Post on 01-Apr-2015
Molecular Biology Databases
NCBI, DDBL, EMBL and others
What is a Database?
• A database can be defined as "a collection of data arranged for ease and speed of search and retrieval.“
• A DNA database contains individual records or data entries of the DNA sequences as well as information about the sequences.
• A DNA database often contains flat-files. These are relatively simple database systems in which each database is contained in a single table.
• In contrast, relational database systems can use multiple tables to store information, and each table can have a different record format.
GenBank as a Database
• GenBank is the National Institute of Health (NIH) genetic sequence database, an annotated collection of all publicly available DNA sequences.
• It is maintained by the National Center for Biotechnology Information (NCBI) within the National Institute of Health (NIH).
Anatomy of a Genome InfoSystem
Information structure– Records of hierarchical, complex documents; Tables of rows and
columns of numbers, letters, words– Table of contents, Reports, Indexing (as a reference book)– Browse thru available structure.– Search and retrieve according to biological questions– Bulk data selection & retrieval for other uses
Information content– Primary: Literature (referenced, abstracted and curated), Sequence and
feature analyses, maps, controlled vocabulary/ontologies relevant to biology, people, research methods, contacts, etc.
– Metadata describing primary data, along with protocols, notes, sourcesInformatics / software
– “Back-end” database, data collection, management, with some analyses– “Front-end” information services (hypertext web, document
search/retrieval methods); ease of understanding and usage (HCI)– “Middleware” glue code, software, etc.– Specialized application for genome data: maps, BLAST searches,
ontologies
History of Sequence Databases
• The first bioinformatics databases were constructed a few years after the first protein sequences began to become available.
• The first protein sequence reported was that of bovine insulin in 1956, consisting of 51 residues.
• Nearly a decade later, the first nucleic acid sequence was reported, that of yeast alanine tRNA with 77 bases.
• Just a year later, Dayhoff gathered all the available sequence data to create the first bioinformatic database.
• The Protein DataBank followed in 1972 with a collection of ten X-ray crystallographic protein structures, and the SWISSPROT protein sequence database began in 1987.
GenBank History
• DNA databases began in the early 1980s with a database called GenBank, which was originated by the U.S. Department of Energy to hold the short stretches of DNA sequence that scientists were just beginning to obtain from a range of organisms.
• In the early days of GenBank, rooms of technicians sat at keyboards consisting of only the four letters A, C, T and G, tediously entering the DNA-sequence information published in academic journals.
The National Center for Biotechnology Information
• Created as a part of NLM in 1988– Establish public databases
• U.S. National DNA Sequence Database
– Perform research in computational biology– Develop software tools for sequence analysis– Disseminate biomedical information
GenBank History
• Newer communication technologies enabled researchers to dial up GenBank and dump in their sequence data directly.
• The administration of GenBank was transferred to National Institutes of Health's National Center for Biotechnology Information (NCBI).
• With the advent of the World Wide Web, researchers could access the data in GenBank for free from around the globe.
• Once the Human Genome Project (HGP) began in 1990, DNA-sequence data in GenBank began to grow exponentially.
• With the introduction in the 1990s of high-throughput sequencing additions to GenBank skyrocketed.
An Interesting MetaphorFor Bioinformatics Information Flow and Databases
Cooks generate and enter the data.
Data Management makes it into a stew of blended information.
The waiters take the data from the servers to the public.
The diners are placing orders for the information they wish to consume.
Molecular Databases• Primary Databases
– Original submissions by experimentalists– Database staff organize but don’t add
additional information•Example: GenBank,SNP, GEO
• Derivative Databases– Human curated
• compilation and correction of data
• Example: SWISS-PROT, NCBI RefSeq mRNA
– Computationally Derived• Example: UniGene
– Combinations• Example: NCBI Genome Assembly
What, the scientists submit their own DNA sequences?
• Who checks for error?• Who makes people actually send their data to
the database so all can share it?• Learn from success, failure of GenBank/EMBL
extensive publicly shared bio-data• Carrot/stick approach. Granting agencies and
journals began requiring scientists to publish sequence data. Patented sequences must be entered in the databases too.
