16 th August 2013
description
Transcript of 16 th August 2013
16th August 2013
carbohydrates, lipids, proteins and nucleic acids
“Molecules of life”
Packets of instantly available energy
Energy storesStructural materialMetabolic workersLibraries of hereditary information
Cell to cell signals
Slides by : J Sen
Proteins are communication devices to conduct biological processes
How are Proteins made?
DNA
RNA
Protein
Cellular processes
Transcription
Translation
Proteins
Enzymes – that carry out chemical
reactions are largely proteins.
Most drugs bind to proteins to
repair a ‘faulty bio-machine’ to restore order in
the system (organism).
Most drugs bind to proteins to repair a ‘faulty bio-machine’ to restore order
in the system (organism).
HIV drugs that bind to a target protein exploits shape
complementarity
Viruses infect by manipulating their proteins
Isolated Viral Capsid protein
Fully formed stable virus particle
Proteins play crucial roles in all biological processesTrypsin, Chmytrypsin – enzymes
Hemoglobin, Myoglobin – transports oxygenTransferrin – transports ironFerritin – stores iron
Myosin, Actin – muscle contraction
Collagen – strength of skin and bone
Rhodopsin – light-sensitive proteinAcetylcholine receptor – responsible for transmitting nerve impluses
Antibodies – recognize foreign substancesRepressor and growth factor proetins
Slides by : Sankar
Biopolymers Building Blocks
Proteins Amino acidsNucleic acids NucleotidesCarbohydrates SugarsLipids Fatty acids
Proteins
Enzymes carry out these reactions.
Proteins are polymers of amino acids
Proteins talk to each other due to shape-complementarity.
The shape is important for its function.
Proteins are made up of 20 amino acids
NH2
H C COOHR
R varies in size, shape, charge, hydrogen-bonding capacity and chemical reactivity.
Slides by : Sankar
– a very small tool kit!!
Only L-amino acids are constituents of proteins
Slides by : Sankar
Nonpolar and hydrophobic
AcidicBasic
Slides by : Sankar
20 amino acids are linked into proteins by peptide bond
Slides by : Sankar
Peptide bond has partial double-bonded character and its rotation is restricted.
Slides by : Sankar
Polypeptide backbone is a repetition of basic unit common to all amino acids
Slides by : Sankar
YGGFL is a different polypeptide than LFGGY
Slide by : J. Sen
A Ala alanineC Cys cysteineD Asp aspartic acidE Glu glutamic acidF Phe phenylalanineG Gly glycineH His histidineI Ile isoleucineK Lys lysineL Leu leucineM Met methionineN Asn asparagineP Pro prolineQ Gln glutamineR Arg arginineS Ser serineT Thr threonineV Val valineW Trp tryptophanY Tyr tyrosine
Large proteins - sequence lengths are long.
One letter code is easier to work with than the three-letter codes for amino acids.
Slide by : Sankar
Long polymers : from 20 amino acids
Fold into compact structures
Primary structure ADDFGFIPRELALKRMKGSTPNY
Proteins
Protein Structure: Four Basic Levels
Primary Structure
Secondary Structure
Tertiary Structure
Quaternary Structure
Slides by : Sankar
Slides by : Sankar
SETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
Histone (human)
MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA
Rhodopsin (human)
An educated guess of the proteins function from the primary sequence
How does a protein’s three dimensional structure emerge?
The primary structure of the protein gives rise to the protein’s shape in the following ways:
1) It allows hydrogen bonds to form between the C=O and N-H groups of different amino acids along the length of the polypeptide chain.
2) It puts “R” groups into positions that allow them to interact. Through their interactions the chain is forced to bend and twist.
Slide by : J. Sen
The anatomy of the peptide backbone
These atoms are on the same plane.
The peptide bond is essentially plannar
Slide by : J. Sen
Second level of protein structureHydrogen bonds form at short intervals along the new polypeptide chain and they give rise to a coiled or extended pattern known as the secondary structure of the protein.
Think of the polypeptide chain as a set of rigid playing cards joined by links that can swivel a bit. Each card is a peptide group. Atoms on either side of it can rotate slightly around their covalent bonds and form bonds with neighboring atoms.
Slide by : J. Sen
Alpha helix (α helix)Features:1. It is a rod like structure.
2. Backbone is inside while side chains are on the outside.
3. Hydrogen bonding between CO and NH groups of the main chain stabilizes the structure.
4. CO group of residue R hydrogen bonds with the NH group of residue R+4.
5. Rise per residue is 1.5Å and rotation per residue is 100 degrees, therefore, residues per turn is 3.6.
6. Most α-helices observed naturally are right-handed helices.
Slide by : J. Sen
Pauling and Corey predicted the structure of α-helix 6 years before it was actually experimentally observed for the structure of Myoglobin.
The elucidation of the structure of α-helix is a landmark in Biochemistry because it was demonstrated that the conformation of a polypeptide chain can be predicted if the properties of its constituents are rigorously and precisely known.
For this work Pauling got the Nobel prize in Chemistry in 1954.The helical content of a protein may vary anywhere between 0% to 100%. 75% of AAs in Ferritin, an iron storage protein is in alpha-helices.α-helices are usually less than 45Å long. However, two or more α-helices can entwine to form a very stable structure, which can have a length of 1000Å or more. Such α-helical coiled coils are found in many structural proteins e.g. myosin, tropomyosin in muscle, Fibrin in blood, Keratin in hair etc.
α-helical coiled coil
Slide by : J. Sen
Beta sheet (β sheet)Where residues per turn is 2 (n=2) it is a β-pleated sheet structure. There are two kinds of β-pleated sheet structures either the chains (strands) are such that in two successive chains they have same directionality for N>C or they are parallel chains (parallel β-sheet) or they are in opposite/ anti-parallel orientation (anti-parallel β-sheet).
Features:1. Distance between two successive amino acids is
3.5Å.
2. The side chains are at 180° to each other.
3. Adjacent β-strands are linked by hydrogen bonds.
4. In antiparallel β-sheets the hydrogen bonds between the CO and NH of adjacent strands form between groups that are diametrically opposite to each other.
5. In parallel β-sheets hydrogen bonds between CO group of one amino acids forms with the NH group of two amino acids downstream in the other strand.
6. β-strands are depicted by arrows schematically.Slide by : J. Sen
β-sheet is an important structural element in many proteins e.g. fatty-acid binding proteins, important for lipid metabolism, are almost exclusively built of β-sheets.
Many β-strands (4-10 or more) may come together in a protein. These β-strands may be all parallel to each other or anti-parallel or mixed.
A and B are ball and stick and ribbon model of the same polypeptide, respectively. β-strands may have twists. Side view of the schematic in B demonstrates the twists.
A protein rich in β-sheets, This is a fatty acid binding protein – but not necessary that all fatty acid binding proteins are like this.
Slide by : J. Sen