Computational Molecular Biology
description
Transcript of Computational Molecular Biology
![Page 1: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/1.jpg)
Computational Molecular Biology
Protein Structure: Introduction and Prediction
![Page 2: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/2.jpg)
My T. [email protected]
2
Protein Folding
One of the most important problem in molecular biology
Given the one-dimensional amino-acid sequence that specifies the protein, what is the protein’s fold in three dimensions?
![Page 3: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/3.jpg)
My T. [email protected]
3
Overview
Understand protein structures Primary, secondary, tertiary
Why study protein folding: Structure can reveal functional information which
we cannot find from the sequence Misfolding proteins can cause diseases: mad cow
disease Use in drug designs
![Page 4: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/4.jpg)
My T. [email protected]
4
Overview of Protein Structure
Proteins make up about 50% of the mass of the average human
Play a vital role in keeping our bodies functioning properly
Biopolymers made up of amino acids The order of the amino acids in a protein and
the properties of their side chains determine the three dimensional structure and function of the protein
![Page 5: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/5.jpg)
My T. [email protected]
5
Building blocks of proteins
Consist of:An amino group (-NH2)Carboxyl group (-COOH)Hydrogen (-H)A side chain group (-R)
attached to the central α-carbon
There are 20 amino acids Primary protein structure
is a sequence of a chain of amino acids
C
RR
C
H
NO
OHH
H
Aminogroup
Carboxylgroup
Side chain
Amino Acid
![Page 6: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/6.jpg)
My T. [email protected]
6
Side chains (Amino Acids)
20 amino acids have side chains that vary in structure, size, hydrogen bonding ability, and charge.
R gives the amino acid its identity R can be simple as hydrogen (glycine) or more
complex such as an aromatic ring (tryptophan)
![Page 7: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/7.jpg)
7
Chemical Structure of Amino Acids
![Page 9: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/9.jpg)
My T. [email protected]
9
Polypeptide More than fifty amino acids in a chain are called a polypeptide. A protein is usually composed of 50 to 400+ amino acids. We call the units of a protein amino acid residues.
carbonylcarbonylcarboncarbon
amideamidenitrogennitrogen
![Page 10: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/10.jpg)
My T. [email protected]
10
Side chain properties Carbon does not make hydrogen bonds with water
easily – hydrophobic. These ‘water fearing’ side chains tend to sequester themselves
in the interior of the protein O and N are generally more likely than C to h-bond to
water – hydrophilic Ten to turn outward to the exterior of the protein
![Page 12: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/12.jpg)
My T. [email protected]
12
Primary StructurePrimary structure: Linear String of Amino Acids
BackboneBackboneSide-chainSide-chain
... ALA PHE LEU ILE LEU ARG ...
Each amino acid within a protein is referred to as residues
Each different protein has a unique sequence of amino acid residues, this is its primary structure
![Page 13: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/13.jpg)
My T. [email protected]
13
Secondary Structure
Refers to the spatial arrangement of contiguous amino acid residues
Regularly repeating local structures stabilized by hydrogen bonds A hydrogen atom attached to a relatively
electronegative atom
Examples of secondary structure are the α–helix and β–pleated-sheet
![Page 14: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/14.jpg)
My T. [email protected]
14
Alpha-Helix
Amino acids adopt the form of a right handed spiral
The polypeptide backbone forms the inner part of the spiral
The side chains project outward every backbone N-H group
donates a hydrogen bond to the backbone C = O group
![Page 15: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/15.jpg)
My T. [email protected]
15
Beta-Pleated-Sheet
Consists of long polypeptide chains called beta-strands, aligned adjacent to each other in parallel or anti-parallel orientation
Hydrogen bonding between the strands keeps them together, forming the sheet
Hydrogen bonding occurs between amino and carboxyl groups of different strands
![Page 19: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/19.jpg)
My T. [email protected]
19
Tertiary Structure
The full dimensional structure, describing the overall shape of a protein
Also known as its fold
![Page 20: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/20.jpg)
My T. [email protected]
20
Quaternary Structure
Proteins are made up of multiple polypeptide chains, each called a subunit
The spatial arrangement of these subunits is referred to as the quaternary structure
Sometimes distinct proteins must combine together in order to form the correct 3-dimensional structure for a particular protein to function properly.
Example: the protein hemoglobin, which carries oxygen in blood. Hemoglobin is made of four similar proteins that combine to form its quaternary structure.
![Page 21: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/21.jpg)
My T. [email protected]
21
Other Units of Structure
Motifs (super-secondary structure): Frequently occurring combinations of secondary
structure units A pattern of alpha-helices and beta-strands
Domains: A protein chain often consists of different regions, or domains Domains within a protein often perform different
functions Can have completely different structures and folds Typically a 100 to 400 residues long
![Page 22: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/22.jpg)
My T. [email protected]
22
What Determines Structure
What causes a protein to fold in a particular way?
At a fundamental level, chemical interactions between all the amino acids in the sequence contribute to a protein’s final conformation
There are four fundamental chemical forces: Hydrogen bonds Hydrophobic effect Van der Waal Forces Electrostatic forces
![Page 23: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/23.jpg)
My T. [email protected]
23
Hydrogen Bonds
Occurs when a pair of nucliophilic atoms such as oxygen and nitrogen share a hydrogen between them
Pattern of hydrogen bounding is essential in stabilizing basic secondary structures
![Page 24: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/24.jpg)
My T. [email protected]
24
Van der Waal Forces
Interactions between immediately adjacent atoms
Result from the attraction between an atom’s nucleus and it neighbor’s electrons
![Page 25: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/25.jpg)
My T. [email protected]
25
Electrostatic Forces
Oppositely charged side chains con form salt-bridges, which pulls chains together
![Page 26: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/26.jpg)
My T. [email protected]
26
Experimental Determination
Centralized database (to deposit protein structures) called the protein Databank (PDB), accessible at http://www.rcsb.org/pdb/index.html
Two main techniques are used to determine/verify the structure of a given protein: X-ray crystallography Nuclear Magnetic Resonance (NMR)
Both are slow, labor intensive, expensive (sometimes longer than a year!)
