ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The...
Transcript of ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The...
![Page 1: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/1.jpg)
CHAPTER 7
THE PB28-13. 1 ANTIGEN-ANTIBODY
COMPLEX
Pb28 protein and therapeutic antibody 13.1
![Page 2: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/2.jpg)
The Pb28-13.1 Antigen-Antibody Complex
7.1 Introduction Every year, 300-600 million people across the globe get affected by malaria and leading
to 1-3 million deaths [Snow et. al., 2005; World malaria rep0l1]. Plasmodium after
undergoing several stages of development inside human host forms gametocytes, which
enter mosquito midgut with blood meal and form micro and mega gametes. These
gametes fuse to form zygote which develops into motile ookinete and crosses the
mosquito midgut epithelium to form oocysts. Mature oocyst releases thousands of
sporozoites, which migrate to the salivary glands of mosquito to infect another human
host. Proteins of P28 family are present on ookinete surfaces of all known Plasmodium
species [Kumar et. aI., 1985; Vermeulen et. aI., 1985; Paton et. aI., 1993]. These proteins
start expressing immediately after fertilization and present on zygote, ookinete and young
oocyst stages of Plasmodium [Fries et. al., 1990]. These proteins are distributed evenly
and abundantly over the entire ookinete surface as shown by immunofluorescent antibody
staining [Winger et. aI., 1988] and immunogold electron microscopy [Sinden ct. aI.,
1987; Duffy et. aI., 1993]. Gene knock out studies indicate that P28 proteins play
important role in parasite survival inside mosquito midgut [Tomas et. aI., 2001]. Proteins
of P28 family contain a signal sequence; four EGF (epidermal growth factor) like
domains and a C-terminal GPI (glycosylphosphatidylinositol) anchor [Kaslow ct. aI.,
1988; Tsuboi et. aI., 1998]. It is well known that EGF-domains are present in surface
proteins participating in recognition, adhesion and signaling [Appell a et. aI., 1988],
which indicates that P28 proteins may have important roles in host parasite interactions.
Also P28 protein show limited sequence polymorphisms. It is presumably because these
proteins are not expressed in the vertebrate host and never exposed to the vertebrate
immune system [Carter et. al., 1989]. The process by which transmission blocking
antibodies inhibit parasite development is not clear. Results show that transmission
blocking antibodies arrest or slow down the movement of ookinete in the mosquito
midgut [Yoshida et. aI., 1999]. The levels of antibody produced were found proportional
with transmission blocking activity observed [Kaslow et. aI., 1996]. It has been shown if
ookinetes delayed in forming oocysts, it will not be able to survive in the harsh
proteolytic environment inside mosquito midgut [Malkin et. aI., 2005]. Recombinant
versions of transmission blocking antibodies also block transmission of parasite from
76
![Page 3: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/3.jpg)
The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997; Han et. al., 2000]. The molecular structure
of scFv of 13.1 antibody bound to antigen Pb28 (Swissprot id Q04620) from P. berghei
may help in understanding mechanism of transmission blocking.
Recently, Protein-protein docking is becoming potential and popular means of
predicting antibody-antigen complex structures particularly in cases, where antigen
antibody complex crystals prove difficult to obtain [Shivasubramanian ct. af., 2006; Gray
et. al., 2006]. In some cases, atomic level accuracy is within reach. In this case we have
used ZDOCK and RDOCK programs for docking Pb28 with scFv of 13.1 antibody.
These programs have successfully recapitulated structures of many known protein
protein complexes and produced high accuracy predictions for multiple protein-protein
targets in the CAPRI challenge [Wiehe et. aI., 2005]. These programs will yield accurate
structures if some biochemical information is available for the studied complex.
Homology modeling of Pb28 protein (Swissprot id Q04620) suggested that mature Pb28
protein is a triangular flat molecule. It has four EGF domains with maximum variations
present in EGF domain III and B loop of EGF domain II, when compared with template
Pvs25 (PBD id lz27). Single chain variable fragment (scFv) of 13.1 antibody was
modeled with the help of W AM server. Loops in the W AM model were refined with the
help of ModLoop program to ensure that the CDRs of the scFv are modeled correctly.
Docking of Pb28 protein model with scFv of 13.1 antibody showed that EGF domain II
of Pb28 interacts with scFv of 13.1 antibody in accordance to Spano et. al. in 1996. In P.
berghei, the transmission blocking antibody 13.1 was mapped using deletions and
overlapping peptides to the sequence GLEKAFVC on the B loop of EGF Domain 2 of
Pb28 protein [Spano et. aI., 1996].
7.2 Materials and Methods 7.2.1 Template selection
Single letter amino acid sequence of Pb28 protein was taken from Swiss-Prot (id
=Q04620) [Gasteiger et. aI., 2003] release 50.4(http://www.expasy.org!uniprot/Q04620).
