2008 Nobel Prize in Chemistry Green fluorescent protein, GFP
-
Upload
rose-stokes -
Category
Documents
-
view
105 -
download
3
description
Transcript of 2008 Nobel Prize in Chemistry Green fluorescent protein, GFP
2008 Nobel Prize in Chemistry Green fluorescent protein, GFP
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.QuickTime™ and a
TIFF (Uncompressed) decompressorare needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressorare needed to see this picture.
Osamu Shimomura Jellyfish/bioluminescence
Purified and characterized GFP (1974)
Marty Chalfie
Obtained the GFP gene (gfp) clone from Prasher in 1992.
Made promoter::GFP And Promoter::GFP::Gene expression vectors to show the When and where genes are expressed.
Roger Tsien
Figured out how GFP glows
Made variants with different colors
2008 Nobel Prize in Chemistry the other guys
Douglas Prasher The first person to realize the potential of GFP as a tracer molecule.
Cloned GFP in 1992!
Sergey A. Lukyanov
Identified and cloned GFP-like proteins in corals
QuickTime™ and aTIFF (Uncompressed) decompressorare needed to see this picture.QuickTime™ and aTIFF (Uncompressed) decompressorare needed to see this picture.
GFP
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
JellyfishAequorea victoria
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
Aequorea victoria photoorgans
GFP
Figure 2. Fluorescence excitation (full-line curve) and emission (dashed curve) spectra of native GFP from Aequorea victoria (Tsien et al., 1998).
nm
GFPMSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICTTGKLPV
PWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAARITHGMDELYK
1 atgagtaaag gagaagaact tttcactgga gtggtcccag ttcttgttga attagatggc
61 gatgttaatg ggcaaaaatt ctctgtcagt ggagagggtg aaggtgatgc aacatacgga
121 aaacttaccc ttaattttat ttgcactact gggaagctac ctgttccatg gccaacactt
181 gtcactactt tctcttatgg tgttcaatgc ttctcaagat acccagatca tatgaaacag
241 catgactttt tcaagagtgc catgcccgaa ggttatgtac aggaaagaac tatattttac
301 aaagatgacg ggaactacaa gacacgtgct gaagtcaagt ttgaaggtga tacccttgtt
361 aatagaatcg agttaaaagg tattgatttt aaagaagatg gaaacattct tggacacaaa
421 atggaataca actataactc acataatgta tacatcatgg gagacaaacc aaagaatggc
481 atcaaagtta acttcaaaat tagacacaac attaaagatg gaagcgttca attagcagac
541 cattatcaac aaaatactcc aattggcgat ggccctgtcc ttttaccaga caaccattac
601 ctgtccacac aatctgccct ttccaaagat cccaacgaaa agagagatca catgatcctt
661 cttgagtttg taacagctgc taggattaca catggcatgg atgaactata caaa
Figure 3. The tertiary structure of GFP, displaying its can-like shape with the α-helix, containing the chromophore, threading up through the can. (Brejc et al., 1997)
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
GFP color variants
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
Have altered absorbsion/emission spectra.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressorare needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.