![Page 27: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/27.jpg)
My T. [email protected]
27
X-ray Crystallography
A technique that can reveal the precise three dimensional positions of most of the atoms in a protein molecule
The protein is first isolated to yield a high concentration solution of the protein
This solution is then used to grow crystals The resulting crystal is then exposed to an X-
ray beam
![Page 28: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/28.jpg)
My T. [email protected]
28
Disadvantages
Not all proteins can be crystallized Crystalline structure of a protein may be
different from its structure Multiple maps may be needed to get a
consensus
![Page 29: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/29.jpg)
My T. [email protected]
29
NMR
The spinning of certain atomic nuclei generates a magnetic moment
NMR measures the energy levels of such magnetic nuclei (radio frequency)
These levels are sensitive to the environment of the atom: What they are bonded to, which atoms they are
close to spatially, what distances are between different atoms…
Thus by carefully measurement, the structure of the protein can be constructed
![Page 30: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/30.jpg)
My T. [email protected]
30
Disadvantages
Constraint of the size of the protein – an upper bound is 200 residues
Protein structure is very sensitive to pH.
![Page 31: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/31.jpg)
My T. [email protected]
31
Computational Methods
Given a long and painful experimental methods, need computational approaches to predict the structure from its sequence.
![Page 38: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/38.jpg)
My T. [email protected]
38
Crystal
A crystal can be defined as an arrangement of building blocks which is periodic in three dimensions
![Page 39: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/39.jpg)
My T. [email protected]
39
Crystallize a Protein
Have to find the right combination of all the different influences to get the protein to crystallize
This can take a couple hundred or even thousand experiments
Most popular way to conduct these experiments Hanging-drop method
![Page 40: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/40.jpg)
My T. [email protected]
40
Hanging drop method The reservoir contains a precipitant
concentration twice as high as the protein solution
The protein solutions is made up of 50% of stock protein solution and 50% of reservoir solution
Overtime, water will diffuse from the protein drop into the reservoir
Both the protein concentration and precipitant concentration will increase
Crystals will appear after days, weeks, months
![Page 41: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/41.jpg)
My T. [email protected]
41
Properties of protein crystal
Very soft Mechanically fragile Large solvent areas (30-70%)
![Page 43: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/43.jpg)
My T. [email protected]
43
Why do we need Crystals
A single molecule could never be oriented and handled properly for a diffraction experiment
In a crystal, we have about 1015 molecules in the same orientation so that we get a tremendous amplification of the diffraction
Crystals produce much simpler diffraction patterns than single molecules
![Page 44: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/44.jpg)
My T. [email protected]
44
Why do we need X-rays
X-rays are electromagnetic waves with a wavelength close to the distance of atoms in the protein molecules
To get information about where the atoms are, we need to resolve them -> thus we need radiation
![Page 47: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/47.jpg)
My T. [email protected]
47
Resolution
The primary measure of crystal order/quality of the model
Ranges of resolution: Low resolution (>3-5 Ao) is difficult to see the side
chains only the overall structural fold Medium resolution (2.5-3 Ao) High resolution (2.0 Ao)
![Page 48: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/48.jpg)
My T. [email protected]
48
Some Crystallographic Terms
h,k,l: Miller indices (like a name of the reflection)
I(h,k,l): intensity 2θ: angle between the x-ray incident beam and
reflect beam
![Page 49: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/49.jpg)
My T. [email protected]
49
Diffraction by a Molecule in a Crystal
The electric vector of the X-ray wave forces the electrons in our sample to oscillate with the same wavelength as the incoming wave
![Page 51: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/51.jpg)
My T. [email protected]
51
Structure Factor Equation
fj: proportional to the number of electrons this atom j has
One of the fundamental equations in X-ray Crystallography
![Page 52: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/52.jpg)
My T. [email protected]
52
The Phase
From the measurement, we can only obtain the intensity I(hkl) of any given reflection (hkl)
The phase α(hkl) cannot be measured
![Page 53: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/53.jpg)
My T. [email protected]
53
How to Determine the Phase Small changes are
introduced into the crystal of the protein of interest: Eg: soaking the crystal
in a solution containing a heavy atom compound
Second diffraction data set needs to be collected
Comparing two data sets to determine the phases (also able to localize the heavy atoms)
![Page 55: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/55.jpg)
My T. [email protected]
55
Electron Density Map
Once we know the complete diffraction pattern (amplitudes and phases), need to calculate an image of the structure
The above equation returns the electron density (so we get a map of where the electrons are their concentration)
![Page 56: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/56.jpg)
My T. [email protected]
56
Interpretation of Electron Density Now, the electron density has to be interpreted in terms
of atom identities and positions.
(1): packing of the whole molecules is shown in the crystal
(2): a chain of seven amino acids in shown with the resulting structure superimposed
(3): the electron density of a trypophan side chain is shown
![Page 58: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/58.jpg)
My T. [email protected]
58
Nuclear Magnetic Resonance
Concentrated protein solution (very purified)
Magnetic field
Effect of radio frequencies on the resonance of
different atoms is measured.
