Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies...
Transcript of Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies...
![Page 1: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/1.jpg)
INFSO-RI-508833
Enabling Grids for E-sciencE
www.eu-egee.org
Concepts of Grid Computing
![Page 2: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/2.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2
Enabling Grids for E-sciencE
INFSO-RI-508833
Acknowledgements
• This talk was originally prepared by Mike Mineter of NeSC and includes slides from previous tutorials and talks delivered by:– Dave Berry, Richard Hopkins (National e-Science Centre)– the EDG training team– Ian Foster, Argonne National Laboratories– Jeffrey Grethe, SDSC– EGEE colleagues
![Page 3: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/3.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 3
Enabling Grids for E-sciencE
INFSO-RI-508833
Overview
• Goal: To introduce the concepts of Grid computing assuming no previous knowledge
• Cover the topics of:– Why Grids?– What is a grid?– Is it secure?– Who uses grids? – Some Examples.– Is the problem solved? – current status of technology.
![Page 4: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/4.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 4
Enabling Grids for E-sciencE
INFSO-RI-508833
Contents
Why Grids?What is a Grid?Is it Secure?Some ExamplesCurrent StatusConclusion
![Page 5: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/5.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 5
Enabling Grids for E-sciencE
INFSO-RI-508833
Researchers in many locations need to share resources
Scientific instruments, data stores and computers in many locations
Before Grids
FTP, telnet, blood, sweat and tears… and little support for
collaboration
There must be a better way of doing this!!!
![Page 6: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/6.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 6
Enabling Grids for E-sciencE
INFSO-RI-508833
Middleware
Workstation
Mobile Access
Data-storage, Sensors, Experiments
Internet, networks
Supercomputer, PC-Cluster
Visualising
DLE
WA
RE
![Page 7: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/7.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 7
Enabling Grids for E-sciencE
INFSO-RI-508833
Resources connect to “The Grid”
Researchers in many locations need to share resources
Scientific instruments, data stores and computers in many locations
With Grids
Slide derived from EDG / LCG tutorials
![Page 8: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/8.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 8
Enabling Grids for E-sciencE
INFSO-RI-508833
Why the word “Grid”?
“The word Grid is used by analogy with the electric power grid, which provides pervasive access to electricity … and has had a dramatic impact on human capabilities and society. Many believe that by allowing all components of our information technology infrastructure … the Grid will have a similar transforming effect, allowing new classes of applications to emerge.”
Foster and Kesselman – The Grid 2
![Page 9: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/9.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 9
Enabling Grids for E-sciencE
INFSO-RI-508833
The grid vision
• The grid vision is of “Virtual computing” (and the information services used to locate computation and storage resources) – Compare this to the web:
Web pages are “virtual documents” – different parts come from different sourcesA search engine is used to locate these resources.
• The effect of collaboration through sharing resources (and expertise) is to expand the horizons of – Research – Commerce – engineering, … (“the knowledge economy”)– Public service – health, environment,…
![Page 10: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/10.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 10
Enabling Grids for E-sciencE
INFSO-RI-508833
Contents
Why Grids?What is a Grid?Is it Secure?Some ExamplesCurrent StatusConclusion
![Page 11: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/11.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 11
Enabling Grids for E-sciencE
INFSO-RI-508833
Virtual Organisation
Expanding Horizons
• The initial vision: “The Grid”• The present reality: Many
“grids”• Each grid is an infrastructure
enabling one or more user communities (called “virtual organisations”) to share computing resources
• What makes a user community?– People in different
organisations seeking to cooperate and share resources across their organisational boundaries
Institute
You
![Page 12: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/12.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 12
Enabling Grids for E-sciencE
INFSO-RI-508833
The Single Computer
• The Operating System enables easy use of – Input devices– Processor– Disks– Display– Any other attached devices
Disks, Processor, Memory, …
Application Software
Operating
System
![Page 13: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/13.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 13
Enabling Grids for E-sciencE
INFSO-RI-508833
The Local Area Network
Disks, Processor, …
Application Software
Operating System on each resource
Middleware for connecting to othercomputers, servers, printers, …
User just perceives “shared resources”, with no regard to location in the building:
- Authenticated by username / password
- Authorised to use own files,…
![Page 14: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/14.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 14
Enabling Grids for E-sciencE
INFSO-RI-508833
A Grid of Resources
THE INTERNET
THE INTERNET
Disks, Processor, …
Application Software
Operating System
Middleware for connecting to other computers, …
Grid Middleware
![Page 15: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/15.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 15
Enabling Grids for E-sciencE
INFSO-RI-508833
The components of a Grid
• Infrastructure– networking, computational resources, storage resources, …
• Middleware– the operating system of the grid, running on all resources.
