The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the...

Post on 30-May-2018

218 views 0 download

Transcript of The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the...

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    1/11

    The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation

    through Interaction with the Retinoblastoma-Related Protein

    Sebastien Lageix,1Olivier Catrice,2Jean-Marc Deragon,1,3Bruno Gronenborn,2Thierry

    Pelissier,1*and Bertha Cecilia Ramrez2*

    CNRS UMR 6547 BIOMOVE, UniversiteBlaise Pascal, 63177 Aubie`re Cedex,1 Institut des Sciences du Vegetal,

    CNRS, 91198 Gif-sur-Yvette,2 and LGDP, UMR 5096, Universitede Perpignan, 66860 Perpignan Cedex,3 France

    JOURNAL OF VIROLOGY,

    Apr. 2007, p. 41774185 Vol. 81, No. 8

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    2/11

    General DescriptionThe genus Nanovirus is one of two genera in the family

    Nanoviridae, which consists of viruses with small (18-19 nm)

    virions and are multipartite (6 to 8 or more segments of

    closed ssDNA), each segment of which is circular and about

    1kb in size.

    DNA SegmentSize(nt) Putative product

    DNA-M (1) 1001 movement protein

    DNA-C2(2) 1003 Replication associated protein

    DNA-C (3) 991 cell-cycle link (Clink) protein

    DNA-N (4) 1002 nuclear shuttle protein

    DNA-S (5) 998 coat proteinDNA-V (6) 1017 Replication associated protein

    DNA-U1 (7) 988 non-structuralprotein U1

    DNA-R (8) 1005 replication initiatorprotein M-Rep

    Nanovirus

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    3/11

    >aj005967|Nanovirus|FBNYV|Cell cycle link protein Clink|

    MGLKYFSHLPEELRQKIVHDHLQQERKKEFLEKAIEDSCRRHVSLLKSDPSPSELYALSKFLDSLADYVGKQFNTRCLIKWKKDVPANIKFEVMEEQHLRLYGFVDMDDLLCREVLPPEEDDDITYEDG

    MIVNCSELDKLFEALGIKVVYITVSKNCICTPLNKDIVIS

    Cell cycle link protein - Clink

    F-Box : N of Clink is an F-Box domain characterised by LRR

    LxCxE : Motif that binds to Retinoblastoma related proteins

    Clink:

    Clink is a 17 kDa protein

    The protein binds to human RB and plant RBR invitro through LxCxE

    It interacts with Skp1, a member ofprotein complex that targets proteins

    for ubiquitin-dependent degradation by the 26S proteosome

    Clink also acts as a replication enhancer

    Does Clink interact with RBR in planta?

    What is the effect of this interaction on the cell cycle proliferation?

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    4/11

    Gluco-corticoid inducible system

    35S Gal 4 DNA BDVP 16

    ADGR

    No Gluco-corticoid

    Inactive Transcription

    Factor

    35S Gal 4 DNA BDVP 16

    ADGR

    Gluco-corticoid

    Active Transcription

    Factor

    Target Gene

    Expression

    Advantages :

    Non-toxic hormone

    Easilypermeable

    Dose dependant gene expression

    Target genes are induced without pleiotrophic effects

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    5/11

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    6/11

    T=24H

    Clink specifically induces cell cycle regulated genes

    Clink is stably expressed from the inducible Gluco-corticoid regulon

    Samples are 6-7 week old fully expanded rosette leaves

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    7/11

    Impact of Clink on Cell Cycle

    Samples are 6-7 week old fully expanded, detached rosette leaves treated with Dex/ethanol for 4 daysIn each case the sample size is 800-1,100 nuclei. Bar represents 15 microns

    A : Ethanol treated Clink transgenic

    B : Dex treated Clinkmut transgenic

    33% 10%

    19% 19%

    7% 1%

    No. represents the % of nuclei observed for each type in Clink expressing cells

    95% 5%

    Dex treated Clink transgenic

    C

    D

    E

    F

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    8/11

    A B

    C D

    Effect of Clink expression on cell size

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    9/11

    Effect of Clink expression on the Ploidy Level

    Clink expressing cells have undergone more endoreduplication cycles

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    10/11

    Ploidy Levels in FBNYV Infected Tissues

  • 8/9/2019 The Nanovirus-Encoded Clink Protein Affects Plant Cell Cycle Regulation through Interaction with the Retinoblastoma-Related Protein

    11/11