![Page 60: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/60.jpg)
My T. [email protected]
60
NMR
Behavior of any atom is influenced by neighboring atoms
more closely spaced residues are more perturbed than distant residues
can calculate distances based on perturbation
![Page 62: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/62.jpg)
Computational Molecular Biology
Protein Structure: Secondary Prediction
![Page 63: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/63.jpg)
My T. [email protected]
63
Primary Structure: Symbolic Definition
A = {A,C,D,E,F,G,H,I,J,K,L,M,N,P,Q,R,S.T,V,W,Y } – set of symbols denoting all amino acids
A* - set of all finite sequences formed out of elements of A, called protein sequences
Elements of A* are denoted by x, y, z …..i.e. we write x A*, y A*, zA*, … etc
PROTEIN PRIMARY STRUCTURE: any x A* is also called a protein sequence or protein sub-unit
![Page 64: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/64.jpg)
My T. [email protected]
64
Protein Secondary Structure (PSS)
Secondary structure: the arrangement of the peptide backbone in space. It is produced by hydrogen bondings between amino acids
PROTEIN SECONDARY STRUCTURE consists of: protein sequence and its hydrogen bonding patterns called SS categories
![Page 65: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/65.jpg)
My T. [email protected]
65
Protein Secondary Structure
Databases for protein sequences are expanding rapidly
The number of determined protein structures (PSS – protein secondary structures) and the number of known protein sequences is still limited
PSSP (Protein Secondary Structure Prediction) research is trying to breach this gap.
![Page 66: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/66.jpg)
My T. [email protected]
66
Protein Secondary Structure
The most commonly observed conformations in secondary structure are:Alpha HelixBeta Sheets/StrandsLoops/Turns
![Page 67: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/67.jpg)
My T. [email protected]
67
Turns and Loops
Secondary structure elements are connected by regions of turns and loops
Turns – short regions of non-, non- conformation
Loops – larger stretches with no secondary structure.
![Page 68: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/68.jpg)
My T. [email protected]
68
Three secondary structure states
Prediction methods are normally assessed for 3 states: H (helix) E (strands) L (others (loop or turn))
![Page 69: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/69.jpg)
My T. [email protected]
69
Secondary Structure
8 different categories:H: - helixG: 310 – helix I: - helix (extremely rare) E: - strandB: - bridgeT: - turnS: bend L: the rest
![Page 70: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/70.jpg)
My T. [email protected]
70
Three SS states: Reduction methods
Method 1, used by DSSP program: H(helix) ={ G (310 – helix), H (- helix)}E (strands) = {E (-strand), B (-bridge)} , L = all the rest• Shortly: E,B => E; G,H => H; Rest => C
Method 2, used by STRIDE program: H as in Method 1E = {E (-strand), b (isolated -bridge)},L = all the rest
![Page 71: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/71.jpg)
My T. [email protected]
71
Three SS states: Reduction methods
Method 3, used by DEFINE program: H(helix) as in Method 1 E (strands) = {E (-strand)}, L = all the rest
![Page 72: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/72.jpg)
My T. [email protected]
72
Example of typical PSS Data
Example:Sequence
KELVLALYDYQEKSPREVTHKKGDILTLLNSTNKDWWKYEYNDRQGFVP
Observed SS HHHHHLLLLEEEHHHLLLEEEEEELLLHHHHHHHHLLLEEEE
EELLLHHH
![Page 73: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/73.jpg)
My T. [email protected]
73
PSS: Symbolic DefinitionGiven A =
{A,C,D,E,F,G,H,I,J,K,L,M,N,P,Q,R,S.T,V,W,Y } – set of symbols denoting amino acids and a protein sequence x A*
Let S ={ H, E, L} be the set of symbols of 3 states: H (helix), E (strands) and L (loop) and S* be the set of all finite sequences of elements of S.
We denote elements of S* by e, e S*
![Page 74: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/74.jpg)
My T. [email protected]
74
PSS: Symbolic Definition
Any one-to-one function
f : A* S* i.e. f A* x S* is called a protein secondary structure (PSS)
identification functionAn element (x, e) f is a called protein
secondary structure (of the protein sequence x)The element e S* (of (x, e) f ) is called
secondary structure.
![Page 75: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/75.jpg)
My T. [email protected]
75
PSSP
If a protein sequence shows clear similarity to a protein of known three dimensional structure then the most accurate method of predicting the
secondary structure is to align the sequences by standard dynamic programming algorithms
Why? homology modelling is much more accurate than
secondary structure prediction for high levels of sequence identity.
![Page 76: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/76.jpg)
My T. [email protected]
76
PSSP
Secondary structure prediction methods are of most use when sequence similarity to a protein of known structure is undetectable.
It is important that there is no detectable sequence similarity between sequences used to train and test secondary structure prediction methods.
![Page 77: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/77.jpg)
My T. [email protected]
77
Classification and Classifiers
Given a database table DB with a special atribute C, called a class attribute (or decision attribute). The values: C1, C2, ...Cn of the class atrribute are called class labels.
Example: A1 A2 A3 A4 C
1 1 m g c1
0 1 v g c2
1 0 m b c1
![Page 78: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/78.jpg)
My T. [email protected]
78
Classification and Classifiers The attribute C partitions the records in the DB:
divides the records into disjoint subsets defined by the attributes C values, CLASSIFIES the records.
It means we use the attributre C and its values to divide the set R of records of DB into n disjoint classes:
C1={ rDB: C=c1} ...... Cn={rDB: C=cn} Example (from our table)
C1 = { (1,1,m,g), (1,0,m,b)} = {r1,r3}
C2 = { (0,1,v,g)} ={r2}
![Page 79: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/79.jpg)
My T. [email protected]
79
Classification and Classifiers An algorithm is called a classification algorithm if it uses the
data and its classification to build a set of patterns.
Those patterns are structured in such a way that we can use them to classify unknown sets of objects- unknown records.
For that reason (because of the goal) the classification algorithm is often called shortly a classifier.
The name classifier implies more then just classification algorithm. A classifier is final product of a data set and a classification algorithm.
![Page 80: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/80.jpg)
My T. [email protected]
80
Classification and Classifiers Building a classifier consists of two phases:
training and testing. In both phases we use data (training data set and disjoint with
it test data set) for which the class labels are known for ALL of the records.
