BioPerl An Introduction to Perl – by Seung-Yeop Lee XS extension – by Sen Zhang BioPerl...
-
date post
22-Dec-2015 -
Category
Documents
-
view
228 -
download
3
Transcript of BioPerl An Introduction to Perl – by Seung-Yeop Lee XS extension – by Sen Zhang BioPerl...
BioPerl
An Introduction to Perl – by Seung-Yeop Lee XS extension – by Sen Zhang BioPerl Introduction– by Hairong Zhao BioPerl Script Examples – by Tiequan Zhang
What is Perl?
Perl is an interpreted programming language that resembles both a real programming language and a shell. A Language for easily manipulating text, files, and
processes Provides more concise and readable way to do jobs
formerly accomplished using C or shells. Perl stands for Practical Extraction and Report
Language. Author: Larry Wall (1986)
Why use Perl?
Easy to use Basic syntax is C-like Type-”friendly” (no need for explicit casting) Lazy memory management A small amount of code goes a long way
Fast Perl has numerous built-in optimization features which
makes it run faster than other scripting language. Portability
One script version runs everywhere (unmodified).
Why use Perl?
Efficiency For programs that perform the same task (C and Perl), even a
skilled C programmer would have to work harder to write code that:
Runs as fast as Perl code Is represented by fewer lines of code
Correctness Perl fully parses and pre-”compiles” script before execution.
Efficiently eliminates the potential for runtime SYNTAX errors.
Free to use Comes with source code
Hello, world!
#!/usr/local/bin/perl#print “Hello, world \n”;
interpreter path ‘#’ denotes a line commment
Delimits a string
Function which outputs arguments.
Newline character
Terminator character
Basic Program Flow
No “main” function Statements executed from start to end of file. Execution continues until
End of file is reached. exit(int) is called. Fatal error occurs.
Variables
Data of any type may be stored within three basic types of variables:
Scalar List Associative array (hash table)
Variables are always preceded by a “dereferencing symbol”.
$ - Scalar variables @ - List variables % - Associative array variables
Variables
Notice that we did NOT have to Declare the variable before using it Define the variable’s data type Allocate memory for new data values
Scalar variables
References to variables always being with “$” in both assignments and accesses: For scalars:
$x = 1; $x = “Hello World!”; $x = $y;
For scalar arrays: $a[1] = 0; $a[1] = $b[1];
List variables
Lists are prefaced by an “@” symbol:@count = (1, 2, 3, 4, 5);
@count = (“apple”, “bat”, “cat”);
@count2 = @count;
A list is simply an array of scalar values. Integer indexes can be used to reference elements
of a list. To print an element of an array, do:
print $count[2];
Associative Array variables Associative array variables are denoted by the %
dereferencing symbol. Associative array variables are simply hash tables
containing scalar values Example:
$fred{“a”} = “aaa”;$fred{“b”} = “bbb”;$fred{6} = “cc”;$fred{1} = 2;
To do this in one step:%fred = (“a”, “aaa”, “b”, “bbb”, 6, “cc”, 1, 2);
Statements & Input/Output
Statements Contains all the usual if, for, while, and more…
Input/Output Any variable not starting with “$”, “@” or “%” is
assumed to be a filehandle. There are several predefined filehandles, including STDIN, STDOUT and STDERR.
Subroutines
We can reuse a segment of Perl code by placing it within a subroutine.
The subroutine is defined using the sub keyword and a name.
The subroutine body is defined by placing code statements within the {} code block symbols.
sub MySubroutine{
#Perl code goes here.
}
Subroutine call
To call a subroutine, prepend the name with the & symbol:
&MySubroutine;
Subroutine may be recursive (call themselves).
Pattern Matching
Perl enables to compare a regular expression pattern against a target string to test for a possible match.
The outcome of the test is a boolean result (TRUE or FALSE).
The basic syntax of a pattern match is
$myScalar =~ /PATTERN/
“Does $myScalar contain PATTERN ?”
Functions
Perl provides a rich set of built-in functions to help you perform common tasks.
Several categories of useful built-in function include Arithmetic functions (sqrt, sin, … ) List functions (push, chop, … ) String functions (length, substr, … ) Existance functions (defined, undef)
Perl 5
Introduce new features: A new data type: the reference A new localization: the my keyword Tools to allow object oriented programming in Perl New shortcuts like “qw” and “=>” An object oriented based liberary system focused
around “Modules”
References
A reference is a scalar value which “points to” any variable.
