of divergence is not so marked as to preclude disulfide pairing as in vitro reduced IGF-I successfully refolds to form only two of the 15 possible disulfide isomers (native IGF-I and IGF-swap). Discrimination against the 13 other possible combinatoric pairing schemes demonstrates that almost all folding information (but not quite all) is retained in the polypeptide sequence of IGF-I. This subtle defect is repaired on substitution of ThrB5 by His. In this context it is noteworthy that in cellular assays of proinsulin folding, we found that the defect in disulfide pairing associated with ThrB5 is less profound (despite the subsequent block to secretion) than that of clinical mutation AspB5 or the other substitutions tested in cell culture. We speculate that IGFBPs enable IGF-I to overcome the block to secretion observed in ThrB5-proinsulin: formation of a heterodimer enables quality-control checkpoints to be satisfied. Conservation of ThrB5 in IGF-I and IGF-II has presumably been enjoined by a selective advantage. HisB5-IGF-I exhibits a twofold increase in binding to both IGF-1R and IR. Thus, threonine subtly attenuates IGF signaling at the expense of uniqueness of folding of the isolated polypeptide. We therefore imagine that IGFBPs (in addition to

sequestering circulating IGF-I and their direct signaling activities) have implicitly expanded the space of foldable sequences available to IGFs. Such co-evolution may in general enable the fine-tuning of receptor affinities of hormones and growth factors under physiological selection to coordinate the regulation of development and metabolism. We envisage that variation at B5 in IGFs enabled fine tuning of receptor affinities without perturbations in receptor selectivity or binding to IGFBPs. Analogous variation in proinsulin was disallowed by impaired secretion, and in the case of a broader set of substitutions at B5, by proteotoxicity due misfolding of the nascent polypeptide in the β-cell. Whereas mutation of HisB5 by Asp in the human insulin gene leads to neonatal DM due to β-cell death (12), we speculate that an analogous ThrB5 substitution might lead to decreased insulin secretion (from the remaining wild-type insulin allele) but would otherwise be well tolerated. Why could fine-tuning of IGF-I activity – even by a factor of two – be of biological importance? Factors of two can seem negligible in biochemical studies, and yet in vivo such variation may have profound consequences, especially in regulatory control systems. An instructive example in pharmacology was provided by a once-promising insulin analogue under development twenty years ago (96). Just as the present study has investigated reciprocal insulin- and IGF-I substitutions at position B5, a candidate rapid-acting insulin formulation (97) was proposed in which HisB10 was substituted by AspB10 (98), whose side-chain carboxylate recapitulates a feature of IGF-I (GluB10; position 9 in the polypeptide sequence of IGF-I). The AspB10 substitution was observed to enhance the stability of insulin (99) and accelerate its absorption after subcutaneous injection (97), both desirable pharmacologic properties. This substitution also enhanced binding to the IR and IGF-1R by twofold due to increased residence times (98,100). Although seemingly minor or even advantageous, this twofold alteration in the receptor-binding properties of AspB10-insulin was associated with an increased incidence of mammary tumors in Sprague-Dawley rats and enhanced mitogenicity in human breast-cancer cell lines (96). Human trials were therefore discontinued. By analogy, we suggest that the intrinsic activity of free IGF-I may likewise be under strict biological selection. Fine-tuning of IGF-I by co-evolution of its sequence and IGFBPs

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

is likely to affect both growth rates and baseline risk of tumorigenesis in an organism. The fine-tuning of IGF-I may extend to the extent of its instability to disulfide exchange. In a pioneering study Nillson and colleagues demonstrated that under the redox conditions of the Golgi apparatus, secretory granules, and blood stream, isolated IGF-I undergoes in vitro disulfide rearrangement to form an equilibrium distribution of native and swapped species (27). Because, to our knowledge, the biological implications of these findings have not been explored, it would be of future interest to extend this study to molecular analysis of the state of IGF-I during cellular biosynthesis. Co-expression or RNAi-knock-down of IGFBPs might be found to modulate the fidelity of disulfide pairing. Nillson and colleagues further speculated that isomerization of free IGF-I in the blood stream and tissues might provide a mechanism to down-regulate its growth-promoting activity (27). The proposed mechanism thus exploits in the instability of free IGF-I and the low activity of IGF-swap as a biological defense against excessive mitogenic signaling. To our knowledge, this intriguing hypothesis has not been tested. Extension to Invertebrate Insulin-like Sequences. The insulin superfamily includes invertebrate insulin-like polypeptides. Although these sequences are more divergent than those of the vertebrate insulin-IGF family, selected NMR structures exhibit insulin-like folds as exemplified by Bombyxin (extracted from the silkworm Bombyx mori) (70) and INS-6 (found in the nematode Caenorhabditis elegans) (71). These proteins contain ThrB5 and ArgB5, respectively. Of 36 insulin-like genes identified in C. Elegans by Ruvkun and colleagues (73), 26 encode a basic residue at B5, and 2 encode Thr. The genome of Drosophila melanogaster encodes 7 insulin-like polypeptides of which 4 contain a basic residue at B5; the remaining sequences contain Thr, Ser, or Met. The ThrB5-containing protein (designated DILP-2) exhibits respective sequence identities of 35% and 26% with respect to human insulin and IGF-I. Conserved residues include GlyA1-IleA2-ValA3, part of a key recognition α-helix (101) shared by insulin and IGF-I but not critical for folding (65). Interestingly, DILP-2 has been demonstrated to bind to a partner protein in D. melanogaster (102,103). This binding protein, designated IMP-2, is a member of the immunoglobulin superfamily homologous to human IGFBP7. We speculate that, like vertebrate