In order to select suitable template for Pb28 protein, PSI-BLAST
(http://www.ncbi.nlm.nih.gov/BLAST/)[Altschulet.al. , 1993] was performed against
the PDB database (http://www.rcsb.org/pdb/Welcome.do. 51977 structures) [Berman ct.
77
![Page 4: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/4.jpg)
The Pb28-13.1 Antigen-Antibody Complex aI., 2000] which resulted in a single significant hit (E value =0.001) i.e. Pvs25 protein
from Plasmodium vivax. It is the only suitable template in PDB database for modeling
Pb28 protein. In both template and target proteins, there are 20 conserved cysteines in the
oxidized form and forming ten disulphide bonds. These disulphide bonds are formed
between 1-3, 2-4 and 5-6 cysteines of EGF domain II and EGF domain III. In case of
EGF domain I, all four cysteines are conserved forming disulphide bonds among 2-4 and
5-6 cysteines, whereas in EGF-domain IV, only four out of six cysteines are conserved.
Sequence alignment with template protein Pvs25, was done with the help of ClustalX
program (http://www.embl.de/..-.Chenna/clustalldarwinJindex.html)[Chennaet.al. , 2003].
Sequence identity between the two proteins was calculated with the help of GraphAlign
(http://daIwin.nmsu.edu/cgi-binJgraph_align.cgi)[Spaldinget.al., 2004] and Ident and
Sim program (http://www.bioinformatics.org/sms2/ident_ sim.html) [Stothard ct. o/.,
2000].
7.2.2 Homology modeling
Pb28 sequence was obtained from Swissprot database were modeled using MODELLER
version 9vl. This software implements homology modeling of proteins by satisfaction of
spatial restraints [Sali ct. a/., 1993]. Hundred models were generated for Pb28 protein
with the help of Modeller. Modeller automatically derives restraints from known related
structures. The restraints include distances, angles, dihedral angles, pairs of dihedral
angles and some other spatial restraints. Bond and angle values are taken from
CHARMM-22 force field. 3D models are generated by molecular probability density
function optimization. X-ray crystallographic structure of Pvs25 from Plasmodium vivax
(PDB id lz27) [Saxena ct. aI., 2004; Saxena et. aI., 2004; Saxena ct. aI., 2006], was used
as template. To model the variable loops ModLoop program
(http://alto.compbio.ucsf.edu/modloopllmodloop.html)wasused[Fiseret.al., 2000; Fiser
ct. aI., 2003]. B loop of EGF domain II was modeled with caution. Modeling of the scFv
of 13.1 antibody (NCBI accession no. JC581O) was done using Web Antibody Modeling
server: WAM (http://www.bath.ac.uk/cpad/)[Whitelegget.al..2000;Whiteleggct.al .•
2004] and refined with the help of Modeller and ModLoop.
78
![Page 5: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/5.jpg)
The Pb28-13.1 Antigen-Antibody Complex 7.2.3 Model evaluation
Evaluation of the models of Pb28 protein were carried out using ProSA-web
(https:llprosa.services.came.sbg.ac.at/prosa.php) [SippI et. at., 1993; Wiederstein ct. aI.,
2007], PROCHECK (http://nihserver.mbi.ucla.edu/SAVS/)[Laskowaskiet.at. , 1993]
and WHATIF programs (http://swift.cmbi.kun.nIlWIWWWII)[Vriendet.al., 1990].
Only those models were selected, which showed satisfactory PROSA, PROCHECK and
WHATIF profile [Hooft et. aI., 1996; Morris et. aI., 1992]. To model the flexible loops,
ModLoop (http://alto.compbio.ucsf.edulmodloopllmodloop.html) was used. 3D structural
superimposition for comparing the structures was done by using program STAMP, which
is a part ofVMD version 1.8.4 [Humphrey et. aI., 1996].
7.2.4 Docking
ZDOCK (v2.1) program was used to predict the antigen-antibody complex from the
unbound proteins. ZDOCK (http://zlab.bu.edulzdock!) is an initial stage protein-protein
docking program, which employs Fast Fourier Transform algorithm to translate and
rotate the antigen around the surface of the antibody. ZDOCK evaluates pairwise shape
complementarity, desolvation and electrostatic energies [Chen ct. aI., 2003]. Script
"Mark sur" was used to mark the model PDB files in order to make the files readable to
ZDOCK program. Rigid body docking was done using ZDOCK and 2000 model
complexes were generated. Refinement and ranking of the obtained models was done
with the help of RDOCK (http://zlab.bu.edulzdock!)program[Liet.al., 2003]. RDOCK
program makes significant improvements upon top ZDOCK predictions by a three-stage
energy minimization using CHARMM program. RDOCK refines complex structures,
evaluates binding free energies and reranks complexes generated by ZDOCK program.