• However, there is significant public databank error due to data ownership by scientists; no inducements to update or go back and correct errors.
ATTGACTA
Primary vs. Derivative DatabasesACGTGC
TTGACA
CG
TG
AATTGACTAT
AT
AG
CC
G
ACGTGC
ACGTGC
AC
GT
GC
TTGACA
TTGACA
TTGACA
CG
TGA C
GTG
A
CG
TG
A
ATT
GA
CTA
ATTGACTA ATTGACTA
ATTGACTA
TATAGCCG
TATAGCCG
TATA
GC
CG
TATAGCCG
GenBank
TATAGCCG TATAGCCGTATAGCCGTATAGCCG
ATGA
CATT
GAGA
ATTATT
CC GAGA
ATTC
CGAGA
ATTATT
CC GAGA
ATTC
C
SequencingCenters
GAGA
ATTC
C GAGA
ATTC
C
UniGene
RefSeq
GenomeAssembly
Labs
Curators
Algorithms
TATAGCCGAGCTCCGATACCGATGACAA
GenBank is NCBI’s Primary Sequence Database
• Nucleotide only sequence database • Archival in nature• GenBank Data
– Direct submissions (traditional records )– Batch submissions (EST, GSS, STS)– ftp accounts (genome data)
• Three collaborating databases– GenBank– DNA Database of Japan (DDBJ) – European Molecular Biology Laboratory (EMBL) Database
Why use Bioinformatics Databases?
• Speed of information retrieval
• Increasing size of data sets
• Amount of information available
• Save time and money by simulating experiments prior to actual experiment (a.k.a. in silico)
How do you access Databases?
• Search engines– Programs that allow you to search the database
•Links from other sites to the search engines
•Programs that directly link to the search engines
Boolean Logic
• Why do we use Boolean operators– To narrow your search– get fewer superfluous results
– * (Wildcard) -looks for ALL entries that contain the term with the * after it
– NOT (or BUTNOT)-looks for entries with one term but not the other
– OR-looks for entries with one term or the other
• What are the Boolean Operators– AND-looks for entries with both terms
AND
Citations that contain the descriptors Food ‘AND’ Allergy only.
Food Allergy
OR
Citations that contain the descriptors Food ‘OR’ Allergy. This is a bigger set.
Food Allergy
NOT
Citations that contain the descriptors Allergy ‘NOT’ Food
* (Wildcard)
Food Allerg*
Citations that contain the descriptors
Allerg* (Allergies, Allergy, Allergen
GenBank as a Database
• GenBank identifiers are unique combination of numbers and letters used to index GenBank sequence entries.
• They can be used to retrieve information about a particular gene or DNA sequence from the GenBank database.
• This information also includes links to similar sequence entries and other public databases, making it a relational database as well as a flat file database.
What is GenBank? NCBI’s Primary Sequence
Database• Nucleotide only sequence database • Archival in nature• GenBank Data
– Direct submissions individual records (BankIt, Sequin)
– Batch submissions via email (EST, GSS, STS)– ftp accounts sequencing centers
• Data shared three collaborating databases– GenBank– DNA Database of Japan (DDBJ). – European Molecular Biology Laboratory
Database (EMBL) at EBI.