• Operations infrastructure– Run enabling services (people + software)
• Virtual Organization management– Procedures for gaining access to resources
![Page 16: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/16.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 16
Enabling Grids for E-sciencE
INFSO-RI-508833
The term “Grid computing”
• “Grid computing” is a trendy phrase!• It’s therefore also a misused term
– Sometimes in Industry : “Grids” = clusters– Also used to refer to the harvesting of unused compute cycles,
e.g. SETI@home, Climateprediction.net
![Page 17: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/17.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 17
Enabling Grids for E-sciencE
INFSO-RI-508833
Grid projects
Many Grid development efforts — all over the world
•NASA Information Power Grid•DOE Science Grid•NSF National Virtual Observatory•NSF GriPhyN•DOE Particle Physics Data Grid•NSF TeraGrid•DOE ASCI Grid•DOE Earth Systems Grid•DARPA CoABS Grid•NEESGrid•DOH BIRN•NSF iVDGL
•DataGrid (CERN, ...)•EuroGrid (Unicore)•DataTag (CERN,…)•Astrophysical Virtual Observatory•GRIP (Globus/Unicore)•GRIA (Industrial applications)•GridLab (Cactus Toolkit)•CrossGrid (Infrastructure Components)•EGSO (Solar Physics)
•UK – OGSA-DAI, RealityGrid, GeoDise, Comb-e-Chem, DiscoveryNet, DAME, AstroGrid, GridPP, MyGrid, GOLD, eDiamond, Integrative Biology, …•Netherlands – VLAM, PolderGrid•Germany – UNICORE, Grid proposal•France – Grid funding approved•Italy – INFN Grid•Eire – Grid proposals•Switzerland - Network/Grid proposal•Hungary – DemoGrid, Grid proposal•Norway, Sweden - NorduGrid
![Page 18: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/18.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 18
Enabling Grids for E-sciencE
INFSO-RI-508833
Summary (so far)
• Virtual organisation: people and resources collaborating - crosses admin, organisational boundaries
• Grid middleware runs on each resource• User just perceives “shared resources” with no
concern for location or owning organisation
![Page 19: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/19.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 19
Enabling Grids for E-sciencE
INFSO-RI-508833
Contents
Why Grids?What is a Grid?Is it Secure?Some ExamplesCurrent StatusConclusion
![Page 20: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/20.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 20
Enabling Grids for E-sciencE
INFSO-RI-508833
Different Perspectives
• Users need – single sign-on: the ability to logon to a machine and have the
user’s identity passed to other resources as required– To trust owners of the resources they are using
• Providers of resources (computers, databases,..) need– risks to be controlled: they are asked to trust users they do not
know– Minimise impact on security – An ability to trace who did what.
• The solution comes from– Virtual Organisations– Digital Certificates
![Page 21: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/21.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 21
Enabling Grids for E-sciencE
INFSO-RI-508833
Users and Virtual Organisations
• Virtual Organisations and trust– User joins a Virtual Organisation – Digital certificate is basis of Authentication and Authorisation.– Identity passed to other resources you use, where it is mapped
to a local account – the mapping is maintained by the Virtual Organisation.
– The user trusts the Virtual Organisation to only use resources that are safe and secure
• User just perceives “shared resources” with no concern for location or owning organisation
![Page 22: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/22.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 22
Enabling Grids for E-sciencE
INFSO-RI-508833
Resource-Provider’s and VO’s
• Virtual Organisations and trust– A Resource-Provider trusts a Virtual Organisation– The Virtual Organisation trusts its users
• Common agreed policies establish rights for a Virtual Organization to use resources– Each resource provider has different usage and security
considerations that must be accounted for.