The script "rdock.pl" was used which uses CHARMM (v32) program [Brooks ct. aI.,
1983] for energy minimization. RDOCK minimizes the complexes generated by ZDOCK
by a process involving 3 steps: Step 1, Small clashes are removed to allow small
conformational changes; Step 2, Polar interactions are optimized and Step 3,
Optimization of charged interactions. In these steps, the charges were turned off for ionic
residues in step 1 and 2. To rerank the top RDOCK predictions, script
"rerank.pl" was used. A reranked list of complexes was obtained based on electrostatic,
79
![Page 6: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/6.jpg)
The Pb28-13.1 Antigen-Antibody Complex vander Waals and Atomic contact energy (ACE) and top 30 complexes were selected out
of the 2000 solutions obtained. These top 30 complexes were divided into four different
groups based on their interaction with the EGF domain lor II or III or IV. Complexes
showing binding to B loop of EGF domain II, were selected and looked for antigen
antibody interaction. Complexes showing interaction with CDRs of the antibody were
selected and buried surface areas of these complexes were calculated using POPScomp
server (http://mathbio.nimr.mrc.ac.ukltoollpopscomp/)[Cavalloet.al. , 2003]. The
complex showing maximum buried surface area in the group was considered as the best
possible interaction between the two proteins. Residue-residue interactions for this
antigen-antibody complex were calculated usmg PDBsum server
(http://www.ebi.ac.uklthomton-srv/databases/pdbsum/upload.html)[Laskowaskiet.al. ,
2001].
7.3 Results and Discussion 7.3.1 Pb28 Protein and sequence conservation with Pvs25:
The Pb28 protein located on the surface of ookinete is considered promising malaria
transmission blocking vaccine candidate. Sequence of this P28 protein from P. berghei
anka strain was taken from Swiss-Prot release 50.4, 51977 entries
(http://au.expasy.org/sprot/). Fig. 7.6.1 depicts the multiple sequence alignment of Pb28
protein (Swiss-Prot id=Q04620) with the template protein Pvs25 (PDB id 1z27) whereas
Fig. 7.6.2 represents the Weblogo (generated from: http://weblogo.berkeley.edu/logo.cgi)
[Schneider et. aI., 1990; Crooks et. at., 2004] of P28 proteins. As represented in Fig.
7.6.2, the twenty cysteine residues are totally conserved along with other residues. These
conserved cysteines provide structural scaffold to Pb28 protein forming ten disulfide
bonds and this scaffold is conserved throughout the P28 family. Also residues that make
contacts among domains 1, 3 and 4 of Pb28 protein to form triangular shape are
conserved as shown in Table 7.5.1. Due to the presence of so many conserved cysteines,
it is predicted that proteins of P25 and P28 families evolved as a result of gene
duplication and hence should contain similar folds and domains. This prediction is further
supported by the results we obtained in this study.
80
![Page 7: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/7.jpg)
The Pb28-13.1 Antigen-Antibody Complex The Pb28 model from P28 family contains four EGF domains arranged in
triangular faschion similar to Pvs25 protein as shown in Fig. 7.6.3(A). EGF-domains
have high tolerance to polymorphism and mutations and are tolerant to insertions and
deletions, therefore a high level of similarity between the template and query protein was
expected. The structure of Pb28 protein was predicted similar to the template protein
Pvs25 [Saxena et. al., 2004; Saxena et. ai., 2004; Saxena et. at., 2006] because of the
presence of 20 conserved cysteines, 37% sequence identity and 52% sequence similarity
(residues taken as similar: GA VLI, FYW, CM, ST, KRH, DENQ, P) between the
template protein Pvs25 and target protein Pb28.
7.3.1 Template
The mature sequence of Pb28 protein from Plasmodium was taken from Swissprot
database (Swiss-Prot id=Q04620). The sequence ofPb28 protein is as follows:
>Q0462010S24_PLABA 24 kDa ookinete surface protein - P~asmodium
berghei (strain Anka) .
MNFKYSFIFLFFIQLAIRYNNAKITVDTICKGGKLIQMSNHYECKCPSGYALKTENTCEPIVKCD
KLENINKVCGEYSICINQGNFGLEKAFVCMCTNGYMLSQNICKPTRCYNYECNAGKCILDSINPN
NPVCSCDIGKILQNGKCTGTGETKCLLKCKAAEECKLTGKHYECVSKPQAPGTGSETPSNSSFMN
GMSIISIIALLVIYVIVM
Only the mature protein was modeled i.e. MNFKYSFIFLFFIQLAIRYNNA
sequence was removed from the C-terminal and GMSIISIIALL VIYVIVM sequence was
removed from N-terminal before modeling of Pb28 protein. As already mentioned, the
cysteine arrangement of Pb28 is similar to Pvs25 (PDB code: lZ27) protein with
significant sequence identity of 52% (Fig. 7.6.1). Pvs25 protein was the only structure in
PDB database showing significant similarity to Pb28 protein and therefore Pvs25 was
used as template for modeling of Pb28 protein.