IGFs, folding of DILP-2 may be coupled to co-expression of this or another binding protein. Should the folding properties of human insulin and IGFs generalize to invertebrate insulin-like polypeptides, we would speculate that, on the one hand, autonomous folding requires Arg, Lys, or His at B5 and that, on the other hand, ThrB5 (or other divergent residue at B5) might indicate the presence of a corresponding binding protein. Concluding Remarks. A major challenge is posed by the problem of how members of the insulin superfamily fold and pass quality-control checkpoints en route to secretion. This problem has both biophysical and cell-biological dimensions. Its subtlety is highlighted by implicit role of HisB5 in a variant IGF-I to destabilize a competing but unseen fold. Despite decades of investigation, rules governing cellular foldability remain elusive. Indeed, Arvan and colleagues have found that substitutions in proinsulin that are well tolerated in vitro can be associated with disulfide mispairing in cell culture (46). Further, mini-proinsulin analogs, although highly efficient in in vitro refolding assays (104), can quantitatively misfold in mammalian cell culture to yield a metastable disulfide isomer (presumably analogous to IGF-swap). These observations strongly suggest that cellular folding of proinsulin is under kinetic control whereas thermodynamic control of IGF folding is imposed, at least at the final steps, by IGFBPs. The present studies have demonstrated the value of reciprocal substitutions in insulin and IGF-I as probes of structure and function. These homologous systems provide a model in which kinetic and thermodynamic determinants of protein folding may be dissected. In addition to their biophysical interest, future studies may define a relationship between misfolding and ER stress in the pathogenesis of β-cell exhaustion in type II diabetes mellitus. Supplemental Material. Two tables providing protein sequences and summary of B5-related hydrogen bonds; four figures outlining scheme of native-ligation synthesis and providing additional HPLC chromatograms and NMR spectra.

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

REFERENCES

1. Rotwein, P., Pollock, K. M., Didier, D. K., and Krivi, G. G. (1986) J. Biol. Chem. 261,

4828-4832 2. Dull, T. J., Gray, A., Hayflick, J. S., and Ullrich, A. (1984) Nature 310, 777-781 3. Hudson, P., Haley, J., John, M., Cronk, M., Crawford, R., Haralambidis, J., Tregear, G.,

Shine, J., and Niall, H. (1983) Nature 301, 628-631 4. Hudson, P., John, M., Crawford, R., Haralambidis, J., Scanlon, D., Gorman, J., Tregear,

G., Shine, J., and Niall, H. (1984) EMBO J. 3, 2333-2339 5. Bathgate, R. A., Samuel, C. S., Burazin, T. C., Layfield, S., Claasz, A. A., Reytomas, I.

G., Dawson, N. F., Zhao, C., Bond, C., Summers, R. J., Parry, L. J., Wade, J. D., and Tregear, G. W. (2002) J. Biol. Chem. 277, 1148-1157

6. Burkhardt, E., Adham, I. M., Hobohm, U., Murphy, D., Sander, C., and Engel, W. (1994) Hum. Genet. 94, 91-94

7. Chassin, D., Laurent, A., Janneau, J. L., Berger, R., and Bellet, D. (1995) Genomics 29, 465-470

8. Conklin, D., Lofton-Day, C. E., Haldeman, B. A., Ching, A., Whitmore, T. E., Lok, S., and Jaspers, S. (1999) Genomics 60, 50-56

9. Hsu, S. Y. (1999) Mol. Endocrinol. 13, 2163-2174 10. De Meyts, P., and Whittaker, J. (2002) Structure-function relationships of insulin and

insulin-like growth factor-I receptor binding. In: De Meyts, P., Dieken, M. L., and Federwisch, M. (eds). Insulin and Other Proteins. From Structure to Function and Pharmacology, Kluwer Publishing, Dordrecht, the Netherlands

11. Katugampola, S., and Davenport, A. (2003) Trends Pharmacol. Sci. 24, 30-35 12. Stoy, J., Edghill, E. L., Flanagan, S. E., Ye, H., Paz, V. P., Pluzhnikov, A., Below, J. E.,

Hayes, M. G., Cox, N. J., Lipkind, G. M., Lipton, R. B., Greeley, S. A., Patch, A. M., Ellard, S., Steiner, D. F., Hattersley, A. T., Philipson, L. H., and Bell, G. I. (2007) Proc. Natl. Acad. Sci. USA 104, 15040-15044

13. Weiss, M. A. (2009) J. Biol. Chem. 284, 19159-19163 14. Colombo, C., Porzio, O., Liu, M., Massa, O., Vasta, M., Salardi, S., Beccaria, L.,

Monciotti, C., Toni, S., Pedersen, O., Hansen, T., Federici, L., Pesavento, R., Cadario, F., Federici, G., Ghirri, P., Arvan, P., Iafusco, D., Barbetti, F., and Early Onset Diabetes Study Group of the Italian Society of Pediatric Endocrinology and Diabetes. (2008) J. Clin. Invest. 118, 2148-2156