VariableVariable
ValueValue
ReferenceReference
Creating References
References to variables are created by using the backslash(\) operator.
$name = “bio perl”;
$reference = \$name;
$array_reference = \@array_name;
$hash_reference = \%hash_name;
$subroutine_ref = \&sub_name;
Dereferencing a Reference
Use an extra $ and @ for scalars and arrays, and -> for hashes.
print “$$scalar_reference\n”
“@$array_reference\n”
“$hash_reference->{‘name’}\n”;
Variable Localization
local keyword is used to limit the scope of a variable to within its enclosing brackets.
Visible not only from within the enclosing bracket but in all subroutine called within those brackets
$a = 1;
sub mySub
{
local $a = 2;
&mySub1($a);
}
sub mySub1
{
print “a is $a\n”;
}
a is 2
Variable Localization – cont’d
my keyword hides the variable from the outside world completely.
Totally hidden
$a = 1;
sub mySub
{
my $a = 2;
&mySub1($a);
}
sub mySub1
{
print “a is $a\n”;
}
a is 1
Object Oriented Programming in Perl (1)
Defining a class A class is simply a package with subroutines that
function as methods.
#!/usr/local/bin/perlpackage Cat;sub new {…}sub meow {…}
Object Oriented Programming in Perl (2)
$new_object = new ClassName;
$cat->meow();
Perl ObjectTo initiates an object from a class, call the class “new” method.
Using MethodTo use the methods of an object, use the “->” operator.
Object Oriented Programming in Perl (3)
Inheritance Declare a class array called @ISA.
This array store the name and parent class(es) of the new species.
package NorthAmericanCat;@NorthAmericanCat::ISA = (“Cat”);sub new { …}
Miscellaneous Constructs
qw The “qw” keyword is used to bypass the quote and
comma character in list array definitions.
@name = (“Tom”, “Mary”, “Michael”);
@name = qw(Tom Mary Michael);
Miscellaneous Constructs
=> The => operator is used to make hash definitions more
readable.
%client = {“name”, , “Michael”, “phone” , ”123-3456”, “email” , ”[email protected]”};
%client = {“name” => “Michael”, “phone” => ”123-3456”, “email” => “[email protected]”};
Perl Modules
A Perl module is a reusable package defined in a library file whose name is the same as the name of the package.
Similar to C link library or C++ class
package Foo;
sub bar { print “Hello $_[0]\n”}
sub blat { print “World $_[0]\n”:
1;
Names
Each Perl module has a unique name. To minimize name space collision, Perl provides a
hierarchical name space for modules. Components of a module name are separated by double
colons (::). For example,
Math::Complex Math::Approx String::BitCount String::Approx
Module files
Each module is contained in a single file. Module files are stored in a subdirectory hierarchy that
parallels the module name hierarchy. All module files have an extension of .pm.
Module Is stored in
Config Config.pm
Math::Complex Math/Complex.pm
String::Approx String/Approx.pm
Module libraries
The Perl interpreter has a list of directories in which it searhces for modules.
Global arry @INC
>perl –V
@INC:
/usr/local/lib/perl5/5.00503/sun4-solaris
/usr/local/lib/perl5/5.00503
/usr/local/lib/perl5/site-perl/5.005/sun4-solaris
/usr/local/lib/perl5/site-perl/5.005
Creating Modules
To create a new Perl module:
../development>h2xs –X –n Foo::Bar
Writing Foo/Bar/Bar.pm
Writing Foo/Bar/Makefile.PL
Writing Foo/Bar/test.pl
Writing Foo/Bar/Changes
Writing Foo/Bar/MANIFEST
../development>
Building Modules
To build a Perl module:
perl Makefile.PL
make
make test
make install
Create the makefile
Create test directory blib and
the installs the module in it. Run test.pl
Install your module
Using Modules
A module can be loaded by calling the use function.
use Foo;
bar( “a” );
blat( “b” );
Calls the eval function to process the code.
The 1; causes eval to evaluate to TRUE.
XS
XS is an acronym for eXternal Subroutine. With XS, we can call C subroutines directly from
Perl code, as if they were Perl subroutines.
Perl is not good at:
very CPU-intensive things, like numerical integration . very memory-intensive things. Perl programs that create
more than 10,000 hashes run slowly. system software, like device drivers. things that have already been written in other languages.
Usually…
These things are done by other highly efficient system programming languages such as C\C++.