7.3.3 The Pb18 Model
The model of Pb28 protein indicates three EGF domains and fourth truncated EGF
domain arranged in the form of a triangular prism as represented in Fig. 7.6.3(A).
Structural superimposition of Pb28 model with template Pvs25 shows similarity in the
over all fold of the two proteins. As compared to the template protein Pvs25, Pb28
81
![Page 8: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/8.jpg)
The Pb28-J3.1 Antigen-Antibody Complex protein contains maximum variations in the Bloop ofEGF domain II and in EGF domain
III as represented in the Fig. 7.6.3(B). A comparative study of the Pb28 protein with
Pvs25 protein showed that out of the four EGF-domains of Pb28, EGF domain I and N
have 4 cysteines. EGF domain I of Pb28 shows maximum similarity to EGF domain I of
Pvs25 with average RMSD of 1.21 A and maximum RMSD of 2.24 A whereas EGF
domain III of Pb28 shows maximum deviation to EGF domain III of Pvs25 with
maximum RMSD of 5.58 A and average RMSD of 2.79 A. EGF domain II has a
maximum RMSD of 5.07 A whereas average RMSD for EGF domain II is 2.54 A. In
case of EGF domain IV, average RMSD is 3.26A. In Pb28 EGF domain IV is larger in
comparison to Pvs28 and therefore calculating maximum RMSD was not possible in this
case. Ramachandran plot statistics of the Pb28 protein models showed that only one
residue Asn96 was present in the disallowed region as shown in Fig. 7.6.4. This Asn96
residue is present just before the disulphide bonded cysteine and change in its
conformation leads to breakage of the disulphide bond and therefore it was decided to
keep this residue as it is and no rotamers were searched. Prosa Web analysis revealed that
the Pb28 model falls within the permitted regions with a Z-score of -5.42 as shown in
Fig. 7.6.5(A) and the model obtained was found energetically favorable as represented by
the energy plot shown in Fig. 7.6.5(B).
7.3.4 Electrostatic representation Pbs28
The two faces of the Pb28 molecule reveal most of the positively charged residues on the
surface as shown in Fig. 7.6.6. In contrast to the other members of the P28 family (we
have studied six members of the family), this molecule reveals an overall positively
charged surface with a total charge of +3.00 kT. The positively charged EGF domain II
as shown in Fig. 7.6.6 (A) interacts with the negatively charged patch present on the scFv
of 13.1 antibody (Fig. 7.6.10). Edge II was found significantly positively charged on the
dorsal surface as shown in the Fig. 7.6.6(A). On ventral surface, EGF domain III showed
maximum positive residues on the surface. Negatively charged residues were few and
were concentrated primarily near the N-terminal and C-terminal pores of the molecule.
Pb28 is positively charged whereas the template Pvs25 is negatively charged (Total
charge= -10.00 kT). There is a minimal hydrophobic core with comparatively few
82
![Page 9: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/9.jpg)
The Pb28-13.1 Antigen-Antibody Complex residues that are buried; most of the residues are solvent-accessible. The positively
charged residues are mainly situated on the surface of the molecule with relatively high
accessible molecular surface indicating the probable significance of these residues in
parasite's interaction to the host cell receptors. Cysteines are present in the core region of
the Pb28 molecule with least relative surface exposure which explains why cysteines are
conserved in all the members of the P28 family of proteins. In order to identify the
residues important in interaction of ookinete to the midgut cells of mosquito, we
compared the theoretical model of Pb28 with other functionally similar proteins of the
P28 family. A similar cysteine arrangement and high sequence and structural identity
between the members have been observed. Though members of P28 family have similar
functions and all of them are supposed to have four EGF domains, they differ in their
loop regions of the EGF domains and probably that is why they are able to recognize
different antibodies and molecules. It was striking to fmd that inspite of so much
similarity in P28 sequences; the charge distribution on the surface of the molecules
differs significantly. Differential charge distribution on the surface of P28 proteins
indicates towards different functional requirements of these molecules inside the
mosquito midgut.
7.3.5 The 13.1 Antibody Model
The model of scFv of 13.1 antibody was developed with the help of WAM server
[Whitelegg et. at., 2000]. Model was further refined with the help of Modeller and
ModLoop programs as shown in Fig. 7.6.7(A and B). The refinement led to major
changes in loop conformations as indicated by the Fig. 7.6.7(C). This antibody has been
reported as an efficient transmission blocking antibody against Pb28 protein [Yoshida et.
aI., 1999; Yoshida et. aI., 2001]. The final model obtained was evaluated with the help of
Procheck, WhatIF and ProsaWeb. Ramachandran plot statistics of the antibody model
showed that no residue was present in the disallowed regions as shown in Fig. 7.6.8.