We use the training data set to create patterns We evaluate created patterns with the use of of test data,
which classification is known. The measure for a trained classifier accuracy is called
predictive accuracy. The classifier is build i.e. we terminate the process if it has
been trained and tested and predictive accuracy was on an acceptable level.
![Page 81: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/81.jpg)
My T. [email protected]
81
Classifiers Predictive Accuracy
PREDICTIVE ACCURACY of a classifier is a percentage of well classified data in the testing data set.
Predictive accuracy depends heavily on a choice of the test and training data.
There are many methods of choosing test and and training sets and hence evaluating the predictive accuracy. This is a separate field of research.
![Page 82: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/82.jpg)
My T. [email protected]
82
Accuracy Evaluation
Use training data to adjust parameters of method until it gives the best agreement between its predictions and the known classes
Use the testing data to evaluate how well the method works (without adjusting parameters!)
How do we report the performance?Average accuracy = fraction of all test examples
that were classified correctly
![Page 83: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/83.jpg)
My T. [email protected]
83
Accuracy Evaluation
Multiple cross-validation test has to be performed to exclude a potential dependency of the evaluated accuracy on the particular test set chosen
Jack-Knife: Use 129 chains for setting up the tool (training set) 1 for estimating the performance (testing) This has to be repeated 130 times until each protein
has been used once for testing The average over all 130 tests gives an estimate of
the prediction accuracy
![Page 84: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/84.jpg)
My T. [email protected]
84
PSSP Datasets Historic RS126 dataset. Contains126 sub-units with known
secondary structure selected by Rost and Sander. Today is not used anymore
CB513 dataset. Contains 513 sub-units with known secondary structure selected by Cuff and Barton in 1999. Used quite frencently in PSSP research
HS17771 dataset. Created by Hobohm and Scharf. In March-2002 it contained 1771 sub-units
Lots of authors has their own and “secret” datasets
![Page 85: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/85.jpg)
My T. [email protected]
85
Measures for PSSP accuracy
http://cubic.bioc.columbia.edu/eva/doc/measure_sec.html (for more information)
Q3 :Three-state prediction accuracy (percent of succesful classified)
Qi %obs: How many of the observed residues
were correctly predicted? Qi
%prd: How many of the predicted residues were correctly predicted?
![Page 86: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/86.jpg)
My T. [email protected]
86
Measures for PSSP Accuracy
Aij = number of residues predicted to be in structure type j and observed to be in type i
Number of residues predicted to be in structure i:
Number of residues observed to be in structure i:
3
1jjii Aa
3
1jiji Ab
![Page 87: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/87.jpg)
My T. [email protected]
87
Measures for SSP Accuracy
The percentage of residues correctly predicted to be in class i relative to those observed to be in class i
The percentages of residues correctly predicted to be in class i from all residues predicted to be in i
Overall 3-state accuracy
100% i
iiobsii b
AQQ
100% i
iipredi a
AQ
100
3
13
b
AQ i
ii
![Page 88: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/88.jpg)
My T. [email protected]
88
PSSP Algorithms
There are three generations in PSSP algorithms• First Generation: based on statistical information of
single amino acids (1960s and 1970s)• Second Generation: based on windows (segments)
of amino acids. Typically a window containes 11-21 amino acids (dominating the filed until early 1990s)
• Third Generation: based on the use of windows on evolutionary information
![Page 89: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/89.jpg)
My T. [email protected]
89
PSSP: First Generation
First generation PSSP systems are based on statistical information on a single amino acid
The most relevant algorithms:Chow-Fasman, 1974GOR, 1978
Both algorithms claimed 74-78% of predictive accuracy, but tested with better constructed datasets were proved to have the predictive accuracy ~50% (Nishikawa, 1983)
![Page 90: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/90.jpg)
My T. [email protected]
90
Chou-Fasman methodChou-Fasman method
Uses table of conformational parameters determined primarily from measurements of the known structure (from experimental methods)
Table consists of one “likelihood” for each structure for each amino acid
Based on frequencies of residues in -helices, -sheets and turns
Notation: P(H): propensity to form alpha helices f(i): probability of being in position 1 (of a turn)
![Page 91: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/91.jpg)
My T. [email protected]
91
Chou-Fasman Pij-valuesName P(H) P(E) P(turn) f(i) f(i+1) f(i+2) f(i+3)
Alanine 142 83 66 0.06 0.076 0.035 0.058
Arginine 98 93 95 0.07 0.106 0.099 0.085
Aspartic Acid 101 54 146 0.147 0.11 0.179 0.081
Asparagine 67 89 156 0.161 0.083 0.191 0.091
Cysteine 70 119 119 0.149 0.05 0.117 0.128
Glutamic Acid 151 37 74 0.056 0.06 0.077 0.064
Glutamine 111 110 98 0.074 0.098 0.037 0.098
Glycine 57 75 156 0.102 0.085 0.19 0.152
Histidine 100 87 95 0.14 0.047 0.093 0.054
Isoleucine 108 160 47 0.043 0.034 0.013 0.056
Leucine 121 130 59 0.061 0.025 0.036 0.07
Lysine 114 74 101 0.055 0.115 0.072 0.095
Methionine 145 105 60 0.068 0.082 0.014 0.055
Phenylalanine 113 138 60 0.059 0.041 0.065 0.065
Proline 57 55 152 0.102 0.301 0.034 0.068
Serine 77 75 143 0.12 0.139 0.125 0.106
Threonine 83 119 96 0.086 0.108 0.065 0.079
Tryptophan 108 137 96 0.077 0.013 0.064 0.167
Tyrosine 69 147 114 0.082 0.065 0.114 0.125
Valine 106 170 50 0.062 0.048 0.028 0.053
![Page 92: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/92.jpg)
My T. [email protected]
92
Chou-FasmanChou-Fasman
A prediction is made for each type of structure for each amino acid Can result in ambiguity if a region has high
propensities for both helix and sheet (higher value usually chosen)
![Page 93: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/93.jpg)
My T. [email protected]
93
Chou-FasmanHow it works:1. Assign all of the residues the appropriate set of parameters2. Identify -helix and -sheet regions. Extend the regions in
both directions.3. If structures overlap compare average values for P(H) and
P(E) and assign secondary structure based on best scores.4. Turns are calculated using 2 different probability values.