15. Baker, E. N., Blundell, T. L., Cutfield, J. F., Cutfield, S. M., Dodson, E. J., Dodson, G. G., Hodgkin, D. M., Hubbard, R. E., Isaacs, N. W., and Reynolds, C. D. (1988) Philos. Trans. R. Soc. Lond. B Biol. Sci. 319, 369-456

16. Vajdos, F. F., Ultsch, M., Schaffer, M. L., Deshayes, K. D., Liu, J., Skelton, N. J., and de Vos, A. M. (2001) Biochemistry 40, 11022-11029

17. Brzozowski, A. M., Dodson, E. J., Dodson, G. G., Murshudov, G. N., Verma, C., Turkenburg, J. P., de Bree, F. M., and Dauter, Z. (2002) Biochemistry 41, 9389-9397

18. Hua, Q. X., Liu, M., Hu, S. Q., Jia, W., Arvan, P., and Weiss, M. A. (2006) J. Biol. Chem. 281, 24889-24899

19. Huang, Q. L., Zhao, J., Tang, Y. H., Shao, S. Q., Xu, G. J., and Feng, Y. M. (2007) Biochemistry 46, 218-224

20. Cooke, R. M., Harvey, T. S., and Campbell, I. D. (1991) Biochemistry 30, 5484-5491

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

21. Sato, A., Nishimura, S., Ohkubo, T., Kyogoku, Y., Koyama, S., Kobayashi, M., Yasuda, T., and Kobayashi, Y. (1992) J. Biochem. (Tokyo) 111, 529-536

22. Magee, B. A., Shooter, G. K., Wallace, J. C., and Francis, G. L. (1999) Biochemistry 38, 15863-15870

23. Smith, M. C., Cook, J. A., Furman, T. C., and Occolowitz, J. L. (1989) J. Biol. Chem. 264, 9314-9321

24. Hober, S., Forsberg, G., Palm, G., Hartmanis, M., and Nilsson, B. (1992) Biochemistry 31, 1749-1756

25. Hejnaes, K. R., Bayne, S., Norskov, L., Sorensen, H. H., Thomsen, J., Schaffer, L., Wollmer, A., and Skriver, L. (1992) Protein Eng. 5, 797-806

26. Miller, J. A., Narhi, L. O., Hua, Q. X., Rosenfeld, R., Arakawa, T., Rohde, M., Prestrelski, S., Lauren, S., Stoney, K. S., Tsai, L., and Weiss, M. A. (1993) Biochemistry 32, 5203-5213

27. Hober, S., Lundstrom Ljung, J., Uhlen, M., and Nilsson, B. (1999) FEBS Lett. 443, 271-276

28. Sato, A., Koyama, S., Yamada, H., Suzuki, S., Tamura, K., Kobayashi, M., Niwa, M., Yasuda, T., Kyogoku, Y., and Kobayashi, Y. (2000) J. Pept. Res. 56, 218-230

29. Hua, Q. X., Jia, W., Frank, B. H., Phillips, N. B., and Weiss, M. A. (2002) Biochemistry 41, 14700-14715

30. Steiner, D. F., Cunningham, D., Spigelman, L., and Aten, B. (1967) Science 157, 697-700 31. Sieber, P. S., Eisler, K., Kamber, B., Riniker, B., Rittel, W., Marki, F., and deGasparo,

M. (1978) Hoppe Seylers Z Physiol. Chem. 359, 113-123 32. Hua, Q. X., Gozani, S. N., Chance, R. E., Hoffmann, J. A., Frank, B. H., and Weiss, M.

A. (1995) Nat. Struct. Biol. 2, 129-138 33. Hober, S., Hansson, A., Uhlen, M., and Nilsson, B. (1994) Biochemistry 33, 6758-6761 34. Hober, S., Uhlen, M., and Nilsson, B. (1997) Biochemistry 36, 4616-4622 35. Guo, Z. Y., Shen, L., and Feng, Y. M. (2002) Biochemistry 41, 1556-1567 36. Guo, Z. Y., Shen, L., Feng, Y. M., and Wang, D. C. (2002) Biochemistry 40, 10585-

10592 37. Chen, Y., You, Y., Jin, R., Guo, Z. Y., and Feng, Y. M. (2004) Biochemistry 43, 9225-

9233 38. Yun, C. H., Tang, Y. H., Feng, Y. M., An, X. M., Chang, W. R., and Liang, D. C. (2005)

Biochem. Biophys. Res. Commun. 326, 52-59 39. Ron, D. (2002) J. Clin. Invest. 109, 443-445 40. Merrifield, R. B., Vizioli, L. D., and Boman, H. G. (1982) Biochemistry 21, 5020-5031 41. Hu, S. Q., Burke, G. T., Schwartz, G. P., Ferderigos, N., Ross, J. B., and Katsoyannis, P.

G. (1993) Biochemistry 32, 2631-2635 42. Sohma, Y., Pentelute, B. L., Whittaker, J., Hua, Q. X., Whittaker, L. J., Weiss, M. A., and

Kent, S. B. H. (2008) Angew. Chem. Int. Ed. Engl. 47, 1102-1106 43. Schnolzer, M., Alewood, P., Jones, A., Alewood, D., and Kent, S. B. (1992) Int. J. Pept.