ProsaWeb analysis revealed that the Z-score (-6.39) of scFv of the 13.1 model falls
within the permitted regions as shown in Fig. 7.6.9(A) and the model obtained is
energetically favorable as shown in Fig. 7.6.9(B). To show the charge distribution on the
surface of the antibody, electrostatic presentation of the molecule was made with the help
83
![Page 10: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/10.jpg)
The Pb28-13.1 Antigen-Antibody Complex of GRASP [Nicholls et. al., 1991] as shown in Fig. 7.6.10. The antibody clearly
represents negatively charged surface (Total charge = -5.0 kT) in contrast to the
positively charged Pb28 protein.
7.3.6 Docking studies
To gain more understanding about transmission blocking mechanism, we docked the
models of Pb28 protein and scFv of 13.1 antibody with the help of ZDOCK program and
obtained models were refined and reranked with the help of RDOCK program. The top
30 complexes obtained were screened according to the biochemical studies available
[Yoshida et. ai., 1999; Yoshida et. ai., 2001]. All the complexes interacting with EGF
domain II were taken and checked for antigen-antibody type of interaction. The
complexes not interacting with CDRs of the scFv of antibody 13.1 were removed. The
complexes representing interactions with CDRs were selected and the best probable
complex was then chosen on the basis of maximum buried surface area. It was found that
EGF domain II of Pb28 interacts with both light and heavy chains of scFv of 13.1
antibody forming two hydrogen bonds each (Fig. 7.6.11). The heavy chain forms 80,
whereas light chain forms 136 non-bonded contacts along with the hydrogen bonds (Fig.
7.6.12). The buried surface area between Pb28 protein and scFv of 13.1 antibody was
calculated to 1940.3 A2. Fig. 7.6.12 represents the detailed interactions at molecular level.
The figure was created with the help ofLIGPLOT software [Wallace et. at., 1995]. In the
complex of Pvs25 protein with scFv of 2A8 antibody, only light chain of the antibody
participates in the complex formation, whereas in case of Pb28 protein and 13.1 antibody
both light and heavy chains of the scFv equally participate in complex formation. The
study clearly demonstrates that variability in loop regions leads to specificity for the
monoclonal antibodies and therefore each P25 and P28 molecule recognizes its specific
monoclonal antibody.
7.4 Conclusion In this study, we have carried out a detailed bioinformatics analysis of the sequence and
structure of Pb28 in order to gain understanding of the functional aspects of this protein.
Comparative studies between theoretical model of Pb28 (Modelled by us) and
84
![Page 11: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/11.jpg)
The Pb28-13.1 Antigen-Antibody Complex functionally similar Pvs25, indicated that EGF domain I of Pb28 shows maximum
similarity to EGF domain I of Pvs25 whereas EGF domain III showed maXlmum
deviation. Maximum variations were found in the loop regions. These loop regions are
responsible for variable molecular recognition among P25 and P28 proteins. These
studies also indicate towards the probable differences in the active sites of these proteins
and may help in explaining why EGF domain II of Pb28 interacts with scFv of 13.1
antibody. Antigen-antibody interaction study of Pb28 and scFv of 13.1 antibody showed
that EGF domain II of Pb28 interacted with both light and heavy chains of scFv of the
transmission blocking antibody 13.1 (Fig. 7.6.11) forming two hydrogen bonds each.
Buried surface area between the two was calculated to be 1940.3 A2. Our study has
drawn attention to the functionally important region and provides a pointer to
experimental work to validate the observations made here based on in silica analysis. It
has been shown earlier by Spano et. al. (1996) [Spano et. al., 1996] that the Gly-Leu-Glu
Lys-Ala-Phe-Val-Cys sequence on the B loop of EGF Domain II of Pb28 interacts with
13.1 antibody which provides an experimental support to our study .. The study also
demonstrates that the interaction of the ookinete surface proteins to their respective
transmission blocking antibody is likely to differ in P28 proteins and that loops are the
major areas, where the specificity of transmission blocking antigen-antibody interaction
lies.
85
![Page 12: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/12.jpg)
The Pb28-13.1 Antigen-Antibody Complex
7.5 Tables
Table 7.5.1: Conserved domain interactions between Pb28 and Pvs25
(Note: In the column Atom name, E represents epsilon, G represents gamma and Z represents zeta.)