EBI
GenBankGenBank
DDBJDDBJ
EMBLEMBL
EMBLEMBL
Entrez
SRS
getentry
NIGNIGCIB
NCBI
NIHNIH
•Submissions•Updates •Submissions
•Updates
•Submissions•Updates
The International Sequence
Database Collaboration
GenBank: NCBI’s Primary Sequence Database
• full release every two months• incremental and cumulative updates daily• available only through internet
ftp://ftp.ncbi.nih.gov/genbank/
Release 131 August 2002 18,197,119 Records22,616,937,182 Nucleotides 110,000 + Species
83.65 Gigabytes of data
GenBank: NCBI’s Primary Sequence Database
• full release every two months• incremental and cumulative updates daily• available only through internet
ftp://ftp.ncbi.nih.gov/genbank/
Release 135 April 2003 24,027,936 Records31,099,264,455 Nucleotides 120,000 + Species
114 Gigabytes
GenBank: NCBI’s Primary Sequence Database
Release 139 December 2003 30,968,418 Records 36,553,368,485 Nucleotides >140,000 Species 138 Gigabytes 570 files
• full release every two months• incremental and cumulative updates daily• available only through internet
ftp://ftp.ncbi.nih.gov/genbank/
Seq
uen
ce R
eco
rds
(mil
lio
ns)
To
tal Base P
airs(b
illion
s)
'82 '84 '85 '86 '87 '88 '90 '91 '92 '93 '95 '96 '97 '98 '00 '01 '02 '030
5
10
15
20
25
30
35
0
5
10
15
20
25
30
35
40
Sequence records
Release 139: 31.0 million records 36.6 billion nucleotides
Average doubling time ≈ 12 months
Total base pairs
The Growth of GenBank
The Entrez System
Entrez Nucleotides
Primary • GenBank / EMBL / DDBJ 35,116,960
Derivative• RefSeq 259,219• Third Party Annotation 3,182
• PDB 4,703 Total 35,384,248
Entrez Protein
• GenPept (GB,EMBL, DDBJ) 3,442,298 • RefSeq 856,191
• Third Party Annotation 3,834• Swiss Prot 144,508• PIR 282,821• PRF 12,079 Total 3,442,298
BLAST nr 1,642,191
Organization of GenBank:GenBank Divisions
Records are divided into 17 Divisions.1 Patent (11 files)
5 High Throughput 11 Traditional
Traditional Divisions: Traditional Divisions: • Direct Submissions (Sequin and BankIt)
• Accurate• Well characterized
BULK Divisions: BULK Divisions: • Batch Submission (Email and FTP)
• Inaccurate• Poorly characterized
EST (288) Expressed Sequence Tag GSS (98) Genome Survey SequenceHTG (61) High Throughput GenomicSTS (3) Sequence Tagged SiteHTC (3) High Throughput cDNA
PRI (27) Primate PLN (10) Plant and FungalBCT (8) Bacterial and Archeal INV (6) InvertebrateROD (11) RodentVRL (3) ViralVRT (4) Other VertebrateMAM (1) Mammalian (ex. ROD and PRI)PHG (1) PhageSYN (1) Synthetic (cloning vectors) UNA (1) Unannotated
Entrez query: gbdiv_xxx[Properties]
Traditional GenBank Divisions
BCT Bacterial and Archeal INV InvertebrateMAM Mammalian (ex. ROD and PRI)PHG PhagePLN Plant and FungalPRI PrimateROD RodentSYN Synthetic (cloning vectors)VRL ViralVRT Other Vertebrate
•Direct Submissions (Sequin and BankIt)•Accurate•Well characterized
A Helpful Resource
• This is a link to a sample annotated GenBank Record. Click on any of the underlined links to learn more about the file structure.
• http://www.ncbi.nlm.nih.gov/Sitemap/samplerecord.html
What is an Accession Number?
• An accession number is label that used to identify a sequence in the various databases. It is a string of letters and/or numbers that corresponds to a molecular sequence.
• Examples (all for retinol-binding protein, RBP4):– X02775 GenBank genomic DNA sequence– NT_030059 Genomic contig– Rs7079946 dbSNP (single nucleotide polymorphism)– N91759.1 An expressed sequence tag (1 of 170)– NM_006744RefSeq DNA sequence (from a transcript)– NP_007635 RefSeq protein– AAC02945 GenBank protein– Q28369 SwissProt protein– 1KT7 Protein Data Bank structure record
GenBank Flat File Format
• When you click on an entry, you have opened a GenBank Flat File
• Information includes:– The Name of the
gene– The Accession
number– Journal articles
• Information (Cont)– Structural
information of the gene (eg intron/exon boundaries, promoters,etc)
– The code for the protein
– The code for the DNA (RNA-if mRNA it is the cDNA for the mRNA sequenced)
GenBank Flat File Format
LOCUS AF062069 3808 bp mRNA INV 02-MAR-2000DEFINITION Limulus polyphemus myosin III mRNA, complete cds.ACCESSION AF062069VERSION AF062069.2 GI:7144484KEYWORDS .SOURCE Atlantic horseshoe crab. ORGANISM Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus.REFERENCE 1 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE A myosin III from Limulus eyes is a clock-regulated phosphoprotein JOURNAL J. Neurosci. (1998) In pressREFERENCE 2 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (29-APR-1998) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USAREFERENCE 3 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (02-MAR-2000) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REMARK Sequence update by submitterCOMMENT On Mar 2, 2000 this sequence version replaced gi:3132700.