When perl talks with C subroutine using perl C API
two things must happen: control flow - control must pass from Perl to C (and
back) C program execution Perl program execution
data flow - data must pass from Perl to C (and back) C data representation Perl data representation
In order to use perl C API
What is Perl's internal data structures. How the Perl stack works, and how a C subroutine gets
access to it. How C subroutines get linked into the Perl executable. Understand the data paths through the DynaLoader module
that associate the name of a Perl subroutine with the entry point of a C subroutine
If you do code directly to the Perl C API
You will find You keep writing the same little bits of code to move parameters on and off the Perl stack; to convert data from Perl's internal representation to C variables; to check for null pointers and other Bad Things.
When you make a mistake, you don't get bad output: you crash the interpreter.
It is difficult, error-prone, tedious, and repetitive.
What is XS?
Narrowly, XS is the name of the glue language More broadly, XS comprises a system of programs and
facilities that work together : MakeMaker, Xsub glue routine, XS language itself, xsubpp, h2xs, DynaLoader.
MakeMaker -tool
Perl's MakeMaker facility can be used to provide a
Makefile to easily install your Perl modules and scripts.
Xsub
The Perl interpreter calls a kind of glue routine as an xsub. Rather than drag the Perl C API into all our C code, we
usually write glue routines. (We'll refer to an existing C subroutine as a target routine.)
Xsub- control flow
The glue routine converts the Perl parameters to C data values, and then calls the target routine, passing it the C data values as parameters on the processor stack.
When the target routine returns, the glue routine creates a Perl data object to represent its return value, and pushes a pointer to that object onto the Perl stack. Finally, the glue routine returns control to the Perl interpreter.
Xsub-data flow
Something has to convert between Perl and C data representations.
The Perl interpreter doesn't, so the xsub has to. Typically, the xsub uses facilities in the Perl C API to get
parameters from the Perl stack and convert them to C data values.
To return a value, the xsub creates a Perl data object and leaves a pointer to it on the Perl stack.
XS - language
Glue routines provide some structure for the data flow and control flow, but they are still hard to write. So we don't.
Instead, we write XS code. XS is, more or less, a macro language. It allows us to declare target routines, and specify the correspondence between Perl and C data types.
XS is a collection of macros , while Perl docs refer to XS as a language, it is a macro language.
Xsubpp-tool xsubpp is a XS language processor, xsubpp is the program that
translates XS code to C code.
xsubpp will compile XS code into C code by embedding the constructs necessary to let C functions manipulate Perl values and creates the glue necessary to let Perl access those functions.
xsubpp expands XS macros into the bits of C code(xsub-glue routines) necessary to connect the Perl interpreter to your C-language subroutines .
write XS code so that xsubpp will do the right thing.
H2xs - tool
h2xs was originally written to generate XS interfaces for existing C libraries.
h2xs is a utility that reads a .h file and generates an outline for an XS interface to the C code.
DynaLoader-module
In order for a C subroutine to become an xsub, three things must happen Loading:the subroutine has to be loaded into memory Linking:the Perl interpreter has to find its entry point Installation:the interpreter has to set the xsub pointer in
a code reference to the entry point of the subroutine
DynaLoader.
Fortunately, all this is done for us by a Perl module called the DynaLoader.
When we write an XS module, our module inherits from DynaLoader.
When our module loads, it makes a single call to the DynaLoader::bootstrap method. bootstrap locates our link libraries, loads them, finds our entry points, and makes the appropriate calls.
Perl module
Development time
Running time
.c.h
Complier, linker
library
h2xs
XS code
xsubpp
Xsub(glue subrutine)
Perl interprator
Pure perl code
Perl C API
Output
Input
Some Manual change
DynaLoader.
An Example- Needleman-Wunsch(NW)
Sequence alignment is an important problem in the bleeding-edge field of genomics.
Sequence alignment is a combinatorial problem, and naive algorithms run in exponential time. The Needleman-Wunsch algorithm runs in (more or less) O(n^3),
Dynamic programming algorithm for global optimal sequence alignment.
Complexity analysis
The O(n^3) step in the NW algorithm is filling in the score matrix; everything else runs in linear time. We want to use the C implementation to fill in the score matrix, use the Perl implementation for everything else, and use XS to call from one to the other.
Our approach
Implement the algorithm as a straight Perl module Analyze (or benchmark) the code for performance Reimplement performance-critical methods (score
matrix filling) in C Write XS to connect the C routines to the Perl module
Performance comparison
a straight Perl implementation of the NW algorithm aligns 2 200-character sequences in 300 seconds .