<-----A TOM 1-----> EGF- <-----A TOM 2 ----> EGF- H-Bond Atom I Atom I Res I Res domain Atom I Atom I Res I Res domain Distance no. name name no. involved no. name name no. involved 109 NE2 GLN 15 I <--> 997 0 LYS 132 III 2.88 120 N SER 17 I <--> 869 0 CYS 114 III 2.68 123 OG SER 17 I <--> 864 N CYS 114 III 2.66 126 N ASN 18 I <--> 861 OG SER 113 III 2.96 136 N01 HIS 19 I <--> 861 OG SER 113 III 2.73
36 001 ASP 5 I <-->1026 NZ LYS 136 IV 2.70 103 N GLN 15 I <-->1136 0 TYR 150 IV 3.08 111 0 GLN 15 I <-->1125 N TYR 150 IV 2.95 108 OE1 GLN 15 I <-->1004 N LEU 134 IV 2.88 220 N LEU 30 I <--> 409 OE1 GLU 54 II 3.06 227 0 LEU 30 I <--> 413 N TYR 55 II 2.71
Table 7.5.2: Pbs21 and TBmAb 13.1 interaction interface statistics
(Note: In the column Atom name, E represents epsilon, G represents gamma and Z represents zeta.)
Chain No. of Interface No. of No. of No. of No. of Interface area (A2) salt disulphide Hydrogen Non-bonded residues bridges bonds bonds contacts
A-H 8:11 386:368 - - 2 80 A-L 15:14 665:718 - - 2 136
Hydrogen bond formation between Pb28 protein and scFv TBmAb 13.1
S. <-----A TOM 1 -----> <----- A TOM 2 ----->
No. Atom I Atom I Res. I Res. no. Atom I Atom I Res. I Res. no. I Bond no. name name & Chain no. name name & Chain length
Hydrogen bonds formed by light chain
1 2737 10 I ASN I 288(A) 491 I OG I SER I 56(L) 12.72),. 2 2928 10 I SER I 309(A) 704 I N I GLU I 81(L) 12.67 A Hydrogen bonds formed by heavy chain
1 2745 INE2 I GLN I 289(A) 2074 10 I ASP I 217(H) I 2.73 A 2 2815 IN I ALA I 297(A) 2079 ISG I CYS I 218(H) 12.82A
86
![Page 13: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/13.jpg)
7.6 FIGURES A 10 20 30 '90 50
Pb28 Pvs25
Pb28 Pvs25
Pb28 Pvs25
Pb28 Pvs25
B
r ~ ~
~ .. c: Q)
::E
... ~~~.~.:iI 1 2 3 4 5
60 70 80 90 100
.. I .. . I .... ;,'b~i<j:\~4tG~~N&~~~·, . "&~4i Pf\QVNMYftI4IJrSKlm~LD'I;2 KlJ;E$
6 7 8 9 10 11 12 110 140 150
iiLD~IN~~~~' IlVX·,'LSEIQS
13 1415 16 17 18 19 160 170
LTGK SKPC!l\rCIrGSXTP.'IlSSFMI'~ •••••••• 1 •••• 1 •••• ' •••• , ••••
rNEG ;2C---MElJFTFDKEIflvCLGP
20
100 I I I I I ~
90 80 70
r----% Identity=36.9% ~
~ ~-:~ Crit. % Identity= 42% =- .--
60 50 40
-. - --. 1 . /\ -. " .- {,.liJ -.. - 1 1 .- -~ ''/'' r' I, -- -
30 20
r--. "\1\ n._ .... r.J' .. \,...J~, / I~I
\jl'\r"
.
r- J L' 10 l-
0 I I I I I I I I
20 40 60 80 100 120 140 160 180
Alignment position -----+.
Figure 7.6.1: (A) Sequence alignment of query sequence Pb28 belonging to P28 family of ookinete surface antigens with template sequence Pvs25 (PDB id lz27). Completely conserved residues between the two sequences are shown in black background whereas the semi conserved residues are shown in gray background. The 20 conserved cysteines are indicated by brick red vertical rectanglcs in the background. Negatively charged (D and E), positively charged (K and R), polar (N, Q, S and T), aliphatic (I, L, M and V) and aromatic (F and Y) residues are shown in red, blue, bluish-purple, green and cyan color respectively. Histidine, glycine, proline are represented in pink, buff and gray color respectively. (B) represents the numerical and graphical form of the percent identity between target (Pys25 starting from AITP A) and template (Pvs25) sequences.
![Page 14: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/14.jpg)
Weblogo: P28 family
EGF domain I
4
3 EGF domain II
~2D' _x~~~Jl{~~fl~ ~ ~e~~ ~gL~~~ N-NM.~~~G~~=~~~~~~S~~N~~~~~~~~~M~R~~~~~~~·~~~~~~~c
4
4
3
EGF domain III
EGF domain IV
Figure 7.6.2: Weblogo representation for 6 sequences of P28 family of ookinete surface antigens. All the members are represented in Table-7.S.1. Each logo consists of stacks of symbols, one stack for each position in the sequence. The overall height of the stack indicates the sequence conservation at that position, while the height of symbols within the stack indicates the relative frequency of each amino acid. Negatively charged (D and E), positively charged (K and R), and cysteine (C) residues are shown in red, blue and yellow color respectively whereas rest all residues are in black color. Conservation of cysteine residues in all the four EGF domains is well represented by the logos above.