Protein Res. 40, 180-193 44. Johnson, E. C., and Kent, S. B. (2007) Tetrahedron Lett. 48, 1795-1799 45. Johnson, E. C., and Kent, S. B. (2006) J. Am. Chem. Soc. 128, 6640-6646 46. Liu, M., Li, Y., Cavener, D., and Arvan, P. (2005) J. Biol. Chem. 280, 13209-13212 47. Liu, A., Yao, L., Li, Y., and Yan, H. (2007) J. Magn. Reson. 186, 319-326 48. Whittaker, J., and Whittaker, L. (2005) J. Biol. Chem. 280, 20932-20936

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

49. Wang, Z. X. (1995) FEBS Lett. 360, 111-114 50. Whittaker, J., Groth, A. V., Mynarcik, D. C., Pluzek, L., Gadsboll, V. L., and Whittaker,

L. J. (2001) J. Biol. Chem. 276, 43980-43986 51. Sell, C., Dumenil, G., Deveaud, C., Miura, M., Coppola, D., DeAngelis, T., Rubin, R.,

Efstratiadis, A., and Baserga, R. (1994) Mol. Cell. Biol. 14, 3604-3612 52. Denley, A., Brierley, G. V., Caroll, J. M., Lindberg, A., Booker, G. W., Cosgrove, L. J.,

Wallace, J. C., Forbes, B. E., and Roberts, C. T. (2006) Endocrinology 147, 1029-1036 53. Sosnick, T. R., Fang, X., and Shelton, V. M. (2000) Methods Enzymol. 317, 393-409 54. Sato, A., Nishimura, S., Ohkubo, T., Kyogoku, Y., Koyama, S., Kobayashi, M., Yasuda,

T., and Kobayashi, Y. (1993) Int. J. Pept. Protein Res. 41, 433-440 55. Narhi, L. O., Hua, Q. X., Arakawa, T., Fox, G. M., Tsai, L., Rosenfeld, R., Holst, P.,

Miller, J. A., and Weiss, M. A. (1993) Biochemistry 32, 5214-5221 56. Hua, Q. X., Mayer, J., Jia, W., Zhang, J., and Weiss, M. A. (2006) J. Biol. Chem. 281,

28131-28142 57. Katsoyannis, P. G. (1966) Science 154, 1509-1514 58. DiMarchi, R. D., Mayer, J. P., Fan, L., Brems, D. N., Frank, B. H., Green, J. K.,

Hoffman, J. A., Howey, D. C., Long, H. B., Shaw, W. N., Shields, J. E., Slieker, L. J., Su, K. S. E., Sundell, K. L., and Chance, R. E. (1992) Synthesis of a fast-acting insulin based on structural homology with insulin-like growth factor I. In: Smith, J. A., and Rivier, J. E. (eds). Peptides: Proceedings of the Twelfth American Peptide Symposium, ESCOM Science Publishers B. V., Leiden, The Netherlands

59. Liu, M., Hodish, I., Rhodes, C. J., and Arvan, P. (2007) Proc. Natl. Acad. Sci. USA 104, 15841-15846

60. Gavel, Y., and Von Heijne, G. (1990) Protein Eng. 3, 433-442 61. Schwarz, R. T. (1991) Behring Inst. Mitt. 89, 198-208 62. Weiss, M. A., Hua, Q. X., Lynch, C. S., Frank, B. H., and Shoelson, S. E. (1991)

Biochemistry 30, 7373-7389 63. Hua, Q. X., Hu, S. Q., Frank, B. H., Jia, W., Chu, Y. C., Wang, S. H., Burke, G. T.,

Katsoyannis, P. G., and Weiss, M. A. (1996) J. Mol. Biol. 264, 390-403 64. Weiss, M. A., Hua, Q. X., Jia, W., Chu, Y. C., Wang, R. Y., and Katsoyannis, P. G.

(2000) Biochemistry 39, 15429-15440 65. Hua, Q. X., Chu, Y. C., Jia, W., Phillips, N. B., Wang, R. Y., Katsoyannis, P. G., and

Weiss, M. A. (2002) J. Biol. Chem. 277, 43443-43453 66. Xu, B., Hua, Q. X., Nakagawa, S. H., Jia, W., Chu, Y. C., Katsoyannis, P. G., and Weiss,

M. A. (2002) Protein Sci. 11, 104-116 67. Liu, M., Wan, Z. L., Chu, Y. C., Aladdin, H., Klaproth, B., Choquette, M. H., Hua, Q. X.,

Mackin, R. B., Rao, J. S., De Meyts, P., Katsoyannis, P. G., Arvan, P., and Weiss, M. A. (2009) J. Biol. Chem. Epub

68. De Vroede, M. A., Rechler, M. M., Nissley, S. P., Ogawa, H., Joshi, S., Burke, G. T., and Katsoyannis, P. G. (1986) Diabetes 35, 355-361

69. Steiner, D. F., and Chan, S. J. (1988) Horm. Metab. Res. 20, 443-444 70. Nagata, K., Hatanaka, H., Kohda, D., Kataoka, H., Nagasawa, H., Isogai, A., Ishizaki, H.,

Suzuki, A., and Inagaki, F. (1995) J. Mol. Biol. 253, 749-758 71. Hua, Q. X., Nakagawa, S. H., Wilken, J., Ramos, R. R., Jia, W., Bass, J., and Weiss, M.