A Traditional GenBank Record
NCBI’s Taxonomy
ACCESSION AF062069VERSION AF062069.2 GI:7144484
Accession Number
Version NumberGI Number
Definition =Title
FEATURES Location/Qualifiers source 1..3808 /organism="Limulus polyphemus" /db_xref="taxon:6850" /tissue_type="lateral eye" CDS 258..3302 /note="N-terminal protein kinase domain; C-terminal myosin heavy chain head; substrate for PKA" /codon_start=1 /product="myosin III" /protein_id="AAC16332.2" /db_xref="GI:7144485" /translation="MEYKCISEHLPFETLPDPGDRFEVQELVGTGTYATVYSAIDKQA NKKVALKIIGHIAENLLDIETEYRIYKAVNGIQFFPEFRGAFFKRGERESDNEVWLGI EFLEEGTAADLLATHRRFGIHLKEDLIALIIKEVVRAVQYLHENSIIHRDIRAANIMF SKEGYVKLIDFGLSASVKNTNGKAQSSVGSPYWMAPEVISCDCLQEPYNYTCDVWSIG ITAIELADTVPSLSDIHALRAMFRINRNPPPSVKRETRWSETLKDFISECLVKNPEYR PCIQEIPQHPFLAQVEGKEDQLRSELVDILKKNPGEKLRNKPYNVTFKNGHLKTISGQBASE COUNT 1201 a 689 c 782 g 1136 tORIGIN 1 tcgacatctg tggtcgcttt ttttagtaat aaaaaattgt attatgacgt cctatctgtt 3781 aagatacagt aactagggaa aaaaaaaa//
GenBank Record: Feature Table
/protein_id="AAC16332.2"/db_xref="GI:7144485"
GenPept Protein IDS
Multiple Formats are available for Sequence Data
• Historically, all the DNA and Protein software was written concurrent with the establishment of the databases. So the formats needed in the databases and the software co-evolved.
• Sequence analysis software needs simpler formats than databases for speed- or else the program must be allowed to ignore most of the excess information.
>gi|603218|gb|U18238.1|MSU18238 Medicago sativa glucose-6-phosphate dehydCCACCAGATATAATTAAGTAGATCAGAGTAGAAGAAGATGGGAACAAATGAATGGCATGTAGAAAGAAGAGATAGCATAGGTACTGAATCTCCTGTAGCAAGAGAGGTACTTGAAACTGGCACACTCTCTATTGTTGTGCTTGGTGCTTCTGGTGATCTTGCCAAGAAGAAGACTTTTCCTGCACTTTTTCACTTATATAAACAGGAATTGTTGCCACCTGATGAAGTTCACATTTTTGGCTATGCAAGGTCAAAGATCTCCGATGATGAATTGAGAAACAAATTGCGTAGCTATCTTGTTCCAGAGAAAGGTGCTTCTCCTAAACAGTTAGATGATGTATCAAAGTTTTTACAATTGGTTAAATATGTAAGTGGCCCTTATGATTCTGAAGATGGATTTCGCTTGTTGGATAAAGAGATTTCAGAGCATGAATATTTGAAAAATAGTAAAGAGGGTTCATCTCGGAGGCTTTTCTATCTTGCACTTCCTCCTTCAGTGTATCCATCCGTTTGCAAGATGATCAAAACTTGTTGCATGAATAAATCTGATCTTGGTGGATGGACACGCGTTGTTGTTGAGAAACCCTTTGGTAGGGATCTAGAATCTGCAGAAGAACTCAGTACTCAGATTGGAGAGTTATTTGAAGAACCACAGATTTATCGTATTGATCACTATTTAGGAAAGGAACTAGTGCAAAACATGTTAGTACTTCGTTTTGCAAATCGGTTCTTCTTGCCTCTGTGGAACCACAACCACATTGACAATGTGCAGATAGTATTTAGAGAGGATTTTGGAACTGATGGTCGTGGTGGATATTTTGACCAATATGGAATTATCCGAGATATCATTCCAAACCATCTGTTGCAGGTTCTTTGCTTGATTGCTATGGAAAAACCCGTTTCTCTCAAGCCTGAGCACATTCGAGATGAGAAAGTGAAGGTTCTTGAATCAGTACTCCCTATTAGAGATGATGAAGTTGTTCTTGGACAATATGAAGGCTATACAGATGACCCAACTGTACCGGACGATTCAAACACCCCGACTTTTGCAACTACTATTCTGCGGATACACAATGAAAGATGGGAAGGTGTTCCTTTCATTGTGAAAGCAGGGAAGGCCCTAAATTCTAGGAAGGCAGAGATTCGGGTTCAATTCAAGGATGTTCCTGGTGACATTTTCAGGAGTAAAAAGCAAGGGAGAAACGAGTTTGTTATCCGCCTACAACCTTCAGAAGCTATTTACATGAAGCTTACGGTCAAGCAACCTGGACTGGAAATGTCTGCAGTTCAAAGTGAACTAGACTTGTCATATGGGCAACGATATCAAGGGATAACCATTCCAGAGGCTTATGAGCGTCTAATTCTCGACACAATTAGAGGTGATCAACAACATTTTGTTCGCAGAGACGAATTAAAGGCATCATGGCAAATATTCACACCACTTTTACACAAAATTGATAGAGGGGAGTTGAAGCCGGTTCCTTACAACCCGGGAAGTAGAGGTCCTGCAGAAGCAGATGAGTTATTAGAAAAAGCTGGATATGTTCAAACACCCGGTTATATATGGATTCCTCCTACCTTATAGAGTGACCAAATTTCATAATAAAACAAGGATTAGGATTATCAGGAGCTTATAAATAAGTCTTCAATAAGCTTGTGAAATTTTCGTTATAATCTCTCTCATTTTGGGGTGTATATCAAGCATTTAAGCGCGTGTTTGACACAGTTTGTGTAATAGATTTGGCTCTGAATGAAAATAAACGGGAATTGTTTCTTTTTGTTTTA
>
FastA format is a very popular solution
FASTA Definition Line>gi|603218|gb|U18238.1|MSU18238
gi number
Database Identifiersgb GenBankemb EMBLdbj DDBJsp SWISS-PROTpdb Protein Databankpir PIRprf PRFref RefSeq
Accession number
Locus Name
FASTA format
Graphics format
ASN.1 Format
• ASN.1, or Abstract Syntax Notation One, is an International Standards Organization (ISO) data representation format used to achieve interoperability between platforms.
• NCBI uses ASN.1 for the storage and retrieval of data such as nucleotide and protein sequences, structures, genomes, and MEDLINE records.
• ASN.1 permits computers and software systems of all types to reliably exchange both the data structure and content.
NCBI Software Development Tool Kit
• The "NCBI Toolbox" is a set of software and data exchange specifications used by NCBI to produce portable, modular software for molecular biology.
• The software in the Toolbox is primarily designed to read ASN.1 format records.
• It is available to the public in the toolbox/ncbi_tools directory of NCBI's ftp site, and can be used in its own right or as a foundation for building tools with similar properties.
• The readme files in the toolbox and toolbox/ncbi_tools directories of the FTP site contain more information about the toolbox and ASN.1.