![Page 15: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/15.jpg)
A
B
EGF domain I EGF domain II
• EGF domain III • EGF domain IV
Figure 7.6.3: A) Cartoon representation of the model of Pb28. The model was generated assuming that the disulfide connectivity of 20 cysteines (shown in yellow CPK representation) in Pb28 is the same as that in the template Pvs25 (PDB id 1Z27). Prs25 model shows four EGF domains as shown above. All the four EGF domains of the molecule are shown in different colors with EGF-domain I in blue, EGF-domain II in red, EGF-domain III in gray and EGF-domain IV in orange color. B) Superimposed structures of Pb28 and Pvs25(C-alpha atoms only) after structural alignment using program STAMP. Superimposition between theoretical 3D model of Pb28 and template Pvs25 shows similarity in the overall fold of the two proteins. EGF domain III and B-Ioop ofEGF domain II shows maximum variations.
![Page 16: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/16.jpg)
180
135
90
45 --- a Vl
<!.) <!.) • :... bJ)
0 <!.) "0 '-" Vl
0...
-45
-90
-135 b
I b
·-1
. J
• ...!.. . ~ • •
•
•
f-l l - p .. • I
Phi (degrees)
Plot statistics
Re,idues inlllost favolU'ed regions [A-B.L) Re,idues in addition.1l allo\yed regions [a.b.l.p) Residues in generously a]]O\yed regiom [-a.-b,-l.-p] Residues ill dis.111owed regions
Kumber of non-glycine ond non-proline residues
Kumb.:r of end-residues (excl. Gly and Pro)
Kumb.:r of glycine residues (shown as triangles) Kumber of proline re.,idues
T otaillumber of residues
. ~
ASN ~6 (G)
'"
122 24 1 1
148
.:!
15 8
173
- b '" b
CYSJJ2 (~ •
'"
'"
- b
82.4% 16.2% 0.7% 0.7%
100.0%
Figure 7.6.4: Ramachandran plot for theoretical 3D model of Pb28 using x-ray crystallographic structure of native Pvs25 protein (PDB id lZ27) as a template. Number of residues in most favored regions were 82.4%. Number of residues in allowed region 16.2%. Residues in generously allowed regions 0.7% and number of residues lying in outlier region were 0.7 %.
![Page 17: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/17.jpg)
A
Z-score=-S.42
-15
3r-------------------~~~~~
B 2
1
.3~,------------------.,..'~7 Sequence position
Figure 7.6.5: ProsaWeb analysis of theoretical 3D model ofPb28. (A) represents the Zscore plot of the Pb28 model where all the values lie within the normal range whereas (B) represents the energy plot for Pb28 model. Energy for all the residues is below zero or negative indicating the stability of the molecule.
![Page 18: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/18.jpg)
Figure 7.6.6: Electrostatic representation of theoretical structural model of malaria transmission blocking surface antigen Pb28 prepared with the help of GRASP. Surface potential was taken from -lOkT (red) to +lOkT (blue). Figure (A) represents the front view of Pb28, (B) the opposite face after 1800 rotation, (C-E) view of each edge of the molecule. ProsaWeb, PROCHECK and WhatIF programs were used for statistical evaluation of the final model. As represented by the different views of the molecule, in contrast to other members of P28 family the negatively charged residues are very few and the molecule is positively charged overall. EGF domain II is more positively charged (Total charge = +3 .0) on the dorsal side whereas EGF domain III is more positively charges on the ventral side of the molecule represented in blue color. The orientation in Fig (B) is the same as in Fig 3(A&B).
![Page 19: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/19.jpg)
A B
c
Figure 7.6.7: A) Cartoon representation of the model of scFv region of transmission blocking antibody 13 .1. The model was generated with the help of web antibody modeling (W AM) server. B) Final model obtained after refIning scFv of 13.1 (W AM model) with the help of Modeller and ModLoop. C) Superimposed W AM model and fInal model of scFv of 13.1 to show the changes occurred after refInement of the model.