A. (2003) Genes Dev. 17, 826-831

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

72. Hsu, S. Y., Nakabayashi, K., Nishi, S., Kumagai, J., Kudo, M., Sherwood, O. D., and Hsueh, A. J. (2002) Science 295, 671-674

73. Pierce, S. B., Costa, M., Wisotzkey, R., Devadhar, S., Homburger, S. A., Buchman, A. R., Ferguson, K. C., Heller, J., Platt, D. M., Pasquinelli, A. A., Liu, L. X., Doberstein, S. K., and Ruvkun, G. (2001) Genes Dev. 15, 672-686

74. Anfinsen, C. B. (1973) Science 181, 223-230 75. Creighton, T. E. (1997) Biol. Chem. 378, 731-744 76. Sali, A., Shakhnovich, E., and Karplus, M. (1994) Nature 369, 248-251 77. Bucciantini, M., Giannoni, E., Chiti, F., Baroni, F., Formigli, L., Zurdo, J., Taddei, N.,

Ramponi, G., Dobson, C. M., and Stefani, M. (2002) Nature 416, 507-511 78. Dobson, C. M. (1999) Trends Biochem. Sci. 24, 329-332 79. Harding, H. P., and Ron, D. (2002) Diabetes 51, S455-S461 80. Zinszner, H., Kuroda, M., Wang, X., Batchvarova, N., Lightfoot, R. T., Remotti, H.,

Stevens, J. L., and Ron, D. (1998) Genes Dev. 12, 982-995 81. Weissman, J. S., and Kim, P. S. (1992) Proc. Natl. Acad. Sci. USA 89, 9900-9904 82. Creighton, T. E. (1990) Biochem. J. 270, 1-16 83. Creighton, T. (1995) Philos. Trans. R. Soc. Lond. B Biol. Sci. 348, 5-10 84. Creighton, T. E., and Goldenberg, D. P. (1984) J. Mol. Biol. 179, 497-526 85. Creighton, T. E. (1992) Bioessays 14, 195-199 86. Creighton, T. E., Darby, N. J., and Kemmink, J. (1996) FASEB J. 10, 110-118 87. Creighton, T. E. (1997) Protein Structure: a Practical Approach, IRL Press at Oxford

University Press, Oxford 88. Hua, Q. X., Narhi, L., Jia, W., Arakawa, T., Rosenfeld, R., Hawkins, N., Miller, J. A.,

and Weiss, M. A. (1996) J. Mol. Biol. 259, 297-313 89. Hua, Q. X., Nakagawa, S. H., Jia, W., Hu, S. Q., Chu, Y. C., Katsoyannis, P. G., and

Weiss, M. A. (2001) Biochemistry 40, 12299-12311 90. Yan, H., Guo, Z. Y., Gong, X. W., Xi, D., and Feng, Y. M. (2003) Protein Sci. 12, 768-

775 91. Nakagawa, S. H., and Tager, H. S. (1991) J. Biol. Chem. 266, 11502-11509 92. Nakagawa, S. H., Zhao, M., Hua, Q. X., Hu, S. Q., Wan, Z. L., Jia, W., and Weiss, M. A.

(2005) Biochemistry 44, 4984-4999 93. Wan, Z., Huang, K., Whittaker, J., and Weiss, M. A. (2008) J. Biol. Chem. 283, 21198-

21210 94. Bryant, C., Strohl, M., Green, L. K., Long, H. B., Alter, L. A., Pekar, A. H., Chance, R.

E., and Brems, D. N. (1992) Biochemistry 31, 5692-5698 95. Jansson, M., Andersson, G., Uhlen, M., Nilsson, B., and Kordel, J. (1998) J. Biol. Chem.

273, 24701-24707 96. Milazzo, G., Sciacca, L., Papa, V., Goldfine, I. D., and Vigneri, R. (1997) Mol. Carcinog.

18, 19-25 97. Brange, J., Ribel, U., Hansen, J. F., Dodson, G., Hansen, M. T., Havelund, S., Melberg,

S. G., Norris, F., Norris, K., and Snel, L. (1988) Nature 333, 679-682 98. Schwartz, G. P., Burke, G. T., and Katsoyannis, P. G. (1987) Proc. Natl. Acad. Sci. USA

84, 6408-6411 99. Kaarsholm, N. C., Norris, K., Jorgensen, R. J., Mikkelsen, J., Ludvigsen, S., Olsen, O.

H., Sorensen, A. R., and Havelund, S. (1993) Biochemistry 32, 10773-10778

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

100. Ish-Shalom, D., Christoffersen, C. T., Vorwerk, P., Sacerdoti-Sierra, N., Shymko, R. M., Naor, D., and De Meyts, P. (1997) Diabetologia 40, S25-S31

101. Xu, B., Huang, K., Chu, Y. C., Hu, S. Q., Nakagawa, S., Wang, S., Wang, R. Y., Whittaker, J., Katsoyannis, P. G., and Weiss, M. A. (2009) J. Biol. Chem. 284, 14597-14608

102. Honegger, B., Galic, M., Kohler, K., Wittwer, F., Brogiolo, W., Hafen, E., and Stocker, H. (2008) J. Biol. 7, 10.11-10.11

103. Arquier, N., Geminard, C., Bourouis, M., Jarretou, G., Honegger, B., Paix, A., and Leopold, P. (2008) Cell Metab. 7, 333-338

104. Markussen, J. (1985) Int. J. Pept. Protein Res. 25, 431-434 105. De Wolf, E., Gill, R., Geddes, S., Pitts, J., Wollmer, A., and Grotzinger, J. (1996) Protein

Sci. 5, 2193-2202 106. Hua, Q. X., Shoelson, S. E., Kochoyan, M., and Weiss, M. A. (1991) Nature 354, 238-