Seq-entry ::= set { level 1 , class nuc-prot , descr { title "Medicago sativa glucose-6-phosphate dehydrogenase mRNA, and translated products" , source { org { taxname "Medicago sativa subsp. sativa" , db { { db "taxon" , tag id 56147 } } , orgname { name binomial { genus "Medicago" , species "sativa" , subspecies "subsp. sativa" } , mod {
Abstract Syntax Notation: ASN.1
FASTA Nucleotide
FASTAProtein
GenPept GenBank
ASN.1
/************************************************************************** asn2ff.c* convert an ASN.1 entry to flat file format, using the FFPrintArray. ***************************************************************************/#include <accentr.h>#include "asn2ff.h"#include "asn2ffp.h"#include "ffprint.h"#include <subutil.h>#include <objall.h>#include <objcode.h>#include <lsqfetch.h>#include <explore.h>
#ifdef ENABLE_ID1#include <accid1.h>#endif
FILE *fpl;
Args myargs[] = {{"Filename for asn.1 input","stdin",NULL,NULL,TRUE,'a',ARG_FILE_IN,0.0,0,NULL},{"Input is a Seq-entry","F", NULL ,NULL ,TRUE,'e',ARG_BOOLEAN,0.0,0,NULL},{"Input asnfile in binary mode","F",NULL,NULL,TRUE,'b',ARG_BOOLEAN,0.0,0,NULL},{"Output Filename","stdout", NULL,NULL,TRUE,'o',ARG_FILE_OUT,0.0,0,NULL},{"Show Sequence?","T", NULL ,NULL ,TRUE,'h',ARG_BOOLEAN,0.0,0,NULL},
NCBI ToolboxNCBI Toolbox
Toolbox Sources
ftp> open ftp.ncbi.nih.gov..ftp> cd toolboxftp> cd ncbi_tools
ftp://ftp.ncbi.nlm.gov/toolbox/ncbi_tools
Database Tools aren’t keeping pace
• Despite the huge progress in sequencing and expression analysis technologies, and the corresponding magnitude of more data that is held in the public, private and commercial databases, the tools used for storage, retrieval, analysis and dissemination of data in bioinformatics are still very similar to the original systems gathered together by researchers 15-20 years ago.
• Many are simple extensions of the original academic systems, which have served the needs of both academic and commercial users for many years.
• These systems are now beginning to fall behind as they struggle to keep up with the pace of change in the pharma industry.
Database Tools aren’t keeping pace
• Databases are still gathered, organized, disseminated and searched using flat files.
• Relational databases are still few and far between, and object-relational or fully object oriented systems are rarer still in mainstream applications.
• Interfaces still rely on command lines, fat client interfaces, which must be installed on every desktop, or HTML/CGI forms.
• Whilst they were in the hands of bioinformatics specialists, pharmas have been relatively undemanding of their tools.
• Now the problems have expanded to cover the mainstream discovery process, much more flexible and scalable solutions are needed to serve pharma R&D informatics requirements.
There are more than one type of DNA sequence in Genebank
• Genomic sequences made from genomic DNA- these do contain introns and LOTS of DNA that never becomes messenger RNA. mRNA codes for proteins.
• cDNA sequences made from mRNA- these don’t contain the introns
• ESTS (short stretches of cDNA sequences that are sort of a “rough draft”
• mtDNA from mitochondrial genomes• SNP single nucleotide polymorphisms with some
DNA variation.
Quality of the Sequence is Variable
• Some of the DNA is sequenced several times before it is added to the databases.
• Some of the DNA is sequenced very quickly on automated equipment and is input directly from the computers.
• Both are important types of information.• The “draft” is corrected by curators who
assemble the pieces into the genome.
Genome Sequencing
Draft Sequence (HTG division)
shredding
Whole BAC insert (or genome)
cloning isolating
assembly
sequencing
GSS divisionor trace archive
Working Draft Sequence
gaps
Assembly Required.
• All the data is still in the pieces used to assemble the genomes.
• So, that means all the overlapping pieces are still in the databases.
• So, searching comes up with many versions and shorter subclones: pieces which are used to assemble the “genomic contigs” or contiguous pieces which are assembled into whole chromosomes.
• Sometimes you want to use the smaller pieces, since handling the whole chromosome is awkward in sequence analysis.
40,000 to > 350,000 bp
phase 1
phase 2
phase 3 ROD
Acc = AC109609.1
Acc =AC109609.6
Acc = AC109609.10
HTG
HTG
HTG Division: High Throughput Genome
40,000 to > 350,000 bp
HTG Division: High Throughput Genome
Whole Genome Shotgun
STS Division : Sequence Tagged Sites
• Segment of gene, EST , mRNA or genomic DNA
of known position (microsatellite)• PCR with STS primers gives one product per
genome• Basis of Radiation Hybrid Mapping
– UniGene– Genome Assembly
• Related resource: Electronic PCR
http://www.ncbi.nlm.nih.gov/genome/sts/epcr.cgi
Be aware of errors in the databases
Sequence errors:• genome projects’ error rate is 1/10,000
nucleotides;• ESTs’ error rate is 1/100 nucleotides.Annotation errors: • Many databases annotate their sequences using
automated computer programs. These programs do not always give correct annotations.