![Page 94: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/94.jpg)
My T. [email protected]
94
Assign Pij values
1. Assign all of the residues the appropriate set of parameters
T S P T A E L M R S T GP(H) 69 77 57 69 142 151 121 145 98 77 69 57P(E) 147 75 55 147 83 37 130 105 93 75 147 75
P(turn) 114 143 152 114 66 74 59 60 95 143 114 156
![Page 95: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/95.jpg)
My T. [email protected]
95
Scan peptide for helix regions
2. Identify regions where 4 out of 6 have a
P(H) >100 “alpha-helix nucleus”
T S P T A E L M R S T GP(H) 69 77 57 69 142 151 121 145 98 77 69 57
T S P T A E L M R S T GP(H) 69 77 57 69 142 151 121 145 98 77 69 57
![Page 96: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/96.jpg)
My T. [email protected]
96
Extend -helix nucleus
3. Extend helix in both directions until a set of four consecutive residues with P(H) <100.
T S P T A E L M R S T GP(H) 69 77 57 69 142 151 121 145 98 77 69 57
Find sum of P(H) and sum of P(E) in the extended regionIf region is long enough ( >= 5 letters) and sum P(H) > sum P(E) then declare the extended region as alpha helix
![Page 97: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/97.jpg)
My T. [email protected]
97
Scan peptide for -sheet regions4. Identify regions where 3 out of 5 have a
P(E) >100 “-sheet nucleus”
5. Extend -sheet until 4 continuous residues with an average P(E) < 100
6. If region average > 100 and the average P(E) > average P(H) then “-sheet”
T S P T A E L M R S T GP(H) 69 77 57 69 142 151 121 145 98 77 69 57P(E) 147 75 55 147 83 37 130 105 93 75 147 75
![Page 98: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/98.jpg)
My T. [email protected]
98
Overlapping
Resolving overlapping alpha helix & beta sheetCompute sum of P(H) and sum of P(E) in the
overlap.If sum P(H) > sum P(E) => alpha helixIf sum P(E) > sum P(H) => beta sheet
![Page 99: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/99.jpg)
My T. [email protected]
99
Turn PredictionAn amino acid is predicted as turn if all of the
following holds:f(i)*f(i+1)*f(i+2)*f(i+3) > 0.000075Avg(P(i+k)) > 100, for k=0, 1, 2, 3Sum(P(t)) > Sum(P(H)) and Sum(P(E)) for i+k, (k=0, 1,
2, 3)
![Page 100: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/100.jpg)
My T. [email protected]
100
PSSP: Second Generation
Based on the information contained in a window of amino acids (11-21 aa.)
The most systems use algorithms based on: Statistical information Physico-chemical properties Sequence patterns Graph-theory Multivariante statistics Expert rules Nearest-neighbour algorithms
![Page 101: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/101.jpg)
My T. [email protected]
101
PSSP: First & Second Generation
Main problems:Prediction accuracy <70%
SS assigments differ even between crystals of the same protein
SS formation is partially determined by long-range interactions, i.e., by contacts between residues that are not visible by any method based on windows of 11-21 adjacent residues
![Page 102: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/102.jpg)
My T. [email protected]
102
PSSP: First & Second Generation
Main problems:Prediction accuracy for -strand 28-48%,
only slightly better than random beta-sheet formation is determined by more
nonlocal contacts than in alpha-helix formation
Predicted helices and strands are usually too short Overlooked by most developers
![Page 103: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/103.jpg)
My T. [email protected]
103
Example of Second Generation
Example for typical secondary structure prediction of the 2nd generation.
The protein sequence (SEQ ) given was the SH3 structure. The observed secondary structure (OBS ) was assigned by DSSP (H
= helix; E = strand; blank = non-regular structure; the dashes indicate the continuation).
The typical prediction of too short segments (TYP ) poses the following problems in practice. (i) Are the residues predicted to be strand in segments 1, 5, and 6
errors, or should the helices be elongated? (ii) Should the 2nd and 3rd strand be joined, or should one of them
be ignored, or does the prediction indicate two strands, here? Note: the three-state per-residue accuracy is 60% for the prediction given.
![Page 104: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/104.jpg)
My T. [email protected]
104
PSSP: Third GenerationPHD: First algorithm in this generation (1994) Evolutionary information improves the prediction
accuracy to 72%
Use of evolutionary information:1. Scan a database with known sequences with alignment methods
for finding similar sequences
2. Filter the previous list with a threshold to identify the most significant sequences
3. Build amino acid exchange profiles based on the probable homologs (most significant sequences)
4. The profiles are used in the prediction, i.e. in building the classifier
![Page 105: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/105.jpg)
My T. [email protected]
105
PSSP: Third GenerationMany of the second generation algorithms
have been updated to the third generation
![Page 106: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/106.jpg)
My T. [email protected]
106
PSSP: Third Generation
Due to the improvement of protein information in databases i.e. better evolutionary information, today’s predictive accuracy is ~80%
It is believed that maximum reachable accuracy is 88%. Why such conjecture?
![Page 107: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/107.jpg)
My T. [email protected]
107
Why 88%
SS assignments may vary for two versions of the same structure Dynamic objects with some regions being more
mobile than others Assignment differ by 5-15% between different X-
ray (NMR) versions of the same protein Assignment diff. by about12% between structural
homologues B. Rost, C. Sander, and R. Schneider,
Redefining the goals of protein secondary structure predictions, J. Mol. Bio.