241 107. Olsen, H. B., Ludvigsen, S., and Kaarsholm, N. C. (1996) Biochemistry 35, 8836-8845 108. Hua, Q. X., Hu, S. Q., Jia, W., Chu, Y. C., Burke, G. T., Wang, S. H., Wang, R. Y.,

Katsoyannis, P. G., and Weiss, M. A. (1998) J. Mol. Biol. 277, 103-118

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

FOOTNOTES

*Acknowledgements. This work was supported in part by grant from the from the National Institutes of Health to PA (NIH DK48280), from the Department of Energy to S.B.H.K. (DE-FG02-04ER63786) and from the National Institutes of Health and American Diabetes Association to M.A.W. (NIH R01 DK0697674, NIH R01 DK40949, and ADA 1-08-RA-218). Y. S. is grateful for a Research Fellowship of the Japan Society for the Promotion of Science for Young Scientists. N.B.P. is supported in part by the Diabetes Association of Greater Cleveland. The authors are grateful for P. G. Katsoyannis for his advice and encouragement throughout this study. This Article is a contribution from the Cleveland Center for Membrane and Structural Biology and Institute for Biophysical Dynamics and the University of Chicago. 1Abbreviations. CD, circular dichroism; dAA, deuteriated acetic acid; DTT, dithiothreitol; ER, endoplasmic reticulum; HPLC, high-performance liquid chromatography; IGF-I and II, insulin-like growth factors I and II; IGF-1R, type 1 IGF receptor; IR, insulin receptor; kDa, kilo-dalton of mass; MALDI, matrix assisted laser desorption ionization; NMR, nuclear magnetic resonance; MS, mass spectrometry; NOEs, nuclear Overhauser enhancements; NOESY, NOE spectroscopy; PNGase F, peptide N-glycosidase F; rp-HPLC, reverse-phase HPLC; TFA, trifluroacetic acid; TOCSY, total correlation spectroscopy; TOF, time of flight; tumicamycin, TM; and UV, ultra-violet. The domains of proinsulin are designated S (signal peptide), B (corresponding to the B-chain of insulin), C (connecting peptide), and A (corresponding to the A-chain); IGF-I also contains a C-terminal D domain. Amino acids are designated by standard one- and three-letter codes. 2Residue numbers in insulin and IGF-I are designated by canonical domain numbering (i.e., A1-A21 and B1-B30) unless otherwise indicated. Residues 1-29 in IGF-I correspond to B2-B30, and residues 42-62 to A1-A21. 3Mini-IGF-I-swap exhibits an additional α-helix in the A domain and elongated B-domain α-helix, which includes HisB5 (magenta in Fig. 2C). It is possible that these anomalous structural features reflect conditions of crystallization. 4The solution structure of mini-IGF-I retains three canonical α-helices (105) but with relative orientations different from those in the solution structures of insulin, mini-proinsulin, or native IGF-I (20,106-108). 5Substitution of IleA2 by Gly causes a decrement in stability with a ΔΔGu of -1.8 ± 0.09 kcal/mole (65). Pairwise substitution of CysA6 and CysA11 by Ser leads to a molten partial fold not amenable to two-state thermodynamic modeling. Estimates of its decrement in stability are > 2 kcal/mole (89). 6In the NOSEY spectrum of insulin the C4H proton of HisB5 exhibits a prominent contact to the methyl groups of IleA10; the corresponding residue is Ser54 in IGF-I.

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Table 1. Sequences of Human Insulin and Related Factorsa

protein B domain A domain

B1 * B30 A1 A21

insulin FVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCN IGF-I GPETLCGAELVDALQFVCGDRGFYFNKPT GIVDECCFRSCDLRRLEMYCA IGF-II PSETLCGGELVDTLQFVCGDRGFYFSRPA GIVEECCFRSCDLALLETYCA relaxin DDVIKLCGRELVRAQIAICGMSTWS ALFEKCCLIGCTKRSLAKYC aConservation among vertebrate species is illustrated in Supplemental Table S1 (online). Residue at position B5 (IGF position 4) is shown in green; conserved sites in the insulin superfamily are highlighted in red. PheB24 (bold) is proposed to function as a structural switch on binding of insulin and IGFs to their cognate receptors. Residues A1-A3 in insulin and IGFs (underlined) participate in receptor binding but are not conserved among relaxin-related factors, which bind to an unrelated class of receptors.

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Table 2. Activitya and Stabilityb of Protein Analogs

Protein IGF-1R (kd, nM) % IR (kd, nM) % ΔGu (kcal/mole)

IGF-I 0.04 ± 0.005 100 13.9 ± 2.2 0.4 ± 0.1 2.9c

IGF-swap 2.8 ± 0.4 1.4 ± 0.19 ND ND 3.7c

HisB5-IGF-I 0.022 ± 0.002 182 ± 16 5.7 ± 1.0 1 ± 0.2 3.1c

insulin 8.7 ± 1.3 0.50 ± 0.08 0.06 ± 0.01 100 4.4d

ThrB5-insulin 53.8 ± 5 0.07 ± 0.001 0.33 ± 0.04 18.0 ± 2.2 2.4d aActivity is defined by relative receptor-binding affinities for immobilized epitope-tagged IGF-1R or IR (isoform B). Values are in each case normalized to 100%. The absolute affinities of native IGF-I for IGF-1R and of insulin for IR are similar under conditions employed (ca. 0.04 nM). bStability is inferred from guanidine denaturation studies based on a two-state model extrapolated to zero denaturant concentration. Uncertainties are ± 0.1 kcal/mole. cStudies were conducted in PBS at 25° C. ΔGu errors are all ± 0.1. dStudies conducted in 50 mM potassium phosphate (pH 7.4) at 4° C. The stability of insulin in PBS at 25° C is 3.6 ± 0.1 kcal/mole. ΔGu errors are all ± 0.1.