• SwissProt is a protein database curated and annotated manually by biologists. It’s regarded as the most reliable database, but does not have the most up-to-date sequence information.
There is a Lot of Sequence in the Databases
• One problem is finding what you are looking for in the database.
• Try putting in the search term human beta hemoglobin into the nucleotide database. It won’t be easy to find the sequence in the 88 pages of hits!
• RefSeq was invented to help you find some of the common sequences based on a human (or now, a computer) looking over all the similar submissions of the same sequence to the database.
• RefSeq corrects some of those sequence errors by comparing lots of sequences.
RefSeq: NCBI’s Derivative Sequence Database
• Curated transcripts and proteins– reviewed– human, mouse, rat, fruit fly, zebrafish, arabidopsis,
C. elegans
• Human model transcripts and proteins
• Assembled Genomic Regions (contigs)– draft human genome– mouse genome
• Chromosome records– microbial– organelle
RefSeq Benefits• non-redundancy • explicitly linked nucleotide and protein
sequences• updates to reflect current sequence data and
biology• data validation • format consistency• distinct accession series • stewardship by NCBI staff and collaborators
The RefSeq Accession NumbersNCBI Reference Sequences
mRNAs and Proteins
NM_123456 Curated mRNANP_123456 Curated ProteinNR_123456 Curated non-coding RNAXM_123456 Predicted Transcript (human, mouse)XP_123456 Predicted Protein (human, mouse)XR_123456 Predicted non-coding RNAGene RecordsNG_123456 Reference Genomic Sequence (human)AssembliesNT_123456 Contig (Mouse and Human)NW_123456 WGS Supercontig (Mouse)NC_123455 Chromosome (Microbial, Arabidopsis )
humanmouseratfruit flyzebrafishArabidopsisMicrobial
GenBank Sequences: Human
Lipoprotein Lipase
Curated RefSeq Records: NM_, NP_
Alignment Based Models
Alignment Based Models
AA change
Alignment GeneratedTranscripts: XM_,XP_
RefSeq Contig: NT_, NW_
LOCUS NC_002695 5498450 bp DNA circular BCT 02-OCT-2001DEFINITION Escherichia coli O157:H7, complete genome.ACCESSION NC_002695VERSION NC_002695.1 GI:15829254KEYWORDS .SOURCE Escherichia coli O157:H7. ORGANISM Escherichia coli O157:H7 Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae; Escherichia.REFERENCE 1 (sites) AUTHORS Makino,K., Yokoyama,K., Kubota,Y., Yutsudo,C.H., Kimura,S., Kurokawa,K., Ishii,K., Hattori,M., Tatsuno,I., Abe,H., Iida,T., Yamamoto,K., Ohnishi,M., Hayashi,T., Yasunaga,T., Honda,T., Sasakawa,C. and Shinagawa,H. TITLE Complete nucleotide sequence of the prophage VT2-Sakai carrying the verotoxin 2 genes of the enterohemorrhagic Escherichia coli O157:H7 derived from the Sakai outbreak JOURNAL Genes Genet. Syst. 74 (5), 227-239 (1999) MEDLINE 20198780 PUBMED 10734605
RefSeq Chromosomes: NC_
Integrated WWW Access: BLAST and Entrez
Some Web Statistics
Books
GeneMap
LocusLink
Taxonomy
Structure
UniGene
Protein
OMIM
BLAST
Genome
Genes and disease
Nucleotide
0 5000 10000 15000 20000
Users Per Weekday
-25 million hits per day-150,000190,000240,000 users/per day-1.2 million Entrez searches
-PubMed alone: 1 million searches-BLAST alone: 80,000 searches per day
3 terabytes of data dowloaded daily via FTP
July 2001
Users per day
0
50000
100000
150000
200000