![Page 108: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/108.jpg)
My T. [email protected]
108
PSSP Data Preparation
Public Protein Data Sets used in PSSP research contain protein secondary structure sequences. In order to use classification algorithms we must transform secondary structure sequences into classification data tables.
Records in the classification data tables are called, in PSSP literature (learning) instances.
The mechanism used in this transformation process is called window.
A window algorithm has a secondary structure as input and returns a classification table: set of instances for the classification algorithm.
![Page 109: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/109.jpg)
My T. [email protected]
109
Window Consider a secondary structure (x, e).
where (x,e)= (x1x2 …xn, e1e2…en)
Window of the length w chooses a subsequence of length w of x1x2 …xn, and an element ei from e1e2…en, corresponding to a special position in the window, usually the middle
Window moves along the sequences
x = x1x2 …xn and e= e1e2…en
simultaneously, starting at the beginning moving to the right one letter at the time at each step of the process.
![Page 110: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/110.jpg)
My T. [email protected]
110
Window: Sequence to StructureSuch window is called sequence to structure
window. We will call it for short a window.The process terminates when the window or its
middle position reaches the end of the sequence x.
The pair: (subsequence, element of e ) is often written in a form
subsequence H, E or L
is called an instance, or a rule.
![Page 111: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/111.jpg)
My T. [email protected]
111
Example: Window
Consider a secondary structure (x, e) and the window of length 5 with the special position in the middle (bold letters)
Fist position of the window is:
x = A R N S T V V S T A A ….
e = H H H H L L L E E EWindow returns instance: A R N S T H
![Page 112: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/112.jpg)
My T. [email protected]
112
Example: Window
Second position of the window is:
x = A R N S T V V S T A A ….
e = H H H H L L L E E EWindows returns instance:
R N S T V H
Next instances are:N S T V V LS T V V S LT V V S T L
![Page 113: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/113.jpg)
My T. [email protected]
113
Symbolic NotationLet f be a protein secondary structure (PSS)
identification function:
f : A* S* i.e. f A* x S* Let x= x1x2…xn, e= e1e2…en, f(x)= e, we define
f(x1x2…xn)|{xi}= ei, i.e. f(x)|{xi}= ei
![Page 114: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/114.jpg)
My T. [email protected]
114
Example:Semantics of Instances
Let• x = A R N S T V V S T A A ….•e = H H H H L L L E E E
And assume that the windows returns an instance:
A R N S T H
•Semantics of the instance is:
f(x)|{N}=H,
where f is the identification function and N is preceded by A R and followed by S T and the window has the length 5
![Page 115: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/115.jpg)
My T. [email protected]
115
Classification Data Base (Table)We build the classification table with attributes being
the positions p1, p2, p3, p4, p5 .. pw in the window, where w is length of the window. The corresponding values of attributes are elements of of
the subsequent on the given position.Classification attribute is S with values in the set {H,
E, L} assigned by the window operation (instance, rule).
The classification table for our example (first few records) is the following.
![Page 116: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/116.jpg)
My T. [email protected]
116
Classification Table (Example) x = A R N S T V V S T A A …. e = H H H H L L L E E E
p1 p2 p3 p4 p5 S
A R N S T H
R N S T V H
N S T V V L
S T V V S L
Semantics of record r= r(p1, p2, p3,p4,p5, S) is : f(x)|{Vp3} = Vs
where Va denotes a value of the attribute a.
![Page 117: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/117.jpg)
My T. [email protected]
117
Size of classification datasets (tables)
The window mechanism produces very large datasets
For example window of size 13 applied to the CB513 dataset of 513 protein subunits produces about
70,000 records (instances)
![Page 118: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/118.jpg)
My T. [email protected]
118
Window
Window has the following parameters:PARAMETER 1 : i N+, the starting point of
the window as it moves along the sequence x= x1 x2 …. xn. The value i=1 means that window starts at x1, i=5 means that window starts at x5
PARAMETER 2: w N+ denotes the size (length) of the window.
For example: the PHD system of Rost and Sander (1994) uses two window sizes: 13 and 17.
![Page 119: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/119.jpg)
My T. [email protected]
119
Window
PARAMETER 3: p {1,2, …, w} where p is a special position of the window
that returns the classification attribute values from S ={H, E, L} and w is the size (length) of the window
PSSP PROBLEM:
find optimal size w, optimal special position p for the best prediction accuracy
![Page 120: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/120.jpg)
My T. [email protected]
120
Window: Symbolic Definition
Window Arguments: window parameters and secondary structure (x,e)
Window Value: (subsequence of x, element of e)OPERATION (sequence – to –structure window)
W is a partial function
W: N+ N+ {1,…, k} (A* S* ) A* S
W(i, k, p, (x,e)) = (xi x(i+1)…. x(i+k-1), f(x)|{x(i+p)}) where (x,e)= (x1x2 ..xn, e1e2…en)
![Page 121: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/121.jpg)
My T. [email protected]
121
Neural network models
machine learning approach provide training sets of structures (e.g. -helices, non -
helices) are trained to recognize patterns in known secondary
structures provide test set (proteins with known structures)
accuracy ~ 70 –75%
![Page 122: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/122.jpg)
My T. [email protected]
122
Reasons for improved accuracy
Align sequence with other related proteins of the same protein family
Find members that has a known structure If significant matches between structure and
sequence assign secondary structures to corresponding residues
![Page 125: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/125.jpg)
My T. [email protected]
125
Input Layer
Most of approach set w = 17. Why? Based on evidence of statistical correlation with
secondary structure as far as 8 residues on either side of the prediction point
The input layer consists of: 17 blocks, each represent a position of window Each block has 21 units:
The first 20 units represent the 20 aa One to provide a null input used when the moving
window overlaps the amino- or carboxyl-terminal end of the protein
![Page 126: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/126.jpg)
My T. [email protected]
126
Binary Encoding Scheme
Example: Let w = 5, and let say we have the sequence:
A E G K Q…. Then the input layer is: A,C,D,E,F,G,…,N,P,Q,R,S.T,V,W,Y
1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 …. 0 0
0 0… 1 0 …..