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

FIGURE LEGENDS

Figure 1. Structures of IGF-I and insulin. (A) Ribbon model of IGF-I (PDB accession code PMX). The A domain is shown in red, B domain in blue, and C and D domains in gray. The three disulfide bridges are shown in gold (canonical numbering A7-B7, A6-A11, A20-B19; IGF residues 6-48, 47-52, and 61-18); balls represent sulfur atoms. Side chain of Thr4 (canonical position B5) is also shown (green). (B) Ribbon model of human insulin (T-state protomer; PDB accession code 4INS). The coloring scheme is as in panel A. HisB5 is shown in green. (C) Position of Thr4 (canonical position B5) adjoining cystine A6-A11 (IGF residues 47-52) in inter-domain crevice of IGF-I. The β-OH group and γ-CH3 of Thr4 (ThrB5) are shown as green and black spheres; neighboring A-chain carbonyl oxygens are shown as red spheres. (D) Position of HisB5 in inter-chain crevice of insulin. Imidazolic NH is shown as green sphere, and neighboring A-chain carbonyl oxygens in red spheres. Whereas HisB5 consistently engages in hydrogen bonding to the A-chain in crystal structures of insulin (T-state protomers), Thr4 in IGF-I engages in analogous hydrogen in only a detergent-stabilized crystal structure and not in multiple other structures (see Supplemental Table S2 online). Figure 2. Structures of Disulfide isomers. (A and B) Corresponding ribbon models of native insulin (A) and insulin-swap (B) A-chain α-helices are shown in red: (native insulin) A1-A8 and A12-A18, (insulin-swap) A12-A18. The A-chains are otherwise shown in gray. In each structure the central B-chain α-helix (residues B9-B19) is shown in blue; the B-chain is otherwise gray. HisB5 in each case is shown in green (PDB accession numbers 4INS and 1XGL). Disulfide pairing is as labeled (boxes). (C) Stereo pair showing crystal structure of mini-IGF-I-swap (PDB accession code 1TGR). The crystal structure exhibits additional a-helical segments relative to the solution structure of intact IGF-swap (purple): residues B4-B9 and A1-A8. Canonical A- and B-domain α-helices are shown in red and blue, respectively. Figure 3. CD and Receptor-binding studies of ThrB5-insulin. (A) Far-ultraviolet CD spectrum of ThrB5-insulin (dashed line) in relation to spectrum of wild-type insulin (black line). Spectrum of analog, acquired at 4° C and pH 7.4, exhibits attenuated α-helical features. (B) CD-detected guanidine titrations of ThrB5-insulin (dashed line) in relation to titration of wild-type insulin (black line). Inferred values of ΔGu are provided in Table 2. (C) Receptor-binding studies employing IR (isoform B). Competitive displacement assay in which pre-bound 125I-labeled insulin is displaced by successive concentrations of unlabeled ThrB5-insulin ( ) or wild-type insulin ( ). Ratio of bound-to-total tracer counts are plotted as a function of the logarithm (base 10) of the ligand concentration (nM). (D) Analogous receptor-binding studies employing IGF-1R. Competitive displacement assay in which pre-bound 125I-labeled IGF-I is displaced by successive concentrations of unlabeled ThrB5-insulin ( ) or wild-type insulin ( ). Figure 4. Cellular Folding and Secretion of Proinsulin and B5 Variants. (A) Cellular pathway of insulin biosynthesis: nascent proinsulin folds as a monomer in ER (left) wherein zinc-ion concentration is low; in post-Golgi granules proinsulin is processed by cleavage of connecting peptide to yield mature insulin, and zinc-stabilized hexamers begin to assemble. Zinc-insulin crystals are observed in secretory granules. On secretion into the portal circulation (right) hexamers dissociated to yield bioactive insulin monomers. (B) Pulse-chase studies in HEK293T cells as analyzed under nonreduced conditions (46). Cells were pulse-labeled with