![Page 23: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/23.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 23
Enabling Grids for E-sciencE
INFSO-RI-508833
Digital Certificates
• A digital certificate is the basis for:– Single Sign on: – Authentication: How do I identify myself to a resource without
username/password for each resource I use?– Authorisation: what can I do? Determined by
User’s membership of a Virtual Organisation Virtual Organisation negotiations with resource providers
– Non-repudiation: the ability to prove who did what• Certificate Authorities issue digital certificates
– Certificate Authorities provide digital certificates after certifying user’s identity – for example by showing a passport
– Digital certificates issued by national Certification Authorities are recognized internationally – a pre-requisite of an international grid.
![Page 24: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/24.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 24
Enabling Grids for E-sciencE
INFSO-RI-508833
Certificate Authority Websites
• A list of Certificate Authorities that mutually recognize each other:
http://www.gridpma.org/.
• A list of the Certificate Authorities in the EU: http://marianne.in2p3.fr/datagrid/ca/ca-table-ca.html– E.g. In UK go to http://www.grid-support.ac.uk/ca/ralist.htm
![Page 25: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/25.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 25
Enabling Grids for E-sciencE
INFSO-RI-508833
The Grid Security Infrastructure
• The “Grid Security Infrastructure” middleware is the basis of (most) production grids
Grid SecurityInfrastructure
Authentication
Encryption & Data Integrity Authorization
Security
For all of this to work you must keep your digital certificate secure
![Page 26: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/26.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 26
Enabling Grids for E-sciencE
INFSO-RI-508833
Contents
Why Grids?What is a Grid?Is it Secure?Some ExamplesCurrent StatusConclusion
![Page 27: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/27.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 27
Enabling Grids for E-sciencE
INFSO-RI-508833
An early driver of Grids: e-Science
• What is e-Science? Collaborative science that is made possible by the sharing across the Internet of resources (data, instruments, computation, people’s expertise...)– Often very compute intensive– Often very data intensive (both creating new data and accessing
very large data collections) – data deluges from new technologies
– Crosses organisational boundaries
![Page 28: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/28.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 28
Enabling Grids for E-sciencE
INFSO-RI-508833
Astronomy
No. & sizes of data sets as of mid-2002,grouped by wavelength
• 12 waveband coverage of large areas of the sky
• Total about 200 TB data• Doubling every 12 months• Largest catalogues near 1B objects
Data and images courtesy Alex Szalay, John Hopkins University
![Page 29: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/29.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 29
Enabling Grids for E-sciencE
INFSO-RI-508833
Earth Observation: Ozone
• Building on European Datagrid experience
• To produce and store the Ozone profiles or columns – Enhance availability
• To extend the processing capabilities – Validation against other data– Mid-latitude ozone studies– ...
• To facilitate collaboration – Including with emerging large
scale European projects
GOME instrument(~75 GB - ~5000 orbits/y)
~28000 profiles/day
![Page 30: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/30.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 30
Enabling Grids for E-sciencE
INFSO-RI-508833
Large Hadron Collider at CERN
Mont Blanc(4810 m)
• Data Challenge:– 10 Petabytes/year of data !!!– 20 million CDs each year!
• Simulation, reconstruction, analysis:– LHC data handling requires computing
power equivalent to ~100,000 of today's fastest PC processors!
• Operational challenges– Reliable and scalable through project
lifetime of decades Downtown Geneva
~9000m
![Page 31: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/31.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 31
Enabling Grids for E-sciencE
INFSO-RI-508833
Engine flight data
Airline office
Maintenance Centre
European data center
London AirportNew York Airport
American data center
GridDiagnostics Centre
XTO
Engine Model
Case Based Reasoning
Companies:Rolls-RoyceDS&S Cybula
DAME: Grid based tools and Infer-structure for Aero-Engine Diagnosis and Prognosis
Universities:York,Leeds,Sheffield, Oxford
Distributed Aircraft Maintenance Environment
![Page 32: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/32.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 32
Enabling Grids for E-sciencE
INFSO-RI-508833
BLAST – comparing DNA or protein sequences
• BLAST is the first step for analysing new sequences: to compare DNA or protein sequences to other ones stored in personal or public databases.