0 … 0 1 0 …..
![Page 127: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/127.jpg)
My T. [email protected]
127
Hidden Layer
Represent the structure of the central aa Encoding scheme:
Can use two units to present: (1,0) = H, (0,1) = E, (0,0) = L
Some uses three units: (1,0,0) = H, (0,1,0) = E, (0,0,1) = L
For each connection, we can assign some weight value.
This weight value can be adjusted to best fit the data (training)
![Page 128: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/128.jpg)
My T. [email protected]
128
Output Level
Based on the hidden level and some function f, calculate the output.
Helix is assigned to any group of 4 or more contiguous residues Having helix output values greater than sheet outputs and
greater than some threshold t
Strand (E) is assigned to any group of two or more contiguous resides, having sheet output values greater than helix outputs and greater than t
Otherwise, assigned to L Note that t can be adjusted as well (training)
![Page 129: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/129.jpg)
My T. [email protected]
129
How PHD works
Step 1. BLAST search with input sequence
Step 2. Perform multiple seq. alignment and calculate aa frequencies for each position
Protein DSSP aligned sequence Pos. profile generation
K K-HK 1 K=0.75, H=0.25
E EDAE 2 E=0.6, D=0.2, A=0.2
L FFFF 3 L=0.2, F=0.8
N SAAS 4 N=0.2, S=0.4, A=0.4
D QKKQ 5 K=0.4,Q=0.4 D=0.2
L LLLL 6 L=1.0
E EEEE 7 E=1.0
K KEKK 8 K=0.2, E=0.2
Y FFYF 9 Y=0.4, F=0.6
N DDND 10 D=0.6, N=0.4
![Page 130: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/130.jpg)
My T. [email protected]
130
How PHD works
Step 3. First Level: “Sequence to structure net” Input: alignment profile, Output: units for H, E, LCalculate “occurrences” of any of the residues to be present in either an a-helix, b-strand, or loop.
1234567
H = 0.05E = 0.18L= 0.67
N=0.2, S=0.4, A=0.4
![Page 131: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/131.jpg)
My T. [email protected]
131
How PHD works
Step 3. Second Level: “Structure to structure net”
Input: First Level values, Output: units for H, E, L
Window size = 17
H = 0.59E = 0.09L= 0.31
E=0.18
Step 4. Decision level
![Page 132: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/132.jpg)
My T. [email protected]
132
Prepare Data for PHD Neural Nets Starting from a sequence of
unknown structure (SEQUENCE ) the following steps are required to finally feed evolutionary information into the PHD neural networks:1. a data base search for
homologues (method Blast), 2. a refined profile-based dynamic-
programming alignment of the most likely homologues (method MaxHom)
3. a decision for which proteins will be considered as homologues (length-depend cut-off for pairwise sequence identity)
4. a final refinement, and extraction of the resulting multiple alignment. Numbers 1-3 indicate the points where users of the PredictProtein service can interfere to improve prediction accuracy without changes made to the final prediction method PHD .
http://cubic.bioc.columbia.edu/papers/2000_rev_humana/paper.html
![Page 134: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/134.jpg)
My T. [email protected]
134
Prediction Accuracy
Authors Year % acurracy MethodChou-Fasman 1974 50% propensities of aa's in 2nd structures Garnier 1978 62% interactions between aa'sLevin 1993 69% multiple seq. alignments (MSA)Rost & Sander 1994 72% neural networks + MSA
![Page 135: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/135.jpg)
My T. [email protected]
135
Where can I learn more?
Protein Structure Prediction Center Biology and Biotechnology Research Program
Lawrence Livermore National Laboratory, Livermore, CA
http://predictioncenter.llnl.gov/Center.html
DSSPDatabase of Secondary Structure Prediction
http://www.sander.ebi.ac.uk/dssp/
![Page 136: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/136.jpg)
Computational Molecular Biology
Protein Structure: Tertiary Prediction via Threading
![Page 137: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/137.jpg)
My T. [email protected]
137
Objective
Study the problem of predicting the tertiary structure of a given protein sequence
![Page 138: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/138.jpg)
My T. [email protected]
138
A Few Examples
actual predicted actual
actual actual
predicted
predicted predicted
![Page 139: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/139.jpg)
My T. [email protected]
139
Two Comparative Modeling
Homology modeling – identification of homologous proteins through sequence alignment; structure prediction through placing residues into “corresponding” positions of homologous structure models
Protein threading – make structure prediction through identification of “good” sequence-structure fit
We will focus on the Protein Threading.
![Page 140: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/140.jpg)
My T. [email protected]
140
Why it Works?
Observations: Many protein structures in the PDB are very similar
Eg: many 4-helical bundles, globins… in the set of solved structure
Conjecture: There are only a limited number of “unique”
protein folds in nature
![Page 141: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/141.jpg)
My T. [email protected]
141
Threading Method
General Idea: Try to determine the structure of a new sequence by
finding its best ‘fit’ to some fold in library of structures
Sequence-Structure Alignment Problem: Given a solved structure T for a sequence t1t2…tn
and a new sequence S = s1s2… sm, we need to find the “best match” between S and T
![Page 142: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/142.jpg)
My T. [email protected]
142
What to Consider
How to evaluate (score) a given alignment of s with a structure T?
How to efficiently search over all possible alignments?