XS version runs the benchmark 200x200 alignment in 3 seconds.
XS version is about 100 times faster than the Perl implementation.
Bio::Tools::pSW - pairwise Smith Waterman object
Bioperl project has pSW implementation. pSW is an Alignment Factory. It builds pairwise
alignments using the smith waterman algorithm. The alignment algorithm is implemented in C and added in
using an XS extension. The Smith-Waterman algorithm needs O(n^2) time to find
the highest scoring cell in the matrix.
What’s Bioperl?
Bioperl is not a new language It is a collection of Perl modules that
facilitate the development of Perl scripts for bio-informatics applications.
Why Bioperl for Bio-informatics?
Perl is good at file manipulation and text processing, which make up a large part of the routine tasks in bio-informatics.
Perl language, documentation and many Perl packages are freely available.
Perl is easy to get started in, to write small and medium-sized programs.
Bioperl Project
It is an international association of developers of open source Perl tools for bioinformatics, genomics and life science research
Started in 1995 by a group of scientists tired of rewriting BLAST and sequence parsers for various formats
Now there are 45 registered developers, 10-15 main developers, 5 core coordinate developers
Project website:http://bioperl.org Project FTP server: bioperl.org
How many people use Bioperl? Bioperl has been used worldwide in both
small academic labs through to enterprise level computing in large pharmaceutical companies since 1998
Bioperl Usage Survey
http://www.bioperl.org/survey.html
The current status of Bioperl The latest mature and stable version 1.0 was
released in March 2002. This new version contains 832 files. The test suite
contains 93 scripts which collectively perform 3042 functionality tests.
This new version is "feature complete" for sequence handling, the most common task in bioinformatics, it adds some new features and improve some existing features
The future of Bioperl
It is far from mature: Except sequence handling, all other
modules are not complete. The portability is not very good, not all
modules will work with on all platforms.
Bioperl resources www.bioperl.org http://www.bioperl.org/Core/bptutorial.html Example code, in the scripts/ and examples/
directories. Online course written at the Pasteur
Institute. See: http://www.pasteur.fr/recherche/unites/sis/formation/bioperl.
Biopython, biojava Similar goals implemented in different language Most effort to date has been to port Bioperl
functionality to Biopython and Biojava, so the differences are fairly peripheral
In the future, some bio-informatics tasks may prove to be more effectively implemented in java or python, interoperability between them is necessary
CORBA is one such framework for interlanguage support, and the Biocorba project is currently implementing a CORBA interface for bioperl
Bioperl-Object Oriented
The Bioperl takes advantages of the OO design to create a consistent, well documented, object model for interacting with biological data in the life sciences.
Bioperl Name space The Bioperl package installs everything in the Bio:: namespace.
Bioperl Objects Sequence handling objects
Sequence objects Alignment objects Location objects
Other Objects:3D structure objects, tree objects and phylogenetic trees, map objects, bibliographic objects and graphics objects
Sequence handling Typical sequence handling tasks:
Access the sequence Format the sequence Sequence alignment and comparison
Search for similar sequences Pairwise comparisons Multiple alignment
Sequence Objects Sequence objects: Seq, RichSeq, SeqWithQuality,
PrimarySeq, LocatableSeq, LiveSeq, LargeSeq, SeqI
Seq is the central sequence object in bioperl, you can use it to describe a DNA, RNA or protein sequence.
Most common sequence manipulations can be performed with Seq.
Sequence Annotation Bio::SeqFeature Sequence object can have
multiple sequence feature (SeqFeature) objects - eg Gene, Exon, Promoter objects - associated with it.
Bio::Annotation A Seq object can also have an Annotation object (used to store database links, literature references and comments) associated with it
Sequence Input/Output The Bio::SeqIO system was designed to
make getting and storing sequences to and from the myriad of formats as easy as possible.