250000 1997 1998 1999 2000 2001
Christmas Day
Bulk GenBank Divisions
EST Expressed Sequence Tag STS Sequence Tagged SiteGSS Genome Survey SequenceHTG High Throughput Genomic
•Batch Submission and htg (email and ftp)•Inaccurate•Poorly Characterized
EST Division: Expressed Sequence Tags
RNA gene products
nucleus30,000 genes
80-100,000 uniquecDNA clones in library
- isolate unique clones -sequence once from each end
make cDNA library
5’
3’>IMAGE:275615 3', mRNA sequenceNNTCAAGTTTTATGATTTATTTAACTTGTGGAACAAAAATAAACCAGATTAACCACAACCATGCCTTACTTTATCAAATGTATAAGANGTAAATATGAATCTTATATGACAAAATGTTTCATTCATTATAACAAATTTCCAATAATCCTGTCAATNATATTTCTAAATTTTCCCCCAAATTCTAAGCAGAGTATGTAAATTGGAAGTTAACTTATGCACGCTTAACTATCTTAACAAGCTTTGAGTGCAAGAGATTGANGAGTTCAAATCTGACCAAGATGTTGATGTTGGATAAGAGAATTCTCTGCTCCCCACCTCTANGTTGCCAGCCCTC
>IMAGE:275615 5' mRNA sequenceGACAGCATTCGGGCCGAGATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGTATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGCCGTGTTGAACCATGTNGACTTTGTCACAGNCCCAAGTTNAGTTTAAGTGGGNATCGAGACATGTAAGGCAGGCATCATGGGAGGTTTTGAAGNATGCCGCNTTTTGGATTGGGATGAATTCCAAATTTCTGGTTTGCTTGNTTTTTTAATATTGGATATGCTTTTG
Unigene
• A gene-oriented view of sequence entries• UniGene collects expressed sequence
tags (ESTs) into clusters, in an attempt to form one gene per cluster.
• Use UniGene to study where your gene is expressed in the body, when it is expressed, and see its abundance.
•MegaBlast based automated sequence
clustering
•Nonredundant set of gene oriented clusters
•Each cluster a unique gene
•Information on tissue types and map locations
•Includes well-characterized genes and novel
ESTs
•Useful for gene discovery and selection of
mapping reagentshttp://www.ncbi.nlm.nih.gov/UniGene/
UniGene
EST hits A.t. serine protease mRNA
A.t. mRNA
5’ EST hits
3’ EST hits
Arabidopsis UniGene Statistics
39,855 mRNAs + gene CDSs 87,006 EST, 3'reads 42,137 EST, 5'reads+ 32,571 EST, other/unknown---------- 201,569 total sequences in clusters
Final Number of Clusters (sets)=============================== sets total
25,474 sets contain at least one known gene17,654 sets contain at least one EST16,326 sets contain both genes and ESTs
UniGene Build 14Apr. 9th, 2002
26,808115,000,000 bp25,498 expected genes5% uncharacterized transcripts
Hs UniGene Statistics 73,419 mRNAs + gene CDSs 1,181,855 EST, 3'reads 1,461,928 EST, 5'reads+ 616,609 EST, other/unknown---------- 3,333,811 total sequences in clusters
Final Number of Clusters (sets)=============================== sets total
22,431 sets contain at least one known gene97,618 sets contain at least one EST21,233 sets contain both genes and ESTs
UniGene Build 148Apr. 8th, 2002
98,8163,000,000 base pairs30 K expected genes80% uncharacterized transcripts
UniGene Collections Jul, 2002
Sequences Clusters
Homo sapiens human 3,569,546 101,602
Mus musculus mouse 2,332, 864 84,247Rattus norvegicus rat 334,582 62,220Danio rerio zebrafish 197,266 15,404Bos taurus cow 128,914 10,295Xenopus laevis frog 162,269 18,984D.melanogaster fruit fly 250,655 11, 115Anopholes gambiae mosquito 43,126 2,556PlantsArabidopsis thaliana thale cress 210,693 26,875Oryzia sativa rice 78,632 15,802Triticum aestivum wheat 139,447 12,575Hordeum vulgare barley 160,518 7,324Zea mays maize (corn) 131,668 10,301