• Ideal as a grid application – trivial to parallelise as independent concurrent jobs on one or more CEs.– Requires resources to store databases and run algorithms– Large user community
![Page 33: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/33.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 33
Enabling Grids for E-sciencE
INFSO-RI-508833
BLAST gridification
DB
BLASTSeq1 > dcscdssdcsdcdscbscdsbcbjbfvbfvbvfbvbvbhvbhsvbhdvbhfdbvfd
Seq2 > bvdfvfdvhbdfvbbhvdsvbhvbhdvrefghefgdscgdfgcsdycgdkcsqkc
…
Seqn > bvdfvfdvhbdfvbbhvdsvbhvbhdvrefghefgdscgdfgcsdycgdkcsqkchdsqhfduhdhdhqedezhhezldhezhfehflezfzejfv
DB
BLAST
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
DB
BLAST
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
DBBLAST
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
RESULTdedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbfvbfvbvfbvbvbhvbhsvbhdvbhfdbvfdbvdfvfdvhbdfvbhdbhvdsvbhvbhdvrefghefgdscgdfgcsdycgdkcsqkcqhdsqhfduhdhdhqedezhdhezldhezhfehflezfzeflehfhezfhehfezhflezhflhfhfelhfehflzlhfzdjazslzdhfhfdfezhfehfizhflqfhduhsdslchlkchudcscscdscdscdscsddzdzeqvnvqvnq! Vqlvkndlkvnldwdfbwdfbdbdwdfbfbndblnblkdnblkdbdfbwfdbfn
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
UI
ComputingelementInput
file
Computingelement
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
Seq1 >dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbdfndfjvbndfbnbnfbjnbjxbnxbjk:nxbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
Seq2 >dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbdfndfjvbndfbnbnfbjnbjxbnxbjk:nxbf
dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbf
Seqn >dedzedzdzedezdzecdscsdcscdssdcsdcdscbscdsbcbjbdfndfjvbndfbnbnfbjnbjxbnxbjk:nxbf
![Page 34: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/34.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 34
Enabling Grids for E-sciencE
INFSO-RI-508833
Contents
Why Grids?What is a Grid?Is it Secure?Some ExamplesCurrent StatusConclusion
![Page 35: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/35.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 35
Enabling Grids for E-sciencE
INFSO-RI-508833
… then where are we now?
If “The Grid”vision leads us here…
![Page 36: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/36.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 36
Enabling Grids for E-sciencE
INFSO-RI-508833
Grids: still a work in progress!!!
• Many key concepts identified and known• Many grid projects have tested these• Major efforts now on establishing:
– Standards (a slow process) (Global Grid Forum, http://www.gridforum.org/ )
– Production Grids for multiple Virtual Organisation’s“Production” = Reliable, sustainable, with commitments to quality of service
• In Europe, EGEE• In UK, National Grid Service• In US, Teragrid
One stack of middleware that serves many research (and other!!!)communities Operational procedures and services (people!, policy,..)
– New user communities• … whilst research & development continues
![Page 37: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/37.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 37
Enabling Grids for E-sciencE
INFSO-RI-508833
Contents
Why Grids?What is a Grid?Is it Secure?Some ExamplesCurrent StatusConclusion
![Page 38: Concepts of Grid Computing - Indico · 2018-11-17 · Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 2 Enabling Grids for E-sciencE INFSO-RI-508833 Acknowledgements](https://reader034.fdocuments.us/reader034/viewer/2022050513/5f9d91ab8ca65d3a52274c8c/html5/thumbnails/38.jpg)
Concepts of Grid Computing Grid Technologies for Digital Libraries, Athens 38
Enabling Grids for E-sciencE
INFSO-RI-508833
Summary
• Collaboration across multiple organisations – sharing data, computers, instruments, application software,..
• Single sign-on to resources in multiple organisations• Need for people-services as well as middleware
services • Drives are towards
– Production services (reliable, sustainable,… – against which research projects, etc… can plan with confidence)
In Europe, EGEE– Standards– New user communities