Accessing sequence data Bioperl supports accessing remote databases as
well as local databases. Bioperl currently supports sequence data
retrieval from the genbank, genpept, RefSeq, swissprot, and EMBL databases
Format the sequences SeqIO object can read a stream of sequences in one
format: Fasta, EMBL, GenBank, Swissprot, PIR, GCG, SCF, phd/phred, Ace, or raw (plain sequence), then write to another file in another formatuse Bio::SeqIO; $in = Bio::SeqIO->new('-file' => "inputfilename",
'-format' => 'Fasta'); $out = Bio::SeqIO->new('-file' => ">outputfilename",
'-format' => 'EMBL'); while ( my $seq = $in->next_seq() ) {$out->write_seq($seq); }
Manipulating sequence data $seqobj->display_id(); # the human read-able id of the
sequence
$seqobj->subseq(5,10); # part of the sequence as a string
$seqobj->desc() # a description of the sequence
$seqobj->trunc(5,10) # truncation from 5 to 10 as new object
$seqobj->revcom # reverse complements sequence
$seqobj->translate # translation of the sequence…
Alignment Searching for ``similar'' sequences, Bioperl can run BLAST
locally or remotely, and then parse the result. Aligning 2 sequences with Smith-Waterman (pSW) or blast
The SW algorithm itself is implemented in C and incorporated into bioperl using an XS extension.
Aligning multiple sequences (Clustalw.pm, TCoffee.pm) bioperl offers a perl interface to the bioinformatics-
standard clustalw and tcoffee programs. Bioperl does not currently provide a perl interface for
running HMMER. However, bioperl does provide a HMMER report parser.
Alignment Objects Early versions used UnivAln, SimpleAlign Ver. 1.0 only support SimpleAlign. It
allows the user to: convert between alignment formats extracting specific regions of the alignment generating consensus sequences. …
Location Objects Bio::Locations: a collection of rather complicated
objects A Location object is designed to be associated
with a Sequence Feature object to indicate where on a larger structure (eg a chromosome or contig) the feature can be found.
SimpleAlign module Description:
It handles multiple alignments of sequences
Lightweight display/formatting and minimal manipulation
Method: new Usage : my $aln = new Bio::SimpleAlign(); Function : Creates a new simple align object Returns : Bio::SimpleAlign Args : -source => string representing the source program where this alignment came from
each_seqUsage : foreach $seq ( $align->each_seq() ) Function : Gets an array of Seq objects from the alignmentReturns : an array
length() Usage : $len = $ali->length() Function : Returns the maximum length of the alignment. To be sure the alignment is a block, use
is_flush
consensus_stringUsage : $str = $ali->consensus_string($threshold_percent) Function : Makes a strict consensus Args : Optional treshold ranging from 0 to 100. The consensus residue has to appear at least threshold % of the sequences at a given location,
otherwise a '?' character will be placed at that location. (Default value = 0%) is_flushUsage : if( $ali->is_flush() ) Function : Tells you whether the alignment is flush, ie all of the same length Returns : 1 or 0 percentage_identityUsage : $id = $align->percentage_identity Function: The function calculates the average percentage identity Returns : The average percentage identity no_sequences
Usage : $depth = $ali->no_sequences Function : number of sequence in the sequence alignmentReturns : integer
testaln.pfam 1433_LYCES/9-246 REENVYMAKLADRAESDEEMVEFMEKVSNSLGS.EELTVEERNLLSVAYKNVIGARRAS$
1434_LYCES/6-243 REENVYLAKLAEQAERYEEMIEFMEKVAKTADV.EELTVEERNLLSVAYKNVIGARRAS$
143R_ARATH/7-245 RDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAA$
143B_VICFA/7-242 RENFVYIAKLAEQAERYEEMVDSMKNVANLDV...ELTIEERNLLSVGYKNVIGARRAS$
143E_HUMAN/4-239 REDLVYQAKLAEQAERYDEMVESMKKVAGMDV...ELTVEERNLLSVAYKNVIGARRAS$
BMH1_YEAST/4-240 REDSVYLAKLAEQAERYEEMVENMKTVASSGQ...ELSVEERNLLSVAYKNVIGARRAS$
RA24_SCHPO/6-241 REDAVYLAKLAEQAERYEGMVENMKSVASTDQ...ELTVEERNLLSVAYKNVIGARRAS$
RA25_SCHPO/5-240 RENSVYLAKLAEQAERYEEMVENMKKVACSND...KLSVEERNLLSVAYKNIIGARRAS$
1431_ENTHI/4-239 REDCVYTAKLAEQSERYDEMVQCMKQVAEMEA...ELSIEERNLLSVAYKNVIGAKRAS$
Script:use Bio::AlignIO
$str = Bio::AlignIO->new('-file' => 'testaln.pfam');
$aln = $str->next_aln();
print $aln->length, "\n";
print $aln->no_residues, "\n";
print $aln->is_flush, "\n";
print $aln->no_sequences, "\n";
print $aln->percentage_identity, "\n";
print $aln->consensus_string(50), "\n";
$pos = $aln->column_from_residue_number('1433_LYCES', 14); # = 6;
foreach $seq ($aln->each_seq) {
$res = $seq->subseq($pos, $pos);
$count{$res}++;
}
foreach $res (keys %count) {
printf "Res: %s Count: %2d\n", $res, $count{$res};
}
Result:argerich-54 bio>: perl align.pl
242
103
1
16
66.9052451661147
RE??VY?AKLAEQAERYEEMV??MK?VAE??????ELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEE??G?N?????LIKEYR?KIE?EL??IC?DVL?LLD??LIP?A?????ESKVFYLKMKGDYYRYLAEFA?G??RKE?AD?SL?AYK?A?DIA?AEL?PTHPIRLGLALNFSVFYYEILNSPD?AC?LAKQAFDEAIAELDTL?EESYKDSTLIMQLLRDNLTLWTSD?????