![Page 20: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/20.jpg)
180
135
90 •
45 ~ ' a IJl V V :.... 01)
0 v "0 '-" IJl
0... .!.... -45
-90
-135 -I b
·-1
.I · 1
... ~ ~
4
•
~ 4
I L1RJ 50 (A) I • · .p · • I
: ~ 4
5 Phi (degrees)
Plot stntistics
Residuo:~ in most favolU·ed region; [A.B.L] Re~idue~ in additional allowed regions [a.b.l.p 1 Residue~ in generously allowo:d regions [-a. - b. - I. -p 1 Residue; in di>'111o\\'ed region;
Kumber of non-glycine and lion-proline ro:sidues
Klllllbet· of end-residue, (excl. Gly and Pm)
KlUllbet· of glycine residue; (;hown as trianglo:s) "lUuber of proline residuo:;
T otalmuuber of ro:sidues
162 28 1 0
191
4
22 11
228
~b .4 b
4
4
4 - b
84.8% 1.:1.7% 0.5% 0.0%
100.0%
Figure 7.6.8: Ramachandran plot for theoretical 3D model of transmission blocking monoclonal antibody (TBmAb) 13.1 using X-ray crystallographic structure of native Pvs25 (PDB code lZ27) as a template. Number of residues in most favored region (84.8%). Number of residues in allowed region (14.7%). Residues in generously allowed regions = 0.5%. Number of residues lying in outlier region = 0.0 %.
![Page 21: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/21.jpg)
A
B
~ o o I/)
N
Z-score=-6.39
Number of residues ----+.
t,
,'~ ________________________________ ~~ Sequence position ---..... -
Figure 7.6.9: ProsaWeb analysis of theoretical 3D model of scFv of 13.1 antibody. (A) represents the Zscore plot of the 13.1 model where all the values lie within the normal range whereas (B) represents the energy plot for scFv of 13.1 antibody model. Energy for all the residues is below zero or negative, indicating the stability of the molecule.
![Page 22: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/22.jpg)
Figure 7.6.10: Electrostatic representation of theoretical structural model of malaria transmission blocking antibody 13.1 prepared with the help of GRASP. Surface potential was taken from -10kT (red) to +1 OkT (blue). Figure (A) represents the front view of Pb28, (B) the opposite face after 1800 rotation, (C-E) view of each edge of the molecule. Prosa Web, Procheck and WhatIF programs were used for statistical evaluation of the final model. As represented by the different views of the molecule, the negatively charged residues are present on the junction of the heavy and light chain and more towards the light chain represented in red color. Total charge on the surface ofthe molecule = -5 .00.
![Page 23: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/23.jpg)
A
B
Pb28 Model Heavy chain Light chain
Pb28 Model Heavy chain Light chain BLoop EGF domain II
-
--
Figure 7.6.11: Figure represents the model of scFv region of transmission blocking antibody 13.1 (light chain shown in yellow and heavy chain shown in magenta color) and the interaction of this region with the Pb28 model shown in cyan color. The EGF domain II of Pb28 interacts with light and heavy chain of scFv 13.1 forming two hydrogen bonds each. The light chain makes 136 non-bonded contacts whereas heavy chain forms 80 non-bonded contacts. A) scFv of TBmAb 13.1 shown in licorice presentation and Pb28 model shown in surface presentation B) CDRs of TBmAb 13.1 shown in surface representation whereas Pb28 model and rest scFv shown in cartoon representation. B loop of EGF domain II which interacts with TBmAb 13.1 is shown in dark blue cartoon representation.
![Page 24: ANTIGEN-ANTIBODY COMPLEX - Shodhgangashodhganga.inflibnet.ac.in/bitstream/10603/14658/13... · The Pb28-13.1 Antigen-Antibody Complex mosquito to human host [Tsuboi et. al., 1997;](https://reader036.fdocuments.us/reader036/viewer/2022071013/5fcbbfbdc7a995008d1067fc/html5/thumbnails/24.jpg)
A)
1111111 Non bonded contacts
- Hydrogen bonds
B
Light chain
Chaiu A Chain L
Gly290 ,)),~ I, IHII_ Glu35 " I .... /f/
Asn188 Se1'56
De287 "
Glu289
\",,1299
l\Iet301
C~'S3000 Gln310 _ ... " ,l l1 l1 '·
.,.i{!~/ l:
Ll'u308
Sl'r309
l\Il't307
T)T306
Cys302 0 ' " . .1. .lt
t'
Tyr319 1111 1111
\",,158
Gly57
Arg61
Glu80
Glu81
Glu79
Ala60
Pro39
Yal78
Pro77
Gly13
Ll'u14
c
Heavy chain
Chain A
Figure 7.6.12: A) Schematic representation of the A chain (Pb28) protein interaction with heavy and light chains of scFv of 13 ,I antibody. B) Residue interaction details of Pb28 and light chain of scFv 13.1 antibody. C) Residue interaction details of heavy chain of scFv 13.1 with Pb28 (A-chain). Non bonded interactions are shown in vertical orange lines whereas hydrogen bonds are shown by blue lines connecting the residues.