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

35S-labeled amino acids for 1 h and chased 1 hour. Chase media (M; even-numbered lanes) and cell lysates (C; odd-numbered lanes) were immunoprecipited with anti-insulin antiserum and analyzed by nonreducing tris-tricine-urea-SDS-PAGE. Whereas wild-type human proinsulin (lanes 3 and 4) and ArgB5-proinsulin (lanes 11 and 12) exhibited efficient folding in the ER and secretion to the medium, MetB5- and GluB5 variants exhibited impaired folding associated with non-native disulfide isomers (lanes 5 and 7) and a block to secretion (lanes 6 and 8). ThrB5-proinsulin forms a larger-molecular weight intracellular aggregate (lane 9; asterisk) also with absent secretion (lane 10). An empty-vector control (pcDNA3) is provided in lanes 1 and 2. (C) Control studies of unstable protein variants in transfected HEK293T cells suggest that cellular foldability is not under thermodynamic control. Folding and secretion of a molten two-disulfide analogue (containing paired substitutions CysA6→Ser and CysA11→Ser; lanes 17 and 18) and partially folded analogue (IleA2→Gly; lanes 19 and 20) are similar to wild type (lanes 15 and 16); an empty-vector control is provided in lanes 13 and 14. Figure 5. Aberrant glycosylation and trafficking of ThrB5-proinsulin. (A) Transfected 293T cells were pre-incubated with (lanes 6 and 11) or without 10 μg/ml tumicamycin (TM) for 30 min. Cells were then pulse-labeled with 35S-labeled amino acids in same media for additional 30 min. The newly synthesized proinsulin or proinsulin variants were immunoprecipitated with anti-insulin antiserum. Immunoprecipitates were treated with (lanes 4 and 9) or without PNGase F and 37° C for 1 h before being analyzed under both reducing and non reducing conditions. As a control for impaired cleavage of the signal peptide, a mutation (AspS24 in the preproprotein; lane 12) showed uncleaved mutant preproinsulin as a band of reduced electrophoretic mobility. (B) Transfected 293T cells were pulse-labeled with 35S-labeled amino acids in presence (lanes 8 and 11) or absence of 10 μg/ml TM for 30 min as panel A. The labeled cells were either immediately lysed (lanes 1, 2, 5, 8, 10) or chased with (lanes 9, 10, 12, and 13) or without 10 μg/ml TM for 2 hrs. Cell lysates (C) and chase media (M) were analyzed under reducing conditions. EV, empty-vector negative control.

Figure 6. Refolding of native and variant IGF-I. (A) Wild-type IGF-I folds to two competing ground states in a bifurcating energy landscape (a), yielding native IGF-I (N) and IGF-swap. MG indicates molten-globule states. Redox-coupled folding was monitored by rp-HPLC at successive times: (b) < 1 minute and (c) 2 hours. (B) Refolding of HisB5-IGF-I yields a single product at higher yield but is slower than that of wild-type IGF-I: (d) < 1 minute, (e) 5 hours, and (f) 8 hours. Arrow in panel (d) indicates accumulation of two-disulfide intermediate. Figure 7. 1H-NMR analysis of HisB5-IGF-I. (A and B) Aliphatic region of 1D 1H-NMR spectra of (A) wild-type IGF-I and (B) HisB5-IGF-I. Brackets indicate methyl resonances of L14 (canonical position B15); arrow indicates δ-methyl resonance of I43 (position A2). (C and D) Corresponding TOCSY spectra of (C) wild-type IGF-I and (D) HisB5-IGF-I. Selected spin systems are as indicated. (E and F) Aromatic TOCSY spectra of (E) wild-type IGF-I and (F) HisB5-IGF-I. Assignments are as indicated (IGF numbering scheme). Residues F16, F23, Y25, F26, Y32 and Y60 correspond to respective canonical positions B17, B24-B26, C2, and A19. Spectra were acquired in 10% deuterioacetic acid at 40° C at 700 MHz. Figure 8. 2D-NMR NOESY spectra of native and variant IGF-I. (A) wild-type IGF-I and (B) HisB5-IGF-I. Assignments of selected cross-peaks are as labeled. F23 and Y60 (vertical axis)

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

correspond to canonical positions B24 and A19; L14 and I43 correspond to canonical positions B15 and A2. Dashed line in (B) indicates resonance position of His4-C4H (canonical position B5). Spectra were acquired in 10% deuterioacetic acid at 40° C at 700 MHz. Figure 9. CD and Receptor-binding studies of HisB5-IGF-I. (A) Far-UV CD spectra of native IGF-I (solid line), IGF-swap (dashed line), and HisB5-IGF-I ( ). (B) CD-detected guanidine titrations of native IGF-I (solid line), IGF-swap (dashed line), and HisB5-IGF-I ( ). Ellipticity was detected at 222 nm. (C) IGF-1R receptor binding assay showing competitive displacement of 125I-labeled IGF-I tracer as a function of unlabeled ligand concentration: ( ) native IGF-I and ( ) HisB5-IGF-I. (D) Corresponding IR receptor binding assay (isoform B) showing competitive displacement of 125I-labeled insulin tracer as a function of unlabeled ligand concentration: ( ) human insulin, ( ) native IGF-I and ( ) HisB5-IGF-I. by guest on A

pril 20, 2020http://w

ww

.jbc.org/D

ownloaded from

Figure 1

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Figure 2

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Figure 3

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Figure 4

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Figure 5

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Figure 6

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Figure 7

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Figure 8

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

Figure 9

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from

H. Kent and Michael A. WeissWhittaker, Linda J. Whittaker, Aubree Ng, Charles T. Roberts, Jr, Peter Arvan, Stephen B.

Youhei Sohma, Qin xin Hua, Ming Liu, Nelson B. Phillips, Shi Quan Hu, JonathanConstraints and fine tuning in the evolution of a protein family

Contribution of residue B5 to the folding and function of insulin and IGF I.

published online December 3, 2009J. Biol. Chem. 

  10.1074/jbc.M109.062992Access the most updated version of this article at doi:

 Alerts:

  When a correction for this article is posted• 

When this article is cited• 

to choose from all of JBC's e-mail alertsClick here

Supplemental material:

  http://www.jbc.org/content/suppl/2009/12/03/M109.062992.DC1

by guest on April 20, 2020

http://ww

w.jbc.org/

Dow

nloaded from