Res: Q Count: 5
Res: Y Count: 10
Res: . Count: 1
argerich-55 bio>:
SwissProt,Seq and SeqIO modules
Description:SwissProt is a curated database of
proteins managed by the Swiss Bioinformatics Institute. This is in contrast to EMBL/GenBank/DDBJ Which are archives of protein information.
It allows the dynamic retrieval of Sequence objects (Bio::Seq)
SeqIO can be used to convert different formats:
1. Fasta FASTA format 2. EMBL EMBL format 3. GenBank GenBank format 4. swiss Swissprot format 5. SCF SCF tracefile format 6. PIR Protein Information Resource
format 7. GCG GCG format 8. raw Raw format
9. ace ACeDB sequence format
Objective: loading a sequence from a remote server
Create a sequence object for the BACR_HALHA SwissProt entry
Print its Accession number and description
Display the sequence in FASTA format
Scripts:
#!/usr/bin/perluse strict;use Bio::DB::SwissProt;use Bio::Seq;use Bio::SeqIO;
my $database = new Bio::DB::SwissProt; my $seq = $database->get_Seq_by_id('BACR_HALHA');
print "Seq: ", $seq->accession_number(), " -- ", $seq->desc(), "\n\n";
my $out = Bio::SeqIO->newFh ( -fh => \*STDOUT, -format => 'fasta');
print $out $seq;
Result:
argerich-47 bio>: perl protein.pl
Seq: P02945 -- BACTERIORHODOPSIN PRECURSOR (BR).
>BACR_HALHA BACTERIORHODOPSIN PRECURSOR (BR).
MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITT
LVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGT
ILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEV
ASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR
AIFGEAEAPEPSAGDGAAATSD
argerich-48 bio>:
References:[1] L. Wall and R. Schwarz. Programming Perl. O’Reilly & Associates, Inc,
1991.[2] Web Developer’s Virtual Library. http://www.wdvl
.com/Authoring/Languages/Perl/5/[3] O’Reily Perl.com. http://www.perl.com/[4] http://archive.ncsa.uiuc.edu/General/Training/PerlIntro/[5] http://www.vis.ethz.ch/manuals/Perl/intro.html[6] http://www.fukada.com/selena/tutorials/perl5/index.html[7] http://world.std.com/~swmcd/steven/perl/module_mechanics.html[8] http://www.sdsc.edu/~moreland/courses/IntroPerl/[9] www.bioperl.org/Core/POD/Bio/SeqIO.html[10] http://docs.bioperl.org/releases/bioperl-1.0/Bio/SimpleAlign.html[11] www.pasteur.fr/recherche/unites/sis/formation/bioperl/index.html
References:[12] www.bioinformatics.com
[13] ] Bioperl: Standard Perl Modules for Bioinformatics by Stephen A Chervitz, Georg Fuellen, Chris Dagdigian, Steven E Brenner, Ewan Birney and Ian Korf Objects in Bioinformatics '98
[15] http://cvs.open-bio.org/cgi-bin/viewcvs/viewcvs.cgi/bioperl-papers/bioperldesign
[16] http://www.cpan.org
[17] http://www.maths.tcd.ie/~lily/pres2/sld008.htm
[18] http://www.sbc.su.se/~per/molbioinfo2001/dynprog/dynamic.html
[19] http://world.std.com/~swmcd/steven/perl/pm/xs/intro/index.html