![Page 143: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/143.jpg)
My T. [email protected]
143
Three Main Approaches
Protein Sequence Alignment 3D Profile Method Contact Potentials
![Page 144: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/144.jpg)
My T. [email protected]
144
Protein Sequence Alignment Method
Align two sequences S and T If in the alignment, si aligns with tj, assign si to the
position pj in the structure
Advantages: Simple
Disadvantages: Similar structures have lots of sequence variability, thus
sequence alignment may not be very helpful
![Page 145: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/145.jpg)
My T. [email protected]
145
3D Profile Method
Actually uses structural information Main idea:
Reduce the 3D structure to a 1D string describing the environment of each position in the protein. (called the 3D profile (of the fold))
To determine if a new sequence S belongs to a given fold T, we align the sequence with the fold’s 3D profile
First question: How to create the 3D profile?
![Page 146: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/146.jpg)
My T. [email protected]
146
Create the 3D Profile
For a given fold, do:1. For each residue, determine:
How buried is it? Fraction of surrounding environment that is polar What secondary structure is it in (alpha-helix, beta-
sheet, or neither)
![Page 147: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/147.jpg)
My T. [email protected]
147
Create the 3D profile
2. Assign an environment class to each position:
Six classes describe the burial and polarity criteria (exposed, partially buried, very buried, different fractions of polar environment)
![Page 148: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/148.jpg)
My T. [email protected]
148
Create the 3D Profile
These environment classes depend on the number of surrounding polar residues and how buried the position is.
There are 3 SS for each of these, thus have 18 environment classes
![Page 149: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/149.jpg)
My T. [email protected]
149
Create the 3D Profile
3. Convert the known structure T to a string of environment descriptors:
4. Align the new sequence S with E using dynamic programming
![Page 150: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/150.jpg)
My T. [email protected]
150
Scores for Alignment
Need scores for aligning individual residues with environments.
Key: Different aa prefer diff. environment. Thus determine scores by looking at the statistical data
![Page 151: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/151.jpg)
My T. [email protected]
151
Scores for Alignment
1. Choose a database of known structures
2. Tabulate the number of times we see a particular residue in a particular environment class -> compute the score for each env class and each aa pair
3. Choose gap penalties, eg. may charge more for gaps in alpha and beta environments…
![Page 152: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/152.jpg)
My T. [email protected]
152
Alignment
This gives us a table of scores for aligning an aa sequence with an environment string
Using this scoring and Dynamic Programming, we can find an optimal alignment and score for each fold in our library
The fold with the highest score is the best fold for the new sequence
![Page 153: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/153.jpg)
My T. [email protected]
153
Contact Potentials Method
Take 3D structure into account more carefully Include information about how residues interact with
each other Consider pairwise interactions between the position pi, pj in
the fold For a given alignment, produce a score which is the sum over
these interactions:
![Page 154: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/154.jpg)
My T. [email protected]
154
Problem
Have a sequence from the database T = t1…tn with known positions p1…pn, and a new sequence S = s1…sm.
Find 1 <= r1 < r2 < … < rn < m which maximize
where ri is the index of the aa in S which occupies position pi
This problem is NP-complete for pairwise interactions
![Page 155: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/155.jpg)
My T. [email protected]
155
How to Define that Score?
Use so-called “knowledge-based potentials”, which comes from databases of observed interactions.
The general form:
![Page 156: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/156.jpg)
My T. [email protected]
156
How to Define the Score
General Idea: Define cutoff parameter for “contact” (e.g. up to 6
Angstroms) Use the PDB to count up the number of times aa i
and j are in contact
Several method for normalization. Eg. Normalization is by hypothetical random frequencies
![Page 157: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/157.jpg)
My T. [email protected]
157
Other Variations
Many other variations in defining the potentials In addition to pairwise potentials, consider
single residue potentials Distance-dependent intervals:
Counting up pairwise contacts separately for intervals within 1 Angstrom, between 1 and 2 Angstroms…
![Page 159: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/159.jpg)
My T. [email protected]
159
Contact Graph
1. Each residue as a vertex2. One edge between two
residues if their spatial distance is within given cutoff.
3. Cores are the most conserved segments in the template
template
![Page 164: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/164.jpg)
My T. [email protected]
164
Graph Labeling Problem Each core as a vertex
Two cores interact if there is an interaction between any two residues, each in one core
Add one edge between two cores that interact.
Each possible sequence alignment position for a single corecan be treated as a possible label assignment to a vertex in GD[i] = be a set of all possible label assignments to vertex i.Then for each label assignment A(i) in D[i], we have:
a
b
c
d f
e
m
l k j
i
h
s
![Page 166: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/166.jpg)
My T. [email protected]
166
Tree Decomposition[Robertson & Seymour, 1986]
h
Greedy: minimum degree heuristic
a
b
c
d f
e
m
l k j
i
g
ac
d f
e
m
k j
i
h
gabd
l
1. Choose the vertex with minimum degree2. The chosen vertex and its neighbors form a
component3. Add one edge to any two neighbors of the chosen
vertex4. Remove the chosen vertex5. Repeat the above steps until the graph is empty
![Page 167: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/167.jpg)
My T. [email protected]
167
Tree Decomposition (Cont’d)
Tree Decomposition
a
b
c
d f
e
m
l k j
i
h
gabd acd
clk
cdem defm
fgh
eij
ab ac
clk
cf
fgh
ij
remove dem
![Page 168: Computational Molecular Biology](https://reader035.fdocuments.us/reader035/viewer/2022070410/5681465a550346895db37943/html5/thumbnails/168.jpg)
My T. [email protected]
168
Tree Decomposition-Based Algorithms
1. Bottom-to-Top: Calculate the minimal F function
2. Top-to-Bottom: Extract the optimal assignment
))(,())(,())(,())(,( min)A(
iililjijXX
iri XAXScoreXAXFXAXFXAXFri
The score of subtree rooted at Xi
The score of component Xi
The scores of subtree rooted at Xj
Xr
Xp Xi
Xj XlXq
Xir
XjiXli
A tree decomposition rooted at Xr
The scores of subtree rooted at Xl